1P8RA

Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase i.
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
308
structure length
308
Chain Sequence
b'KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDESMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase 1
publication title Structural and functional importance of first-shell metal ligands in the binuclear manganese cluster of arginase I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 105
structure length 308
sequence length 308
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2003-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1p8rA00
4Q41A 3TF3A 4IU1A 4Q3SA 2PLLA 1P8QA 1PQ3A 3GMZA 4MYFA 1P8SA 4HZEA 1WOIA 1CEVA 4IU4A 1P8RA 1HQGA 4Q3RA 4GSVA 4I06A 3F80A 4Q3TA 4MYNA 1D3VA 4MXRA 3E6KA 3NIOA 3SL0A 4RLAA 4FCIA 4Q40A 1HQXA 4GWCA 4MYLA 4IU0A 5RLAA 3RLAA 1TBLA 4RHJA 3LHLA 4Q3UA 5HJ9A 4RHQA 4FCKA 1P8OA 1P8NA 3CEVA 4GWDA 1WVAA 4IE3A 3LP4A 4DZ4A 3THEA 4IU5A 4ITYA 4IXVA 1HQFA 3PZLA 4IE1A 4HWWA 4Q3PA 4Q3VA 1ZPGA 1T5FA 3DJ8A 4RHMA 4IE2A 4GSZA 3MMRA 3THJA 2EF4A 1T5GA 1WOHA 3KV2A 3TH7A 1T4TA 2EF5A 3SJTA 2PHOA 3M1RA 4RHLA 1T4PA 3MJLA 2ZAVA 4CEVA 2CEVA 3E6VA 2A0MA 3MFVA 4RHKA 5CEVA 3E8ZA 4Q42A 1TBJA 4Q3RC 4MYKA 1WVBA 4RHIA 1TA1A 1ZPEA 3LP7A 1R1OA 3THHA 4G3HA 1XFKA 3E8QA 3GN0A 4GSMA 1P8MA 3NIPA 3E9BA 2PHAA 1GQ6A 4Q3QA 1TBHA 3MFWA 1GQ7A 1T4SA 1HQHA 1HQ5A 2EIVA 5HJAA 1P8PA 3NIQA 3SKKA 2RLAA 2AEBA 1T4RA 4IXUA 1WOGA 1RLAA 3SL1A 4HXQA
chains in the Genus database with same CATH superfamily
3C0YA 4BZ9A 5G12A 4Q41A 1C3PA 2VQJA 5EFJD 3EZTA 4IU1A 3TF3A 4Q3SA 2PLLA 1P8QA 1PQ3A 4QA6A 3GMZA 4MYFA 4LXZA 4ZUMA 5G1CA 1P8SA 4BKXB 5FUEA 4HZEA 1WOIA 1CEVA 4IU4A 1P8RA 1HQGA 4Q3RA 4GSVA 5FCWA 3EZPA 4I06A 3F80A 4Q3TA 5JI5A 3MZ4A 4MYNA 2VCGA 5EF7A 1D3VA 4MXRA 4CBYA 3E6KA 3Q9FA 5IWGA 3NIOA 3SL0A 4RLAA 3MZ7A 4FCIA 4Q40A 1HQXA 4RN0A 4GWCA 4MYLA 5G13A 5DC5A 5EFNA 3MAXA 5G0YA 5G17A 1T67A 4IU0A 2V5WA 5RLAA 3SFHA 3RLAA 5EFBD 3SFFA 1C3RA 1TBLA 4RHJA 5D1CA 3LHLA 4Q3UA 5EEKA 5A2SA 5HJ9A 4RHQA 4BZ8A 4FCKA 5D1DA 1P8OA 4BZ6A 1P8NA 1W22A 3CEVA 3MZ3A 4GWDA 5G0XA 4QA4A 1WVAA 4IE3A 2VQWG 3LP4A 5DC8A 5G3WA 4DZ4A 3C0ZA 5DC6A 5G0HA 5EEFA 3C10A 5THSA 3THEA 4IU5A 4ITYA 5G1AA 4IXVA 1HQFA 3F06A 3PZLA 4HWWA 4IE1A 4Q3PA 4Q3VA 