1WOGA

Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
Knots found
sequence length
303
structure length
303
Chain Sequence
GPAHLPYGGIPTFARAPLVQPDGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTRLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFADVPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEALPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADLAGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords agmatinase
total genus 114
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.5.3.11: Agmatinase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 1wogA00
3GN0A 1HQFA 4GSVA 3THEA 4DZ4A 2EF5A 4IU4A 3SKKA 1WVAA 1GQ7A 4Q42A 4RLAA 3E6KA 4FCIA 1TA1A 1T4RA 1ZPGA 3SL1A 3MFWA 1GQ6A 1CEVA 1HQGA 4MYLA 4IE2A 1RLAA 1T4SA 2PLLA 4RHQA 2EIVA 4HXQA 4I06A 1P8QA 3E9BA 3SJTA 3GMZA 1HQHA 1PQ3A 3THJA 1ZPEA 4RHMA 3NIOA 4GWCA 1D3VA 3MMRA 5HJ9A 1P8NA 4GSZA 2AEBA 3NIQA 4Q3QA 3LP4A 2PHOA 4IU0A 4IXUA 3NIPA 4RHIA 4Q3UA 3TH7A 4MYKA 4Q3TA 1T4TA 3LHLA 3MJLA 3M1RA 4GWDA 4Q40A 3SL0A 1TBLA 4RHLA 3CEVA 4Q3PA 1P8OA 5CEVA 1P8PA 3LP7A 1HQXA 4Q3VA 3RLAA 2A0MA 1R1OA 1TBJA 4Q3RA 4CEVA 4IU5A 1HQ5A 2CEVA 4MXRA 1XFKA 1WOGA 2PHAA 4GSMA 4HZEA 3E8QA 5RLAA 4ITYA 4Q41A 3TF3A 4MYFA 3E8ZA 3E6VA 4Q3SA 3MFVA 5HJAA 3DJ8A 1P8RA 3KV2A 1WOIA 4G3HA 4RHKA 3THHA 4FCKA 3PZLA 4IE3A 1T5FA 2EF4A 2RLAA 4Q3RC 1P8SA 4IU1A 1T5GA 4IE1A 3F80A 1WVBA 4RHJA 1P8MA 4MYNA 4IXVA 1TBHA 2ZAVA 1T4PA 1WOHA 4HWWA
chains in the Genus database with same CATH superfamily
3GN0A 1HQFA 4QA5A 5EEKA 4HWWA 1W22A 3C0ZA 4GSVA 1ZZ1A 5G3WA 3THEA 4DZ4A 2EF5A 1T69A 5BWZA 3EZPA 4IU4A 3SKKA 1C3SA 1WVAA 5G17A 1GQ7A 4Q42A 4QA4A 4RLAA 3E6KA 4QA6A 4FCIA 1TA1A 4CBTA 1T4RA 1ZPGA 2GH6A 2VQVA 5D1BA 3MFWA 5G12A 3SL1A 5G0GA 5LI3A 1GQ6A 1CEVA 5G0JA 1HQGA 4MYLA 5JI5A 4IE2A 1RLAA 5EEIA 3Q9EA 1T4SA 2PLLA 1T64A 4RHQA 3SFHA 2EIVA 4HXQA 4I06A 1P8QA 3EZTA 4CQFA 3E9BA 3SJTA 3GMZA 5IWGA 5THTA 1HQHA 1PQ3A 4BZ8A 5G1BA 3THJA 1ZPEA 4LY1A 4RHMA 4ZUPA 3NIOA 5IX0A 5DC7A 4GWCA 1D3VA 2VQWG 3MMRA 5HJ9A 1P8NA 2V5XA 4GSZA 3Q9FA 2AEBA 3NIQA 4QA0A 4QA1A 4A69A 4Q3QA 4BZ9A 4ZUOA 3C0YA 5DC5A 3LP4A 1C3RA 2PHOA 4IU0A 4IXUA 3NIPA 1T67A 4RHIA 5EFHA 4Q3UA 4RN0A 3TH7A 2VCGA 4MYKA 1T4TA 4Q3TA 3LHLA 3MJLA 3ZNSA 3M1RA 5EFJD 3MAXA 4GWDA 5EFNA 