1GQ7A

Proclavaminate amidino hydrolase from streptomyces clavuligerus
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
Knots found
sequence length
301
structure length
301
Chain Sequence
SPRYAQIPTFMRLPHDPQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oligomeric structure of proclavaminic acid amidino hydrolase: evolution of a hydrolytic enzyme in clavulanic acid biosynthesis.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Hydrolase
molecule keywords PROCLAVAMINATE AMIDINO HYDROLASE
total genus 106
structure length 301
sequence length 301
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31 +31 +31
ec nomenclature ec 3.5.3.22: Proclavaminate amidinohydrolase.
pdb deposition date 2001-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1gq7A00
4RHKA 1P8MA 2ZAVA 1XFKA 4IE3A 2EF4A 1TBHA 1WVAA 3SL1A 1WOHA 3LP4A 4CEVA 3TF3A 3LP7A 1P8SA 4ITYA 3E9BA 1P8PA 3GN0A 4Q3RC 3SJTA 1P8NA 2EIVA 1ZPGA 4RHJA 3PZLA 4RHLA 4IU4A 4MXRA 3M1RA 3NIQA 2RLAA 4MYNA 5HJ9A 4MYLA 2A0MA 3E8ZA 1HQXA 1ZPEA 3NIOA 2CEVA 1HQGA 4Q3SA 4IE2A 4Q3RA 4GSMA 4RHIA 4Q3QA 1P8QA 4IXVA 4Q40A 5HJAA 4FCKA 1T5FA 4IU5A 1WVBA 2PLLA 4I06A 1CEVA 1TA1A 4MYFA 1T5GA 4RHMA 1WOIA 3NIPA 3DJ8A 4GWCA 3THJA 3SL0A 4HXQA 1GQ7A 1HQFA 1T4RA 4DZ4A 3MFVA 3TH7A 3MJLA 1P8RA 3THHA 4HZEA 4Q41A 4HWWA 3RLAA 4IXUA 3CEVA 3GMZA 4GSVA 3THEA 4GSZA 4Q3UA 4GWDA 4RLAA 1R1OA 4IU1A 4Q42A 4Q3TA 1GQ6A 3MMRA 4IU0A 3E6KA 3MFWA 1TBJA 1P8OA 3F80A 4Q3VA 4G3HA 4RHQA 5RLAA 2AEBA 2PHOA 3E8QA 3E6VA 1T4TA 1HQHA 1TBLA 1T4PA 2PHAA 1WOGA 1PQ3A 1D3VA 4IE1A 1HQ5A 1RLAA 2EF5A 4FCIA 4MYKA 3SKKA 3KV2A 5CEVA 1T4SA 3LHLA 4Q3PA
chains in the Genus database with same CATH superfamily
3MZ3A 4RHKA 1P8MA 1T64A 2ZAVA 3SFFA 1XFKA 4IE3A 2EF4A 1TBHA 1WVAA 3SL1A 5EEFA 1WOHA 3LP4A 5G1BA 4CEVA 3TF3A 3LP7A 1P8SA 1C3RA 2VQJA 4ITYA 5DC5A 3ZNSA 4ZUPA 3E9BA 1P8PA 5EFJD 3GN0A 4Q3RC 3SJTA 4BKXB 3F0RA 5G0HA 1P8NA 2EIVA 1ZPGA 3EWFA 1ZZ1A 4BZ7A 4RHJA 5EENA 3ZNRA 5EF7A 2VQQA 3EW8A 3PZLA 4ZUOA 3Q9CA 4RHLA 4IU4A 3C10A 4MXRA 5G13A 4BZ5A 3M1RA 5JI5A 5LI3A 3NIQA 5A2SA 2RLAA 4MYNA 5HJ9A 3MZ4A 5G3WA 3Q9BA 5THTA 4ZURA 4QA1A 4MYLA 2A0MA 5G0IA 1W22A 3E8ZA 4CBYA 5THSA 1HQXA 3MENA 1ZPEA 5FCWA 2VQMA 2VCGA 5D1DA 3NIOA 2CEVA 3C0ZA 3C0YA 1HQGA 4Q3SA 4IE2A 2VQOA 3F07A 4Q3RA 4GSMA 3MZ7A 4RHIA 5G0YA 3F06A 5EFNA 