4BZ5A 1ZPGA 4ZURA 3ZNRA 4QA0A 1T5FA 3DJ8A 4RHMA 4QA3A 4LY1A 4IE2A 1T64A 4CBTA 4GSZA 3MENA 3RQDA 3MMRA 5BWZA 3THJA 5D1BA 2EF4A 1T5GA 4A69A 1WOHA 5EEIA 4QA2A 1ZZ3A 3KV2A 3TH7A 1T4TA 1VKGA 2EF5A 3SJTA 2PHOA 3M1RA 4RHLA 5EF8A 1T4PA 3MJLA 4BZ7A 2ZAVA 4CEVA 2CEVA 3E6VA 3Q9BA 5DC7A 3EWFA 3Q9CA 2VQQA 5IX0A 5ICNB 5EEMA 2A0MA 5G0IA 3MFVA 4RHKA 5CEVA 3E8ZA 3EW8A 4Q42A 2GH6A 1TBJA 3MZ6A 1C3SA 2VQMA 4MYKA 4Q3RC 1WVBA 5LI3A 5EFHA 4RHIA 1TA1A 1ZPEA 2VQOA 3LP7A 5G0GA 3F0RA 1ZZ1A 3Q9EA 1R1OA 4QA5A 5G10A 3THHA 4G3HA 1XFKA 3E8QA 4ZUNA 5THUA 3GN0A 5G1BA 1ZZ0A 4GSMA 1P8MA 3NIPA 3E9BA 5EFGA 2PHAA 1GQ6A 4Q3QA 1TBHA 5EFKB 3MFWA 1GQ7A 1T4SA 4ZUPA 3F07A 4QA1A 1T69A 5THTA 1HQHA 1HQ5A 2EIVA 4QA7A 5HJAA 1P8PA 5EENA 3NIQA 3SKKA 4ZUOA 4CQFA 2RLAA 4RN1A 2AEBA 5G0JA 1T4RA 4RN2A 2VQVA 5G11A 4IXUA 1WOGA 1RLAA 5THVA 3ZNSA 4ZUQA 2V5XA 3SL1A 4HXQA
chains in the Genus database with same CATH topology
4Q41A 3TF3A 4IU1A 4Q3SA 2PLLA 1P8QA 1PQ3A 3GMZA 4MYFA 1P8SA 4HZEA 1WOIA 1CEVA 4IU4A 1P8RA 1HQGA 4Q3RA 4GSVA 4I06A 3F80A 4Q3TA 4MYNA 1D3VA 4MXRA 3E6KA 3NIOA 3SL0A 4RLAA 4FCIA 4Q40A 1HQXA 4GWCA 4MYLA 4IU0A 5RLAA 3RLAA 1TBLA 4RHJA 3LHLA 4Q3UA 5HJ9A 4RHQA 4FCKA 1P8OA 1P8NA 3CEVA 4GWDA 1WVAA 4IE3A 3LP4A 4DZ4A 3THEA 4IU5A 4ITYA 4IXVA 1HQFA 3PZLA 4IE1A 4HWWA 4Q3PA 4Q3VA 1ZPGA 1T5FA 3DJ8A 4RHMA 4IE2A 4GSZA 3MMRA 3THJA 2EF4A 1T5GA 1WOHA 3KV2A 3TH7A 1T4TA 2EF5A 3SJTA 2PHOA 3M1RA 4RHLA 1T4PA 3MJLA 2ZAVA 4CEVA 2CEVA 3E6VA 2A0MA 3MFVA 4RHKA 5CEVA 3E8ZA 4Q42A 1TBJA 4Q3RC 4MYKA 1WVBA 4RHIA 1TA1A 1ZPEA 3LP7A 1R1OA 3THHA 4G3HA 1XFKA 3E8QA 3GN0A 4GSMA 1P8MA 3NIPA 3E9BA 2PHAA 1GQ6A 4Q3QA 1TBHA 3MFWA 1GQ7A 1T4SA 1HQHA 1HQ5A 2EIVA 5HJAA 1P8PA 3NIQA 3SKKA 2RLAA 2AEBA 1T4RA 4IXUA 1WOGA 1RLAA 3SL1A 4HXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q41 A;  3TF3 A;  4IU1 A;  4Q3S A;  2PLL A;  1P8Q A;  1PQ3 A;  3GMZ A;  4MYF A;  1P8S A;  4HZE A;  1WOI A;  1CEV A;  4IU4 A;  1P8R A;  1HQG A;  4Q3R A;  4GSV A;  4I06 A;  3F80 A;  4Q3T A;  4MYN A;  1D3V A;  4MXR A;  3E6K A;  3NIO A;  3SL0 A;  4RLA A;  4FCI A;  4Q40 A;  1HQX A;  4GWC A;  4MYL A;  4IU0 A;  5RLA A;  3RLA A;  1TBL A;  4RHJ A;  3LHL A;  4Q3U A;  5HJ9 A;  4RHQ A;  4FCK A;  1P8O A;  1P8N A;  3CEV A;  4GWD A;  1WVA A;  4IE3 A;  3LP4 A;  4DZ4 A;  3THE