5G0XA 3F07A 4Q40A 3SL0A 1TBLA 4RHLA 3CEVA 4Q3PA 4RN2A 3C10A 5EFGA 5FCWA 2V5WA 1P8OA 2VQJA 5DC6A 5ICNB 4ZURA 1ZZ3A 1C3PA 1P8PA 5CEVA 3LP7A 1HQXA 4CBYA 3Q9CA 4Q3VA 5THUA 3RLAA 5EF7A 4BKXB 2A0MA 1R1OA 5THSA 3RQDA 5G1CA 1TBJA 5EFBD 4Q3RA 3MENA 4CEVA 3MZ7A 4BZ6A 4IU5A 4QA3A 1ZZ0A 3SFFA 1HQ5A 4MXRA 2VQMA 3MZ3A 1XFKA 5G10A 1WOGA 2PHAA 4GSMA 5G0YA 3EW8A 5EENA 5G0HA 4HZEA 5D1CA 3E8QA 5RLAA 4ITYA 3MZ6A 4QA7A 4Q41A 3TF3A 4MYFA 3E8ZA 3E6VA 4Q3SA 4ZUNA 3MFVA 4LXZA 5HJAA 3DJ8A 1P8RA 3KV2A 4BZ7A 5FUEA 5DC8A 5A2SA 1WOIA 4G3HA 4RN1A 2VQQA 3F06A 4RHKA 3THHA 4FCKA 3PZLA 4IE3A 4QA2A 5EF8A 1T5FA 2EF4A 2RLAA 4Q3RC 1P8SA 3ZNRA 4IU1A 5G11A 4BZ5A 5G13A 3F0RA 5THVA 4ZUQA 1T5GA 4IE1A 3F80A 1WVBA 5EEMA 4RHJA 5G1AA 5EFKB 1P8MA 4MYNA 1VKGA 4IXVA 5EEFA 5G0IA 1TBHA 3EWFA 2ZAVA 5D1DA 2VQOA 3Q9BA 3MZ4A 1T4PA 4ZUMA 1WOHA 2CEVA
chains in the Genus database with same CATH topology
3GN0A 1HQFA 4GSVA 3THEA 4DZ4A 2EF5A 4IU4A 3SKKA 1WVAA 1GQ7A 4Q42A 4RLAA 3E6KA 4FCIA 1TA1A 1T4RA 1ZPGA 3SL1A 3MFWA 1GQ6A 1CEVA 1HQGA 4MYLA 4IE2A 1RLAA 1T4SA 2PLLA 4RHQA 2EIVA 4HXQA 4I06A 1P8QA 3E9BA 3SJTA 3GMZA 1HQHA 1PQ3A 3THJA 1ZPEA 4RHMA 3NIOA 4GWCA 1D3VA 3MMRA 5HJ9A 1P8NA 4GSZA 2AEBA 3NIQA 4Q3QA 3LP4A 2PHOA 4IU0A 4IXUA 3NIPA 4RHIA 4Q3UA 3TH7A 4MYKA 4Q3TA 1T4TA 3LHLA 3MJLA 3M1RA 4GWDA 4Q40A 3SL0A 1TBLA 4RHLA 3CEVA 4Q3PA 1P8OA 5CEVA 1P8PA 3LP7A 1HQXA 4Q3VA 3RLAA 2A0MA 1R1OA 1TBJA 4Q3RA 4CEVA 4IU5A 1HQ5A 2CEVA 4MXRA 1XFKA 1WOGA 2PHAA 4GSMA 4HZEA 3E8QA 5RLAA 4ITYA 4Q41A 3TF3A 4MYFA 3E8ZA 3E6VA 4Q3SA 3MFVA 5HJAA 3DJ8A 1P8RA 3KV2A 1WOIA 4G3HA 4RHKA 3THHA 4FCKA 3PZLA 4IE3A 1T5FA 2EF4A 2RLAA 4Q3RC 1P8SA 4IU1A 1T5GA 4IE1A 3F80A 1WVBA 4RHJA 1P8MA 4MYNA 4IXVA 1TBHA 2ZAVA 1T4PA 1WOHA 4HWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN0 A;  1HQF A;  4GSV A;  3THE A;  4DZ4 A;  2EF5 A;  4IU4 A;  3SKK A;  1WVA A;  1GQ7 A;  4Q42 A;  4RLA A;  3E6K A;  4FCI A;  1TA1 A;  1T4R A;  1ZPG A;  3SL1 A;  3MFW A;  1GQ6 A;  1CEV A;  1HQG A;  4MYL A;  4IE2 A;  1RLA A;  1T4S A;  2PLL A;  4RHQ A;  2EIV A;  4HXQ A;  4I06 A;  1P8Q A;  3E9B A;  3SJT A;  3GMZ A;  1HQH A;  1PQ3 A;  3THJ A;  1ZPE A;  4RHM A;  3NIO A;  4GWC A;  1D3V A;  3MMR A;  5HJ9 A;  1P8N A;  4GSZ A;  2AEB A;  3NIQ A;  4Q3Q A;  3LP4 A;  2PHO A;  4IU0 A;  4IXU