4CEVA

Arginase from bacillus caldevelox, l-ornithine complex
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
298
Chain Sequence
KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLMAAAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARGINASE)
publication title Crystal structures of Bacillus caldovelox arginase in complex with substrate and inhibitors reveal new insights into activation, inhibition and catalysis in the arginase superfamily.
pubmed doi rcsb
source organism Bacillus caldovelox
molecule tags Hydrolase
total genus 112
structure length 298
sequence length 298
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1999-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4cevA00
1WVAA 4I06A 3CEVA 3MFWA 4IXVA 3NIPA 4Q3RA 4Q3SA 3THJA 1ZPGA 1ZPEA 4GWDA 1CEVA 2EF4A 4RHLA 1R1OA 4IU0A 4DZ4A 1T5FA 4RLAA 4FCKA 1WOHA 1WOIA 2A0MA 4HZEA 3MFVA 3TF3A 1HQFA 4IE3A 4Q40A 4GSVA 4IE2A 3SKKA 3M1RA 2ZAVA 3MJLA 4IU5A 4FCIA 3E6KA 4GSMA 4MYNA 1P8QA 3SL0A 4G3HA 3E8QA 3E9BA 1PQ3A 4Q3VA 5HJAA 1T4RA 4MYLA 4Q3QA 1P8RA 2PHAA 4MXRA 3THEA 3LHLA 4RHKA 3TH7A 1T4PA 3THHA 3NIOA 1RLAA 4IE1A 5HJ9A 4Q41A 3MMRA 4GWCA 4HXQA 3GN0A 3SL1A 4MYFA 4Q3PA 4IU1A 4RHQA 1TBJA 4GSZA 1WVBA 2EF5A 3KV2A 4Q3RC 4CEVA 4Q42A 1GQ7A 4RHJA 1P8OA 2EIVA 5CEVA 2CEVA 4IU4A 3SJTA 1HQXA 3DJ8A 1GQ6A 4RHMA 3E6VA 3F80A 1D3VA 4HWWA 1HQHA 1XFKA 3NIQA 3LP4A 4Q3TA 1HQGA 2PHOA 4ITYA 5RLAA 1T4TA 1P8SA 3PZLA 3LP7A 3GMZA 1P8PA 4Q3UA 1T4SA 1WOGA 1T5GA 4RHIA 3RLAA 1TBLA 1P8NA 1TBHA 3E8ZA 4MYKA 2RLAA 1TA1A 4IXUA 2PLLA 1HQ5A 2AEBA 1P8MA
chains in the Genus database with same CATH superfamily
4ZUMA 4ZURA 1WVAA 3MZ6A 2GH6A 4I06A 4QA0A 5IWGA 5JI5A 3CEVA 3MFWA 4IXVA 3NIPA 1ZZ0A 5D1BA 4Q3RA 4Q3SA 3THJA 1ZPGA 5DC7A 1ZPEA 2V5XA 5G3WA 4GWDA 1CEVA 5G1AA 4QA7A 2EF4A 1W22A 1T67A 4RHLA 1R1OA 3ZNSA 2VQOA 4IU0A 4DZ4A 5EFKB 1T5FA 3MZ4A 4RLAA 4FCKA 5EFHA 5G13A 3C0ZA 1WOHA 3C10A 1WOIA 2A0MA 3F07A 3MFVA 1VKGA 4HZEA 4QA4A 5EEIA 5G11A 4BZ8A 3MAXA 3Q9EA 1HQFA 4IE3A 3TF3A 5G0HA 4Q40A 5G1CA 4GSVA 4IE2A 1ZZ3A 4RN0A 3SKKA 3Q9CA 1T69A 3M1RA 3MZ7A 3F06A 4QA5A 4ZUOA 5G17A 2ZAVA 5EENA 3MJLA 4IU5A 4FCIA 3ZNRA 5LI3A 4BZ6A 1C3SA 4A69A 1T64A 3E6KA 4GSMA 1P8QA 4MYNA 5FUEA 4G3HA 5EEFA 5G0GA 3SL0A 3F0RA 5EF8A 3E8QA 2VQWG 3E9BA 1PQ3A 4Q3VA 5HJAA 1T4RA 4MYLA 4Q3QA 