A;  4IU5 A;  4ITY A;  4IXV A;  1HQF A;  3PZL A;  4IE1 A;  4HWW A;  4Q3P A;  4Q3V A;  1ZPG A;  1T5F A;  3DJ8 A;  4RHM A;  4IE2 A;  4GSZ A;  3MMR A;  3THJ A;  2EF4 A;  1T5G A;  1WOH A;  3KV2 A;  3TH7 A;  1T4T A;  2EF5 A;  3SJT A;  2PHO A;  3M1R A;  4RHL A;  1T4P A;  3MJL A;  2ZAV A;  4CEV A;  2CEV A;  3E6V A;  2A0M A;  3MFV A;  4RHK A;  5CEV A;  3E8Z A;  4Q42 A;  1TBJ A;  4Q3R C;  4MYK A;  1WVB A;  4RHI A;  1TA1 A;  1ZPE A;  3LP7 A;  1R1O A;  3THH A;  4G3H A;  1XFK A;  3E8Q A;  3GN0 A;  4GSM A;  1P8M A;  3NIP A;  3E9B A;  2PHA A;  1GQ6 A;  4Q3Q A;  1TBH A;  3MFW A;  1GQ7 A;  1T4S A;  1HQH A;  1HQ5 A;  2EIV A;  5HJA A;  1P8P A;  3NIQ A;  3SKK A;  2RLA A;  2AEB A;  1T4R A;  4IXU A;  1WOG A;  1RLA A;  3SL1 A;  4HXQ A; 
#chains in the Genus database with same CATH topology
 3C0Y A;  4BZ9 A;  5G12 A;  4Q41 A;  1C3P A;  2VQJ A;  5EFJ D;  3EZT A;  4IU1 A;  3TF3 A;  4Q3S A;  2PLL A;  1P8Q A;  1PQ3 A;  4QA6 A;  3GMZ A;  4MYF A;  4LXZ A;  4ZUM A;  5G1C A;  1P8S A;  4BKX B;  5FUE A;  4HZE A;  1WOI A;  1CEV A;  4IU4 A;  1P8R A;  1HQG A;  4Q3R A;  4GSV A;  5FCW A;  3EZP A;  4I06 A;  3F80 A;  4Q3T A;  5JI5 A;  3MZ4 A;  4MYN A;  2VCG A;  5EF7 A;  1D3V A;  4MXR A;  4CBY A;  3E6K A;  3Q9F A;  5IWG A;  3NIO A;  3SL0 A;  4RLA A;  3MZ7 A;  4FCI A;  4Q40 A;  1HQX A;  4RN0 A;  4GWC A;  4MYL A;  5G13 A;  5DC5 A;  5EFN A;  3MAX A;  5G0Y A;  5G17 A;  1T67 A;  4IU0 A;  2V5W A;  5RLA A;  3SFH A;  3RLA A;  5EFB D;  3SFF A;  1C3R A;  1TBL A;  4RHJ A;  5D1C A;  3LHL A;  4Q3U A;  5EEK A;  5A2S A;  5HJ9 A;  4RHQ A;  4BZ8 A;  4FCK A;  5D1D A;  1P8O A;  4BZ6 A;  1P8N A;  1W22 A;  3CEV A;  3MZ3 A;  4GWD A;  5G0X A;  4QA4 A;  1WVA A;  4IE3 A;  2VQW G;  3LP4 A;  5DC8 A;  5G3W A;  4DZ4 A;  3C0Z A;  5DC6 A;  5G0H A;  5EEF A;  3C10 A;  5THS A;  3THE A;  4IU5 A;  4ITY A;  5G1A A;  4IXV A;  1HQF A;  3F06 A;  3PZL A;  4HWW A;  4IE1 A;  4Q3P A;  4Q3V A;  4BZ5 A;  1ZPG A;  4ZUR A;  3ZNR A;  4QA0 A;  1T5F A;  3DJ8 A;  4RHM A;  4QA3 A;  4LY1 A;  4IE2 A;  1T64 A;  4CBT A;  4GSZ A;  3MEN A;  3RQD A;  3MMR A;  5BWZ A;  3THJ A;  5D1B A;  2EF4 A;  1T5G A;  4A69 A;  1WOH A;  5EEI A;  4QA2 A;  1ZZ3 A;  3KV2 A;  3TH7 A;  1T4T A;  1VKG A;  2EF5 A;  3SJT A;  2PHO A;  3M1R A;  4RHL A;  5EF8 A;  1T4P A;  