A;  3NIP A;  4RHI A;  4Q3U A;  3TH7 A;  4MYK A;  4Q3T A;  1T4T A;  3LHL A;  3MJL A;  3M1R A;  4GWD A;  4Q40 A;  3SL0 A;  1TBL A;  4RHL A;  3CEV A;  4Q3P A;  1P8O A;  5CEV A;  1P8P A;  3LP7 A;  1HQX A;  4Q3V A;  3RLA A;  2A0M A;  1R1O A;  1TBJ A;  4Q3R A;  4CEV A;  4IU5 A;  1HQ5 A;  2CEV A;  4MXR A;  1XFK A;  1WOG A;  2PHA A;  4GSM A;  4HZE A;  3E8Q A;  5RLA A;  4ITY A;  4Q41 A;  3TF3 A;  4MYF A;  3E8Z A;  3E6V A;  4Q3S A;  3MFV A;  5HJA A;  3DJ8 A;  1P8R A;  3KV2 A;  1WOI A;  4G3H A;  4RHK A;  3THH A;  4FCK A;  3PZL A;  4IE3 A;  1T5F A;  2EF4 A;  2RLA A;  4Q3R C;  1P8S A;  4IU1 A;  1T5G A;  4IE1 A;  3F80 A;  1WVB A;  4RHJ A;  1P8M A;  4MYN A;  4IXV A;  1TBH A;  2ZAV A;  1T4P A;  1WOH A;  4HWW A; 
#chains in the Genus database with same CATH topology
 3GN0 A;  1HQF A;  4QA5 A;  5EEK A;  4HWW A;  1W22 A;  3C0Z A;  4GSV A;  1ZZ1 A;  5G3W A;  3THE A;  4DZ4 A;  2EF5 A;  1T69 A;  5BWZ A;  3EZP A;  4IU4 A;  3SKK A;  1C3S A;  1WVA A;  5G17 A;  1GQ7 A;  4Q42 A;  4QA4 A;  4RLA A;  3E6K A;  4QA6 A;  4FCI A;  1TA1 A;  4CBT A;  1T4R A;  1ZPG A;  2GH6 A;  2VQV A;  5D1B A;  3MFW A;  5G12 A;  3SL1 A;  5G0G A;  5LI3 A;  1GQ6 A;  1CEV A;  5G0J A;  1HQG A;  4MYL A;  5JI5 A;  4IE2 A;  1RLA A;  5EEI A;  3Q9E A;  1T4S A;  2PLL A;  1T64 A;  4RHQ A;  3SFH A;  2EIV A;  4HXQ A;  4I06 A;  1P8Q A;  3EZT A;  4CQF A;  3E9B A;  3SJT A;  3GMZ A;  5IWG A;  5THT A;  1HQH A;  1PQ3 A;  4BZ8 A;  5G1B A;  3THJ A;  1ZPE A;  4LY1 A;  4RHM A;  4ZUP A;  3NIO A;  5IX0 A;  5DC7 A;  4GWC A;  1D3V A;  2VQW G;  3MMR A;  5HJ9 A;  1P8N A;  2V5X A;  4GSZ A;  3Q9F A;  2AEB A;  3NIQ A;  4QA0 A;  4QA1 A;  4A69 A;  4Q3Q A;  4BZ9 A;  4ZUO A;  3C0Y A;  5DC5 A;  3LP4 A;  1C3R A;  2PHO A;  4IU0 A;  4IXU A;  3NIP A;  1T67 A;  4RHI A;  5EFH A;  4Q3U A;  4RN0 A;  3TH7 A;  2VCG A;  4MYK A;  1T4T A;  4Q3T A;  3LHL A;  3MJL A;  3ZNS A;  3M1R A;  5EFJ D;  3MAX A;  4GWD A;  5EFN A;  5G0X A;  3F07 A;  4Q40 A;  3SL0 A;  1TBL A;  4RHL A;  3CEV A;  4Q3P A;  4RN2 A;  3C10 A;  5EFG A;  5FCW A;  2V5W A;  1P8O A;  2VQJ A;  5DC6 A;  5ICN B;  4ZUR A;  1ZZ3 A;  1C3P A;  1P8P A;  5CEV A;  3LP7 A;  1HQX A;  4CBY A;  3Q9C A;  4Q3V A;  5THU A;  3RLA A;  5EF7 A;  4BKX B;  2A0M A;  1R1O A;  5THS A;  3RQD A;  5G1C A;  