5EFGA 2V5WA 1P8RA 2PHAA 4MXRA 5THVA 3THEA 3LHLA 4RHKA 3C0YA 2VQVA 1T4PA 5THUA 3EZTA 3TH7A 4BKXB 5ICNB 5THSA 3THHA 1C3RA 5EFBD 3NIOA 5IX0A 1RLAA 4IE1A 5EEKA 5HJ9A 4Q41A 3MMRA 5BWZA 4GWCA 4HXQA 3GN0A 3SL1A 2VQQA 4MYFA 4QA6A 3MENA 4Q3PA 4IU1A 4CBTA 4RHQA 1TBJA 5DC5A 3KV2A 1WVBA 2EF5A 4GSZA 4Q3RC 3Q9FA 4CEVA 4Q42A 1GQ7A 4LXZA 4RHJA 5EFNA 1P8OA 4BZ7A 2EIVA 2VCGA 4QA1A 5A2SA 5CEVA 2CEVA 4IU4A 5G0YA 3SJTA 5G0JA 3DJ8A 1HQXA 5EFJD 1GQ6A 4RHMA 3Q9BA 3E6VA 4RN2A 5G0XA 3F80A 5D1DA 4QA2A 3EW8A 4BZ5A 4ZUNA 1D3VA 2VQJA 4HWWA 1HQHA 5G0IA 3MZ3A 5G12A 1XFKA 3NIQA 5D1CA 3LP4A 4CQFA 4Q3TA 1HQGA 2PHOA 4ITYA 4LY1A 5RLAA 3SFFA 5DC6A 1T4TA 5G1BA 4ZUQA 5FCWA 1P8SA 4ZUPA 5THTA 3RQDA 3PZLA 5EF7A 3LP7A 3GMZA 1P8PA 4Q3UA 5G10A 4CBYA 1T4SA 1C3PA 1T5GA 1WOGA 4RHIA 5DC8A 3RLAA 3SFHA 1TBLA 1P8NA 1TBHA 3E8ZA 4MYKA 3EZPA 2RLAA 1ZZ1A 4QA3A 1TA1A 4IXUA 4RN1A 3EWFA 2PLLA 4BZ9A 1HQ5A 2VQMA 5EEMA 2AEBA 1P8MA
chains in the Genus database with same CATH topology
1WVAA 4I06A 3CEVA 3MFWA 4IXVA 3NIPA 4Q3RA 4Q3SA 3THJA 1ZPGA 1ZPEA 4GWDA 1CEVA 2EF4A 4RHLA 1R1OA 4IU0A 4DZ4A 1T5FA 4RLAA 4FCKA 1WOHA 1WOIA 2A0MA 4HZEA 3MFVA 3TF3A 1HQFA 4IE3A 4Q40A 4GSVA 4IE2A 3SKKA 3M1RA 2ZAVA 3MJLA 4IU5A 4FCIA 3E6KA 4GSMA 4MYNA 1P8QA 3SL0A 4G3HA 3E8QA 3E9BA 1PQ3A 4Q3VA 5HJAA 1T4RA 4MYLA 4Q3QA 1P8RA 2PHAA 4MXRA 3THEA 3LHLA 4RHKA 3TH7A 1T4PA 3THHA 3NIOA 1RLAA 4IE1A 5HJ9A 4Q41A 3MMRA 4GWCA 4HXQA 3GN0A 3SL1A 4MYFA 4Q3PA 4IU1A 4RHQA 1TBJA 4GSZA 1WVBA 2EF5A 3KV2A 4Q3RC 4CEVA 4Q42A 1GQ7A 4RHJA 1P8OA 2EIVA 5CEVA 2CEVA 4IU4A 3SJTA 1HQXA 3DJ8A 1GQ6A 4RHMA 3E6VA 3F80A 1D3VA 4HWWA 1HQHA 1XFKA 3NIQA 3LP4A 4Q3TA 1HQGA 2PHOA 4ITYA 5RLAA 1T4TA 1P8SA 3PZLA 3LP7A 3GMZA 1P8PA 4Q3UA 1T4SA 1WOGA 1T5GA 4RHIA 3RLAA 1TBLA 1P8NA 1TBHA 3E8ZA 4MYKA 2RLAA 1TA1A 4IXUA 2PLLA 1HQ5A 2AEBA 1P8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WVA A;  4I06 A;  3CEV A;  3MFW A;  4IXV A;  3NIP A;  4Q3R A;  4Q3S A;  3THJ A;  1ZPG A;  1ZPE A;  4GWD A;  1CEV A;  2EF4 A;  4RHL A;  1R1O A;  4IU0 A;  4DZ4 A;  1T5F A;  4RLA A;  4FCK A;  1WOH A;  1WOI A;  2A0M A;  4HZE A;  3MFV A;  3TF3 A;  1HQF A;  4IE3 A;  4Q40 A;  4GSV A;  4IE2 A;  3SKK A;  3M1R A;  2ZAV A;  3MJL A;  4IU5 A;  4FCI A;  3E6K A;  4GSM A;  4MYN A;  1P8Q A;  3SL0 A;  4G3H A;  3E8Q A;  3E9B A;  1PQ3 A;  