2VQWG 4Q3QA 5G1CA 5THVA 4QA7A 1P8QA 4IXVA 5D1BA 4Q40A 5HJAA 5IX0A 4A69A 4FCKA 1T5FA 5DC8A 5EFKB 4IU5A 1WVBA 2PLLA 4QA2A 4I06A 1CEVA 1TA1A 4MYFA 5G0GA 5EEKA 5DC6A 3SFHA 5EEMA 4RN1A 1T5GA 4RHMA 5EEIA 1WOIA 3MAXA 3NIPA 4RN0A 3DJ8A 4GWCA 3THJA 4QA5A 3SL0A 4HXQA 1GQ7A 1HQFA 1T4RA 4DZ4A 4QA6A 5G0XA 5G1AA 3MFVA 3Q9FA 3TH7A 1T67A 4CBTA 3MJLA 5G10A 1P8RA 3THHA 4ZUMA 3Q9EA 4HZEA 5G11A 4HWWA 2GH6A 4Q41A 3RLAA 4IXUA 3CEVA 3GMZA 4GSVA 4QA3A 4RN2A 4GSZA 4Q3UA 5G17A 3RQDA 3THEA 4BZ8A 4BZ6A 5ICNB 4GWDA 4LY1A 4RLAA 1R1OA 4QA4A 4IU1A 4Q42A 4BZ9A 5G0JA 5THUA 4Q3TA 5EFHA 1GQ6A 3MMRA 3MZ6A 4IU0A 5G12A 3E6KA 3MFWA 1TBJA 5EF8A 5BWZA 1ZZ0A 1P8OA 2VQVA 3F80A 4Q3VA 1ZZ3A 4G3HA 3EZPA 4RHQA 5DC7A 5D1CA 5RLAA 2AEBA 2PHOA 1C3PA 4LXZA 3E8QA 3E6VA 5EFBD 1T4TA 1HQHA 1TBLA 1VKGA 1T4PA 1T69A 2PHAA 1C3SA 1WOGA 1PQ3A 4QA0A 1D3VA 5IWGA 4IE1A 4ZUQA 2V5WA 1HQ5A 2V5XA 1RLAA 2EF5A 4ZUNA 4FCIA 5EFGA 4MYKA 3SKKA 3EZTA 3KV2A 5CEVA 4CQFA 1T4SA 3LHLA 5FUEA 4Q3PA
chains in the Genus database with same CATH topology
4RHKA 1P8MA 2ZAVA 1XFKA 4IE3A 2EF4A 1TBHA 1WVAA 3SL1A 1WOHA 3LP4A 4CEVA 3TF3A 3LP7A 1P8SA 4ITYA 3E9BA 1P8PA 3GN0A 4Q3RC 3SJTA 1P8NA 2EIVA 1ZPGA 4RHJA 3PZLA 4RHLA 4IU4A 4MXRA 3M1RA 3NIQA 2RLAA 4MYNA 5HJ9A 4MYLA 2A0MA 3E8ZA 1HQXA 1ZPEA 3NIOA 2CEVA 1HQGA 4Q3SA 4IE2A 4Q3RA 4GSMA 4RHIA 4Q3QA 1P8QA 4IXVA 4Q40A 5HJAA 4FCKA 1T5FA 4IU5A 1WVBA 2PLLA 4I06A 1CEVA 1TA1A 4MYFA 1T5GA 4RHMA 1WOIA 3NIPA 3DJ8A 4GWCA 3THJA 3SL0A 4HXQA 1GQ7A 1HQFA 1T4RA 4DZ4A 3MFVA 3TH7A 3MJLA 1P8RA 3THHA 4HZEA 4Q41A 4HWWA 3RLAA 4IXUA 3CEVA 3GMZA 4GSVA 3THEA 4GSZA 4Q3UA 4GWDA 4RLAA 1R1OA 4IU1A 4Q42A 4Q3TA 1GQ6A 3MMRA 4IU0A 3E6KA 3MFWA 1TBJA 1P8OA 3F80A 4Q3VA 4G3HA 4RHQA 5RLAA 2AEBA 2PHOA 3E8QA 3E6VA 1T4TA 1HQHA 1TBLA 1T4PA 2PHAA 1WOGA 1PQ3A 1D3VA 4IE1A 1HQ5A 1RLAA 2EF5A 4FCIA 4MYKA 3SKKA 3KV2A 5CEVA 1T4SA 3LHLA 4Q3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RHK A;  1P8M A;  2ZAV A;  1XFK A;  4IE3 A;  2EF4 A;  1TBH A;  1WVA A;  3SL1 A;  1WOH A;  3LP4 A;  4CEV A;  3TF3 A;  3LP7 A;  1P8S A;  4ITY A;  3E9B A;  1P8P A;  3GN0 A;  4Q3R C;  3SJT A;  1P8N A;  2EIV A;  1ZPG A;  4RHJ A;  3PZL A;  4RHL A;  4IU4 A;  4MXR A;  3M1R A;  3NIQ A;  2RLA A;  4MYN A;  5HJ9 A;  4MYL A;  2A0M A;  3E8Z A;  1HQX A;  1ZPE A;  3NIO A;  2CEV A;  1HQG A;  4Q3S A;  4IE2 