1WOGA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords agmatinase
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1wogA00
4IU0A 4MYNA 3THHA 1P8MA 3CEVA 4FCKA 3E8QA 1WVBA 4HZEA 4IE3A 3KV2A 4Q3RA 4Q3UA 1GQ6A 1TBJA 3MMRA 3DJ8A 1T4SA 3M1RA 4Q40A 3TH7A 2CEVA 2EIVA 1T5GA 1P8PA 4GWDA 5CEVA 4Q3PA 3GMZA 4ITYA 1WVAA 1T4TA 1RLAA 5RLAA 2RLAA 1P8OA 3E6KA 1T4PA 3SKKA 1TBHA 3MFWA 4RHJA 2PHAA 4RHKA 3GN0A 3LP4A 1P8SA 4G3HA 4I06A 1WOGA 4IE1A 3PZLA 4Q3QA 4Q3TA 4Q3VA 1HQFA 4RLAA 5HJAA 3LP7A 1ZPEA 3MFVA 3TF3A 1P8RA 3SJTA 4IXUA 4IU1A 4Q3SA 4FCIA 4RHIA 1WOIA 3E6VA 4DZ4A 1ZPGA 4RHQA 1GQ7A 5HJ9A 1T5FA 3E8ZA 1HQGA 3NIQA 3MJLA 4IXVA 1XFKA 1D3VA 1PQ3A 2EF4A 1P8QA 4MYKA 1P8NA 1HQHA 1HQXA 4Q3RC 1T4RA 4HXQA 2PHOA 1WOHA 4GSZA 1R1OA 3THEA 4GWCA 4GSVA 3THJA 4IE2A 4MYLA 3LHLA 3RLAA 3SL0A 1TA1A 4Q41A 4IU5A 2PLLA 4IU4A 1CEVA 4Q42A 3NIOA 4RHMA 4MYFA 1TBLA 3E9BA 2A0MA 3SL1A 2AEBA 3F80A 4MXRA 4RHLA 1HQ5A 3NIPA 4HWWA 4CEVA 2EF5A 4GSMA 2ZAVA
chains in the Genus database with same CATH superfamily
4IU0A 2VQWG 5IX0A 3SFHA 4MYNA 2V5WA 3THHA 5G0GA 5G1BA 3ZNSA 2VQVA 1P8MA 1ZZ1A 3Q9CA 5G12A 2VCGA 3EWFA 2VQMA 3C10A 3CEVA 5G3WA 4FCKA 3MZ7A 3E8QA 5EF8A 2V5XA 1C3RA 1WVBA 5DC6A 1T69A 4HZEA 4RN1A 3MENA 3KV2A 2VQQA 4IE3A 5FCWA 4Q3RA 4Q3UA 4QA7A 4ZUOA 5G13A 1GQ6A 2GH6A 5EENA 5G0JA 1TBJA 5EEFA 4BZ6A 3MMRA 3DJ8A 5EEIA 1T4SA 3Q9EA 3M1RA 4Q40A 3TH7A 5G0HA 3EZTA 4QA6A 1VKGA 2CEVA 2EIVA 1T5GA 2VQJA 1P8PA 3MZ4A 4GWDA 5A2SA 5CEVA 4Q3PA 3C0ZA 3GMZA 4ITYA 1WVAA 5EEKA 4QA4A 1T4TA 1RLAA 5RLAA 4QA1A 2RLAA 1P8OA 3E6KA 1T4PA 3SKKA 5G1CA 1T64A 5EF7A 4BZ7A 1TBHA 3MFWA 4RHJA 2PHAA 4RHKA 4ZUQA 3GN0A 3LP4A 1P8SA 4RN0A 3EW8A 4ZUNA 4G3HA 4I06A 5D1BA 5G0XA 1WOGA 4IE1A 4RN2A 3PZLA 4Q3QA 4Q3TA 5D1DA 4Q3VA 5DC8A 5THTA 1HQFA 3MZ6A 4CQFA 4ZUMA 5G0YA 4RLAA 5HJAA 1T67A 4A69A 3LP7A 4BZ5A 1ZPEA 5FUEA 3MFVA 3TF3A 1P8RA 3SJTA 4IXUA 4IU1A 4Q3SA 5G11A 4BKXB 4FCIA 4QA2A 4RHIA 4ZUPA 1WOIA 5THUA 3E6VA 4DZ4A 5EFHA 1ZPGA 4RHQA 1GQ7A 5HJ9A 4BZ8A 4CBYA 1T5FA 5EFNA 3E8ZA 4QA0A 1HQGA 3NIQA 1ZZ0A 3MJLA 4IXVA 1XFKA 1ZZ3A 1D3VA 1PQ3A 2EF4A 3F0RA 1P8QA 3F07A 5EFKB 4MYKA 1P8NA 1HQHA 1HQXA 4Q3RC 1C3SA 4ZURA 5G0IA 