3MJL A;  4BZ7 A;  2ZAV A;  4CEV A;  2CEV A;  3E6V A;  3Q9B A;  5DC7 A;  3EWF A;  3Q9C A;  2VQQ A;  5IX0 A;  5ICN B;  5EEM A;  2A0M A;  5G0I A;  3MFV A;  4RHK A;  5CEV A;  3E8Z A;  3EW8 A;  4Q42 A;  2GH6 A;  1TBJ A;  3MZ6 A;  1C3S A;  2VQM A;  4MYK A;  4Q3R C;  1WVB A;  5LI3 A;  5EFH A;  4RHI A;  1TA1 A;  1ZPE A;  2VQO A;  3LP7 A;  5G0G A;  3F0R A;  1ZZ1 A;  3Q9E A;  1R1O A;  4QA5 A;  5G10 A;  3THH A;  4G3H A;  1XFK A;  3E8Q A;  4ZUN A;  5THU A;  3GN0 A;  5G1B A;  1ZZ0 A;  4GSM A;  1P8M A;  3NIP A;  3E9B A;  5EFG A;  2PHA A;  1GQ6 A;  4Q3Q A;  1TBH A;  5EFK B;  3MFW A;  1GQ7 A;  1T4S A;  4ZUP A;  3F07 A;  4QA1 A;  1T69 A;  5THT A;  1HQH A;  1HQ5 A;  2EIV A;  4QA7 A;  5HJA A;  1P8P A;  5EEN A;  3NIQ A;  3SKK A;  4ZUO A;  4CQF A;  2RLA A;  4RN1 A;  2AEB A;  5G0J A;  1T4R A;  4RN2 A;  2VQV A;  5G11 A;  4IXU A;  1WOG A;  1RLA A;  5THV A;  3ZNS A;  4ZUQ A;  2V5X A;  3SL1 A;  4HXQ A; 
#chains in the Genus database with same CATH homology
 4Q41 A;  3TF3 A;  4IU1 A;  4Q3S A;  2PLL A;  1P8Q A;  1PQ3 A;  3GMZ A;  4MYF A;  1P8S A;  4HZE A;  1WOI A;  1CEV A;  4IU4 A;  1P8R A;  1HQG A;  4Q3R A;  4GSV A;  4I06 A;  3F80 A;  4Q3T A;  4MYN A;  1D3V A;  4MXR A;  3E6K A;  3NIO A;  3SL0 A;  4RLA A;  4FCI A;  4Q40 A;  1HQX A;  4GWC A;  4MYL A;  4IU0 A;  5RLA A;  3RLA A;  1TBL A;  4RHJ A;  3LHL A;  4Q3U A;  5HJ9 A;  4RHQ A;  4FCK A;  1P8O A;  1P8N A;  3CEV A;  4GWD A;  1WVA A;  4IE3 A;  3LP4 A;  4DZ4 A;  3THE A;  4IU5 A;  4ITY A;  4IXV A;  1HQF A;  3PZL A;  4IE1 A;  4HWW A;  4Q3P A;  4Q3V A;  1ZPG A;  1T5F A;  3DJ8 A;  4RHM A;  4IE2 A;  4GSZ A;  3MMR A;  3THJ A;  2EF4 A;  1T5G A;  1WOH A;  3KV2 A;  3TH7 A;  1T4T A;  2EF5 A;  3SJT A;  2PHO A;  3M1R A;  4RHL A;  1T4P A;  3MJL A;  2ZAV A;  4CEV A;  2CEV A;  3E6V A;  2A0M A;  3MFV A;  4RHK A;  5CEV A;  3E8Z A;  4Q42 A;  1TBJ A;  4Q3R C;  4MYK A;  1WVB A;  4RHI A;  1TA1 A;  1ZPE A;  3LP7 A;  1R1O A;  3THH A;  4G3H A;  1XFK A;  3E8Q A;  3GN0 A;  4GSM A;  1P8M A;  3NIP A;  3E9B A;  2PHA A;  1GQ6 A;  4Q3Q A;  1TBH A;  3MFW A;  1GQ7 A;  1T4S A;  1HQH A;  1HQ5 A;  2EIV A;  5HJA A;  1P8P A;  3NIQ A;  3SKK A;  2RLA A;  2AEB A;  1T4R A;  4IXU A;  1WOG A;  1RLA A;  3SL1 A;  4HXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...