4Q3V A;  5HJA A;  1T4R A;  4MYL A;  4Q3Q A;  1P8R A;  2PHA A;  4MXR A;  3THE A;  3LHL A;  4RHK A;  3TH7 A;  1T4P A;  3THH A;  3NIO A;  1RLA A;  4IE1 A;  5HJ9 A;  4Q41 A;  3MMR A;  4GWC A;  4HXQ A;  3GN0 A;  3SL1 A;  4MYF A;  4Q3P A;  4IU1 A;  4RHQ A;  1TBJ A;  4GSZ A;  1WVB A;  2EF5 A;  3KV2 A;  4Q3R C;  4CEV A;  4Q42 A;  1GQ7 A;  4RHJ A;  1P8O A;  2EIV A;  5CEV A;  2CEV A;  4IU4 A;  3SJT A;  1HQX A;  3DJ8 A;  1GQ6 A;  4RHM A;  3E6V A;  3F80 A;  1D3V A;  4HWW A;  1HQH A;  1XFK A;  3NIQ A;  3LP4 A;  4Q3T A;  1HQG A;  2PHO A;  4ITY A;  5RLA A;  1T4T A;  1P8S A;  3PZL A;  3LP7 A;  3GMZ A;  1P8P A;  4Q3U A;  1T4S A;  1WOG A;  1T5G A;  4RHI A;  3RLA A;  1TBL A;  1P8N A;  1TBH A;  3E8Z A;  4MYK A;  2RLA A;  1TA1 A;  4IXU A;  2PLL A;  1HQ5 A;  2AEB A;  1P8M A; 
#chains in the Genus database with same CATH topology
 4ZUM A;  4ZUR A;  1WVA A;  3MZ6 A;  2GH6 A;  4I06 A;  4QA0 A;  5IWG A;  5JI5 A;  3CEV A;  3MFW A;  4IXV A;  3NIP A;  1ZZ0 A;  5D1B A;  4Q3R A;  4Q3S A;  3THJ A;  1ZPG A;  5DC7 A;  1ZPE A;  2V5X A;  5G3W A;  4GWD A;  1CEV A;  5G1A A;  4QA7 A;  2EF4 A;  1W22 A;  1T67 A;  4RHL A;  1R1O A;  3ZNS A;  2VQO A;  4IU0 A;  4DZ4 A;  5EFK B;  1T5F A;  3MZ4 A;  4RLA A;  4FCK A;  5EFH A;  5G13 A;  3C0Z A;  1WOH A;  3C10 A;  1WOI A;  2A0M A;  3F07 A;  3MFV A;  1VKG A;  4HZE A;  4QA4 A;  5EEI A;  5G11 A;  4BZ8 A;  3MAX A;  3Q9E A;  1HQF A;  4IE3 A;  3TF3 A;  5G0H A;  4Q40 A;  5G1C A;  4GSV A;  4IE2 A;  1ZZ3 A;  4RN0 A;  3SKK A;  3Q9C A;  1T69 A;  3M1R A;  3MZ7 A;  3F06 A;  4QA5 A;  4ZUO A;  5G17 A;  2ZAV A;  5EEN A;  3MJL A;  4IU5 A;  4FCI A;  3ZNR A;  5LI3 A;  4BZ6 A;  1C3S A;  4A69 A;  1T64 A;  3E6K A;  4GSM A;  1P8Q A;  4MYN A;  5FUE A;  4G3H A;  5EEF A;  5G0G A;  3SL0 A;  3F0R A;  5EF8 A;  3E8Q A;  2VQW G;  3E9B A;  1PQ3 A;  4Q3V A;  5HJA A;  1T4R A;  4MYL A;  4Q3Q A;  5EFG A;  2V5W A;  1P8R A;  2PHA A;  4MXR A;  5THV A;  3THE A;  3LHL A;  4RHK A;  3C0Y A;  2VQV A;  1T4P A;  5THU A;  3EZT A;  3TH7 A;  4BKX B;  5ICN B;  5THS A;  3THH A;  1C3R A;  5EFB D;  3NIO A;  5IX0 A;  1RLA A;  4IE1 A;  5EEK A;  5HJ9 A;  4Q41 A;  3MMR A;  5BWZ A;  4GWC A;  4HXQ A;  3GN0 A;  3SL1 A;  2VQQ A;  4MYF A;  4QA6 A;  3MEN A;  4Q3P A;  4IU1 A;  4CBT A;  4RHQ A;  1TBJ A;  5DC5 A;  3KV2 A;  1WVB A;  