1T4RA 2VQOA 4HXQA 2PHOA 1WOHA 4GSZA 5G17A 1R1OA 3THEA 4CBTA 4GWCA 5D1CA 4GSVA 5DC7A 5THVA 3THJA 4IE2A 4MYLA 3LHLA 3RLAA 3MAXA 3F06A 3MZ3A 1TA1A 4QA5A 5DC5A 3RQDA 3SL0A 5BWZA 5G10A 5ICNB 5EEMA 4LY1A 4Q41A 4IU5A 3SFFA 4LXZA 5EFBD 2PLLA 4IU4A 1CEVA 4Q42A 3NIOA 1W22A 4RHMA 3Q9FA 5EFJD 1C3PA 4MYFA 1TBLA 3E9BA 2A0MA 3Q9BA 4QA3A 3SL1A 5JI5A 2AEBA 3F80A 3EZPA 4MXRA 4RHLA 3ZNRA 3C0YA 1HQ5A 5G1AA 5EFGA 5THSA 3NIPA 4HWWA 4CEVA 2EF5A 4GSMA 2ZAVA 5IWGA 4BZ9A 5LI3A
chains in the Genus database with same CATH topology
4IU0A 4MYNA 3THHA 1P8MA 3CEVA 4FCKA 3E8QA 1WVBA 4HZEA 4IE3A 3KV2A 4Q3RA 4Q3UA 1GQ6A 1TBJA 3MMRA 3DJ8A 1T4SA 3M1RA 4Q40A 3TH7A 2CEVA 2EIVA 1T5GA 1P8PA 4GWDA 5CEVA 4Q3PA 3GMZA 4ITYA 1WVAA 1T4TA 1RLAA 5RLAA 2RLAA 1P8OA 3E6KA 1T4PA 3SKKA 1TBHA 3MFWA 4RHJA 2PHAA 4RHKA 3GN0A 3LP4A 1P8SA 4G3HA 4I06A 1WOGA 4IE1A 3PZLA 4Q3QA 4Q3TA 4Q3VA 1HQFA 4RLAA 5HJAA 3LP7A 1ZPEA 3MFVA 3TF3A 1P8RA 3SJTA 4IXUA 4IU1A 4Q3SA 4FCIA 4RHIA 1WOIA 3E6VA 4DZ4A 1ZPGA 4RHQA 1GQ7A 5HJ9A 1T5FA 3E8ZA 1HQGA 3NIQA 3MJLA 4IXVA 1XFKA 1D3VA 1PQ3A 2EF4A 1P8QA 4MYKA 1P8NA 1HQHA 1HQXA 4Q3RC 1T4RA 4HXQA 2PHOA 1WOHA 4GSZA 1R1OA 3THEA 4GWCA 4GSVA 3THJA 4IE2A 4MYLA 3LHLA 3RLAA 3SL0A 1TA1A 4Q41A 4IU5A 2PLLA 4IU4A 1CEVA 4Q42A 3NIOA 4RHMA 4MYFA 1TBLA 3E9BA 2A0MA 3SL1A 2AEBA 3F80A 4MXRA 4RHLA 1HQ5A 3NIPA 4HWWA 4CEVA 2EF5A 4GSMA 2ZAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IU0 A;  4MYN A;  3THH A;  1P8M A;  3CEV A;  4FCK A;  3E8Q A;  1WVB A;  4HZE A;  4IE3 A;  3KV2 A;  4Q3R A;  4Q3U A;  1GQ6 A;  1TBJ A;  3MMR A;  3DJ8 A;  1T4S A;  3M1R A;  4Q40 A;  3TH7 A;  2CEV A;  2EIV A;  1T5G A;  1P8P A;  4GWD A;  5CEV A;  4Q3P A;  3GMZ A;  4ITY A;  1WVA A;  1T4T A;  1RLA A;  5RLA A;  2RLA A;  1P8O A;  3E6K A;  1T4P A;  3SKK A;  1TBH A;  3MFW A;  4RHJ A;  2PHA A;  4RHK A;  3GN0 A;  3LP4 A;  1P8S A;  4G3H A;  4I06 A;  1WOG A;  4IE1 A;  3PZL A;  4Q3Q A;  4Q3T A;  4Q3V A;  1HQF A;  4RLA A;  5HJA A;  3LP7 A;  1ZPE A;  3MFV A;  3TF3 A;  1P8R A;  3SJT A;  4IXU A;  4IU1 A;  4Q3S A;  4FCI A;  4RHI A;  1WOI A;  3E6V A;  4DZ4 A;  1ZPG A;  4RHQ A;  1GQ7 A;  5HJ9 A;  1T5F A;  3E8Z A;  1HQG A;  