1TBJ A;  5EFB D;  4Q3R A;  3MEN A;  4CEV A;  3MZ7 A;  4BZ6 A;  4IU5 A;  4QA3 A;  1ZZ0 A;  3SFF A;  1HQ5 A;  4MXR A;  2VQM A;  3MZ3 A;  1XFK A;  5G10 A;  1WOG A;  2PHA A;  4GSM A;  5G0Y A;  3EW8 A;  5EEN A;  5G0H A;  4HZE A;  5D1C A;  3E8Q A;  5RLA A;  4ITY A;  3MZ6 A;  4QA7 A;  4Q41 A;  3TF3 A;  4MYF A;  3E8Z A;  3E6V A;  4Q3S A;  4ZUN A;  3MFV A;  4LXZ A;  5HJA A;  3DJ8 A;  1P8R A;  3KV2 A;  4BZ7 A;  5FUE A;  5DC8 A;  5A2S A;  1WOI A;  4G3H A;  4RN1 A;  2VQQ A;  3F06 A;  4RHK A;  3THH A;  4FCK A;  3PZL A;  4IE3 A;  4QA2 A;  5EF8 A;  1T5F A;  2EF4 A;  2RLA A;  4Q3R C;  1P8S A;  3ZNR A;  4IU1 A;  5G11 A;  4BZ5 A;  5G13 A;  3F0R A;  5THV A;  4ZUQ A;  1T5G A;  4IE1 A;  3F80 A;  1WVB A;  5EEM A;  4RHJ A;  5G1A A;  5EFK B;  1P8M A;  4MYN A;  1VKG A;  4IXV A;  5EEF A;  5G0I A;  1TBH A;  3EWF A;  2ZAV A;  5D1D A;  2VQO A;  3Q9B A;  3MZ4 A;  1T4P A;  4ZUM A;  1WOH A;  2CEV A; 
#chains in the Genus database with same CATH homology
 3GN0 A;  1HQF A;  4GSV A;  3THE A;  4DZ4 A;  2EF5 A;  4IU4 A;  3SKK A;  1WVA A;  1GQ7 A;  4Q42 A;  4RLA A;  3E6K A;  4FCI A;  1TA1 A;  1T4R A;  1ZPG A;  3SL1 A;  3MFW A;  1GQ6 A;  1CEV A;  1HQG A;  4MYL A;  4IE2 A;  1RLA A;  1T4S A;  2PLL A;  4RHQ A;  2EIV A;  4HXQ A;  4I06 A;  1P8Q A;  3E9B A;  3SJT A;  3GMZ A;  1HQH A;  1PQ3 A;  3THJ A;  1ZPE A;  4RHM A;  3NIO A;  4GWC A;  1D3V A;  3MMR A;  5HJ9 A;  1P8N A;  4GSZ A;  2AEB A;  3NIQ A;  4Q3Q A;  3LP4 A;  2PHO A;  4IU0 A;  4IXU A;  3NIP A;  4RHI A;  4Q3U A;  3TH7 A;  4MYK A;  4Q3T A;  1T4T A;  3LHL A;  3MJL A;  3M1R A;  4GWD A;  4Q40 A;  3SL0 A;  1TBL A;  4RHL A;  3CEV A;  4Q3P A;  1P8O A;  5CEV A;  1P8P A;  3LP7 A;  1HQX A;  4Q3V A;  3RLA A;  2A0M A;  1R1O A;  1TBJ A;  4Q3R A;  4CEV A;  4IU5 A;  1HQ5 A;  2CEV A;  4MXR A;  1XFK A;  1WOG A;  2PHA A;  4GSM A;  4HZE A;  3E8Q A;  5RLA A;  4ITY A;  4Q41 A;  3TF3 A;  4MYF A;  3E8Z A;  3E6V A;  4Q3S A;  3MFV A;  5HJA A;  3DJ8 A;  1P8R A;  3KV2 A;  1WOI A;  4G3H A;  4RHK A;  3THH A;  4FCK A;  3PZL A;  4IE3 A;  1T5F A;  2EF4 A;  2RLA A;  4Q3R C;  1P8S A;  4IU1 A;  1T5G A;  4IE1 A;  3F80 A;  1WVB A;  4RHJ A;  1P8M A;  4MYN A;  4IXV A;  1TBH A;  2ZAV A;  1T4P A;  1WOH A;  4HWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...