A;  4Q3R A;  4GSM A;  4RHI A;  4Q3Q A;  1P8Q A;  4IXV A;  4Q40 A;  5HJA A;  4FCK A;  1T5F A;  4IU5 A;  1WVB A;  2PLL A;  4I06 A;  1CEV A;  1TA1 A;  4MYF A;  1T5G A;  4RHM A;  1WOI A;  3NIP A;  3DJ8 A;  4GWC A;  3THJ A;  3SL0 A;  4HXQ A;  1GQ7 A;  1HQF A;  1T4R A;  4DZ4 A;  3MFV A;  3TH7 A;  3MJL A;  1P8R A;  3THH A;  4HZE A;  4Q41 A;  4HWW A;  3RLA A;  4IXU A;  3CEV A;  3GMZ A;  4GSV A;  3THE A;  4GSZ A;  4Q3U A;  4GWD A;  4RLA A;  1R1O A;  4IU1 A;  4Q42 A;  4Q3T A;  1GQ6 A;  3MMR A;  4IU0 A;  3E6K A;  3MFW A;  1TBJ A;  1P8O A;  3F80 A;  4Q3V A;  4G3H A;  4RHQ A;  5RLA A;  2AEB A;  2PHO A;  3E8Q A;  3E6V A;  1T4T A;  1HQH A;  1TBL A;  1T4P A;  2PHA A;  1WOG A;  1PQ3 A;  1D3V A;  4IE1 A;  1HQ5 A;  1RLA A;  2EF5 A;  4FCI A;  4MYK A;  3SKK A;  3KV2 A;  5CEV A;  1T4S A;  3LHL A;  4Q3P A; 
#chains in the Genus database with same CATH topology
 3MZ3 A;  4RHK A;  1P8M A;  1T64 A;  2ZAV A;  3SFF A;  1XFK A;  4IE3 A;  2EF4 A;  1TBH A;  1WVA A;  3SL1 A;  5EEF A;  1WOH A;  3LP4 A;  5G1B A;  4CEV A;  3TF3 A;  3LP7 A;  1P8S A;  1C3R A;  2VQJ A;  4ITY A;  5DC5 A;  3ZNS A;  4ZUP A;  3E9B A;  1P8P A;  5EFJ D;  3GN0 A;  4Q3R C;  3SJT A;  4BKX B;  3F0R A;  5G0H A;  1P8N A;  2EIV A;  1ZPG A;  3EWF A;  1ZZ1 A;  4BZ7 A;  4RHJ A;  5EEN A;  3ZNR A;  5EF7 A;  2VQQ A;  3EW8 A;  3PZL A;  4ZUO A;  3Q9C A;  4RHL A;  4IU4 A;  3C10 A;  4MXR A;  5G13 A;  4BZ5 A;  3M1R A;  5JI5 A;  5LI3 A;  3NIQ A;  5A2S A;  2RLA A;  4MYN A;  5HJ9 A;  3MZ4 A;  5G3W A;  3Q9B A;  5THT A;  4ZUR A;  4QA1 A;  4MYL A;  2A0M A;  5G0I A;  1W22 A;  3E8Z A;  4CBY A;  5THS A;  1HQX A;  3MEN A;  1ZPE A;  5FCW A;  2VQM A;  2VCG A;  5D1D A;  3NIO A;  2CEV A;  3C0Z A;  3C0Y A;  1HQG A;  4Q3S A;  4IE2 A;  2VQO A;  3F07 A;  4Q3R A;  4GSM A;  3MZ7 A;  4RHI A;  5G0Y A;  3F06 A;  5EFN A;  2VQW G;  4Q3Q A;  5G1C A;  5THV A;  4QA7 A;  1P8Q A;  4IXV A;  5D1B A;  4Q40 A;  5HJA A;  5IX0 A;  4A69 A;  4FCK A;  1T5F A;  5DC8 A;  5EFK B;  4IU5 A;  1WVB A;  2PLL A;  4QA2 A;  4I06 A;  1CEV A;  1TA1 A;  4MYF A;  5G0G A;  5EEK A;  5DC6 A;  3SFH A;  5EEM A;  4RN1 A;  1T5G A;  4RHM A;  5EEI A;  1WOI A;  3MAX A;  3NIP A;  4RN0 A;  3DJ8 A;  4GWC A;  3THJ A;  4QA5 A;  3SL0 A;  4HXQ A;  1GQ7 A;  1HQF A;  1T4R A;  4DZ4 A;  4QA6 A;  5G0X A;  5G1A A;  3MFV A;  3Q9F A;  