3NIQ A;  3MJL A;  4IXV A;  1XFK A;  1D3V A;  1PQ3 A;  2EF4 A;  1P8Q A;  4MYK A;  1P8N A;  1HQH A;  1HQX A;  4Q3R C;  1T4R A;  4HXQ A;  2PHO A;  1WOH A;  4GSZ A;  1R1O A;  3THE A;  4GWC A;  4GSV A;  3THJ A;  4IE2 A;  4MYL A;  3LHL A;  3RLA A;  3SL0 A;  1TA1 A;  4Q41 A;  4IU5 A;  2PLL A;  4IU4 A;  1CEV A;  4Q42 A;  3NIO A;  4RHM A;  4MYF A;  1TBL A;  3E9B A;  2A0M A;  3SL1 A;  2AEB A;  3F80 A;  4MXR A;  4RHL A;  1HQ5 A;  3NIP A;  4HWW A;  4CEV A;  2EF5 A;  4GSM A;  2ZAV A; 
#chains in the Genus database with same CATH topology
 4IU0 A;  2VQW G;  5IX0 A;  3SFH A;  4MYN A;  2V5W A;  3THH A;  5G0G A;  5G1B A;  3ZNS A;  2VQV A;  1P8M A;  1ZZ1 A;  3Q9C A;  5G12 A;  2VCG A;  3EWF A;  2VQM A;  3C10 A;  3CEV A;  5G3W A;  4FCK A;  3MZ7 A;  3E8Q A;  5EF8 A;  2V5X A;  1C3R A;  1WVB A;  5DC6 A;  1T69 A;  4HZE A;  4RN1 A;  3MEN A;  3KV2 A;  2VQQ A;  4IE3 A;  5FCW A;  4Q3R A;  4Q3U A;  4QA7 A;  4ZUO A;  5G13 A;  1GQ6 A;  2GH6 A;  5EEN A;  5G0J A;  1TBJ A;  5EEF A;  4BZ6 A;  3MMR A;  3DJ8 A;  5EEI A;  1T4S A;  3Q9E A;  3M1R A;  4Q40 A;  3TH7 A;  5G0H A;  3EZT A;  4QA6 A;  1VKG A;  2CEV A;  2EIV A;  1T5G A;  2VQJ A;  1P8P A;  3MZ4 A;  4GWD A;  5A2S A;  5CEV A;  4Q3P A;  3C0Z A;  3GMZ A;  4ITY A;  1WVA A;  5EEK A;  4QA4 A;  1T4T A;  1RLA A;  5RLA A;  4QA1 A;  2RLA A;  1P8O A;  3E6K A;  1T4P A;  3SKK A;  5G1C A;  1T64 A;  5EF7 A;  4BZ7 A;  1TBH A;  3MFW A;  4RHJ A;  2PHA A;  4RHK A;  4ZUQ A;  3GN0 A;  3LP4 A;  1P8S A;  4RN0 A;  3EW8 A;  4ZUN A;  4G3H A;  4I06 A;  5D1B A;  5G0X A;  1WOG A;  4IE1 A;  4RN2 A;  3PZL A;  4Q3Q A;  4Q3T A;  5D1D A;  4Q3V A;  5DC8 A;  5THT A;  1HQF A;  3MZ6 A;  4CQF A;  4ZUM A;  5G0Y A;  4RLA A;  5HJA A;  1T67 A;  4A69 A;  3LP7 A;  4BZ5 A;  1ZPE A;  5FUE A;  3MFV A;  3TF3 A;  1P8R A;  3SJT A;  4IXU A;  4IU1 A;  4Q3S A;  5G11 A;  4BKX B;  4FCI A;  4QA2 A;  4RHI A;  4ZUP A;  1WOI A;  5THU A;  3E6V A;  4DZ4 A;  5EFH A;  1ZPG A;  4RHQ A;  1GQ7 A;  5HJ9 A;  4BZ8 A;  4CBY A;  1T5F A;  5EFN A;  3E8Z A;  4QA0 A;  1HQG A;  3NIQ A;  1ZZ0 A;  3MJL A;  4IXV A;  1XFK A;  1ZZ3 A;  1D3V A;  1PQ3 A;  2EF4 A;  3F0R A;  1P8Q A;  3F07 A;  