2EF5 A;  4GSZ A;  4Q3R C;  3Q9F A;  4CEV A;  4Q42 A;  1GQ7 A;  4LXZ A;  4RHJ A;  5EFN A;  1P8O A;  4BZ7 A;  2EIV A;  2VCG A;  4QA1 A;  5A2S A;  5CEV A;  2CEV A;  4IU4 A;  5G0Y A;  3SJT A;  5G0J A;  3DJ8 A;  1HQX A;  5EFJ D;  1GQ6 A;  4RHM A;  3Q9B A;  3E6V A;  4RN2 A;  5G0X A;  3F80 A;  5D1D A;  4QA2 A;  3EW8 A;  4BZ5 A;  4ZUN A;  1D3V A;  2VQJ A;  4HWW A;  1HQH A;  5G0I A;  3MZ3 A;  5G12 A;  1XFK A;  3NIQ A;  5D1C A;  3LP4 A;  4CQF A;  4Q3T A;  1HQG A;  2PHO A;  4ITY A;  4LY1 A;  5RLA A;  3SFF A;  5DC6 A;  1T4T A;  5G1B A;  4ZUQ A;  5FCW A;  1P8S A;  4ZUP A;  5THT A;  3RQD A;  3PZL A;  5EF7 A;  3LP7 A;  3GMZ A;  1P8P A;  4Q3U A;  5G10 A;  4CBY A;  1T4S A;  1C3P A;  1T5G A;  1WOG A;  4RHI A;  5DC8 A;  3RLA A;  3SFH A;  1TBL A;  1P8N A;  1TBH A;  3E8Z A;  4MYK A;  3EZP A;  2RLA A;  1ZZ1 A;  4QA3 A;  1TA1 A;  4IXU A;  4RN1 A;  3EWF A;  2PLL A;  4BZ9 A;  1HQ5 A;  2VQM A;  5EEM A;  2AEB A;  1P8M A; 
#chains in the Genus database with same CATH homology
 1WVA A;  4I06 A;  3CEV A;  3MFW A;  4IXV A;  3NIP A;  4Q3R A;  4Q3S A;  3THJ A;  1ZPG A;  1ZPE A;  4GWD A;  1CEV A;  2EF4 A;  4RHL A;  1R1O A;  4IU0 A;  4DZ4 A;  1T5F A;  4RLA A;  4FCK A;  1WOH A;  1WOI A;  2A0M A;  4HZE A;  3MFV A;  3TF3 A;  1HQF A;  4IE3 A;  4Q40 A;  4GSV A;  4IE2 A;  3SKK A;  3M1R A;  2ZAV A;  3MJL A;  4IU5 A;  4FCI A;  3E6K A;  4GSM A;  4MYN A;  1P8Q A;  3SL0 A;  4G3H A;  3E8Q A;  3E9B A;  1PQ3 A;  4Q3V A;  5HJA A;  1T4R A;  4MYL A;  4Q3Q A;  1P8R A;  2PHA A;  4MXR A;  3THE A;  3LHL A;  4RHK A;  3TH7 A;  1T4P A;  3THH A;  3NIO A;  1RLA A;  4IE1 A;  5HJ9 A;  4Q41 A;  3MMR A;  4GWC A;  4HXQ A;  3GN0 A;  3SL1 A;  4MYF A;  4Q3P A;  4IU1 A;  4RHQ A;  1TBJ A;  4GSZ A;  1WVB A;  2EF5 A;  3KV2 A;  4Q3R C;  4CEV A;  4Q42 A;  1GQ7 A;  4RHJ A;  1P8O A;  2EIV A;  5CEV A;  2CEV A;  4IU4 A;  3SJT A;  1HQX A;  3DJ8 A;  1GQ6 A;  4RHM A;  3E6V A;  3F80 A;  1D3V A;  4HWW A;  1HQH A;  1XFK A;  3NIQ A;  3LP4 A;  4Q3T A;  1HQG A;  2PHO A;  4ITY A;  5RLA A;  1T4T A;  1P8S A;  3PZL A;  3LP7 A;  3GMZ A;  1P8P A;  4Q3U A;  1T4S A;  1WOG A;  1T5G A;  4RHI A;  3RLA A;  1TBL A;  1P8N A;  1TBH A;  3E8Z A;  4MYK A;  2RLA A;  1TA1 A;  4IXU A;  2PLL A;  1HQ5 A;  2AEB A;  1P8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...