3TH7 A;  1T67 A;  4CBT A;  3MJL A;  5G10 A;  1P8R A;  3THH A;  4ZUM A;  3Q9E A;  4HZE A;  5G11 A;  4HWW A;  2GH6 A;  4Q41 A;  3RLA A;  4IXU A;  3CEV A;  3GMZ A;  4GSV A;  4QA3 A;  4RN2 A;  4GSZ A;  4Q3U A;  5G17 A;  3RQD A;  3THE A;  4BZ8 A;  4BZ6 A;  5ICN B;  4GWD A;  4LY1 A;  4RLA A;  1R1O A;  4QA4 A;  4IU1 A;  4Q42 A;  4BZ9 A;  5G0J A;  5THU A;  4Q3T A;  5EFH A;  1GQ6 A;  3MMR A;  3MZ6 A;  4IU0 A;  5G12 A;  3E6K A;  3MFW A;  1TBJ A;  5EF8 A;  5BWZ A;  1ZZ0 A;  1P8O A;  2VQV A;  3F80 A;  4Q3V A;  1ZZ3 A;  4G3H A;  3EZP A;  4RHQ A;  5DC7 A;  5D1C A;  5RLA A;  2AEB A;  2PHO A;  1C3P A;  4LXZ A;  3E8Q A;  3E6V A;  5EFB D;  1T4T A;  1HQH A;  1TBL A;  1VKG A;  1T4P A;  1T69 A;  2PHA A;  1C3S A;  1WOG A;  1PQ3 A;  4QA0 A;  1D3V A;  5IWG A;  4IE1 A;  4ZUQ A;  2V5W A;  1HQ5 A;  2V5X A;  1RLA A;  2EF5 A;  4ZUN A;  4FCI A;  5EFG A;  4MYK A;  3SKK A;  3EZT A;  3KV2 A;  5CEV A;  4CQF A;  1T4S A;  3LHL A;  5FUE A;  4Q3P A; 
#chains in the Genus database with same CATH homology
 4RHK A;  1P8M A;  2ZAV A;  1XFK A;  4IE3 A;  2EF4 A;  1TBH A;  1WVA A;  3SL1 A;  1WOH A;  3LP4 A;  4CEV A;  3TF3 A;  3LP7 A;  1P8S A;  4ITY A;  3E9B A;  1P8P A;  3GN0 A;  4Q3R C;  3SJT A;  1P8N A;  2EIV A;  1ZPG A;  4RHJ A;  3PZL A;  4RHL A;  4IU4 A;  4MXR A;  3M1R A;  3NIQ A;  2RLA A;  4MYN A;  5HJ9 A;  4MYL A;  2A0M A;  3E8Z A;  1HQX A;  1ZPE A;  3NIO A;  2CEV A;  1HQG A;  4Q3S A;  4IE2 A;  4Q3R A;  4GSM A;  4RHI A;  4Q3Q A;  1P8Q A;  4IXV A;  4Q40 A;  5HJA A;  4FCK A;  1T5F A;  4IU5 A;  1WVB A;  2PLL A;  4I06 A;  1CEV A;  1TA1 A;  4MYF A;  1T5G A;  4RHM A;  1WOI A;  3NIP A;  3DJ8 A;  4GWC A;  3THJ A;  3SL0 A;  4HXQ A;  1GQ7 A;  1HQF A;  1T4R A;  4DZ4 A;  3MFV A;  3TH7 A;  3MJL A;  1P8R A;  3THH A;  4HZE A;  4Q41 A;  4HWW A;  3RLA A;  4IXU A;  3CEV A;  3GMZ A;  4GSV A;  3THE A;  4GSZ A;  4Q3U A;  4GWD A;  4RLA A;  1R1O A;  4IU1 A;  4Q42 A;  4Q3T A;  1GQ6 A;  3MMR A;  4IU0 A;  3E6K A;  3MFW A;  1TBJ A;  1P8O A;  3F80 A;  4Q3V A;  4G3H A;  4RHQ A;  5RLA A;  2AEB A;  2PHO A;  3E8Q A;  3E6V A;  1T4T A;  1HQH A;  1TBL A;  1T4P A;  2PHA A;  1WOG A;  1PQ3 A;  1D3V A;  4IE1 A;  1HQ5 A;  1RLA A;  2EF5 A;  4FCI A;  4MYK A;  3SKK A;  3KV2 A;  5CEV A;  1T4S A;  3LHL A;  4Q3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...