5EFK B;  4MYK A;  1P8N A;  1HQH A;  1HQX A;  4Q3R C;  1C3S A;  4ZUR A;  5G0I A;  1T4R A;  2VQO A;  4HXQ A;  2PHO A;  1WOH A;  4GSZ A;  5G17 A;  1R1O A;  3THE A;  4CBT A;  4GWC A;  5D1C A;  4GSV A;  5DC7 A;  5THV A;  3THJ A;  4IE2 A;  4MYL A;  3LHL A;  3RLA A;  3MAX A;  3F06 A;  3MZ3 A;  1TA1 A;  4QA5 A;  5DC5 A;  3RQD A;  3SL0 A;  5BWZ A;  5G10 A;  5ICN B;  5EEM A;  4LY1 A;  4Q41 A;  4IU5 A;  3SFF A;  4LXZ A;  5EFB D;  2PLL A;  4IU4 A;  1CEV A;  4Q42 A;  3NIO A;  1W22 A;  4RHM A;  3Q9F A;  5EFJ D;  1C3P A;  4MYF A;  1TBL A;  3E9B A;  2A0M A;  3Q9B A;  4QA3 A;  3SL1 A;  5JI5 A;  2AEB A;  3F80 A;  3EZP A;  4MXR A;  4RHL A;  3ZNR A;  3C0Y A;  1HQ5 A;  5G1A A;  5EFG A;  5THS A;  3NIP A;  4HWW A;  4CEV A;  2EF5 A;  4GSM A;  2ZAV A;  5IWG A;  4BZ9 A;  5LI3 A; 
#chains in the Genus database with same CATH homology
 4IU0 A;  4MYN A;  3THH A;  1P8M A;  3CEV A;  4FCK A;  3E8Q A;  1WVB A;  4HZE A;  4IE3 A;  3KV2 A;  4Q3R A;  4Q3U A;  1GQ6 A;  1TBJ A;  3MMR A;  3DJ8 A;  1T4S A;  3M1R A;  4Q40 A;  3TH7 A;  2CEV A;  2EIV A;  1T5G A;  1P8P A;  4GWD A;  5CEV A;  4Q3P A;  3GMZ A;  4ITY A;  1WVA A;  1T4T A;  1RLA A;  5RLA A;  2RLA A;  1P8O A;  3E6K A;  1T4P A;  3SKK A;  1TBH A;  3MFW A;  4RHJ A;  2PHA A;  4RHK A;  3GN0 A;  3LP4 A;  1P8S A;  4G3H A;  4I06 A;  1WOG A;  4IE1 A;  3PZL A;  4Q3Q A;  4Q3T A;  4Q3V A;  1HQF A;  4RLA A;  5HJA A;  3LP7 A;  1ZPE A;  3MFV A;  3TF3 A;  1P8R A;  3SJT A;  4IXU A;  4IU1 A;  4Q3S A;  4FCI A;  4RHI A;  1WOI A;  3E6V A;  4DZ4 A;  1ZPG A;  4RHQ A;  1GQ7 A;  5HJ9 A;  1T5F A;  3E8Z A;  1HQG A;  3NIQ A;  3MJL A;  4IXV A;  1XFK A;  1D3V A;  1PQ3 A;  2EF4 A;  1P8Q A;  4MYK A;  1P8N A;  1HQH A;  1HQX A;  4Q3R C;  1T4R A;  4HXQ A;  2PHO A;  1WOH A;  4GSZ A;  1R1O A;  3THE A;  4GWC A;  4GSV A;  3THJ A;  4IE2 A;  4MYL A;  3LHL A;  3RLA A;  3SL0 A;  1TA1 A;  4Q41 A;  4IU5 A;  2PLL A;  4IU4 A;  1CEV A;  4Q42 A;  3NIO A;  4RHM A;  4MYF A;  1TBL A;  3E9B A;  2A0M A;  3SL1 A;  2AEB A;  3F80 A;  4MXR A;  4RHL A;  1HQ5 A;  3NIP A;  4HWW A;  4CEV A;  2EF5 A;  4GSM A;  2ZAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...