3TH7A

Crystal structure of unliganded co2+2-hai (ph 7.0)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
314
structure length
314
Chain Sequence
b'RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Crystal structures of complexes with cobalt-reconstituted human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3th7A00
3TF3A 3MFWA 4Q3UA 1T5GA 5HJ9A 3E6KA 5RLAA 1WOGA 1T4TA 1ZPGA 1CEVA 2EF4A 4RHLA 3E8QA 2ZAVA 4Q3RC 4Q42A 4MYFA 3MJLA 4IU1A 3TH7A 1P8RA 3LHLA 1P8OA 3DJ8A 4HWWA 4FCKA 1TBLA 2PLLA 1T4SA 1TBHA 2A0MA 4GSZA 3RLAA 1P8QA 4RHJA 4IE2A 3MMRA 5HJAA 1P8PA 4Q3VA 4RHQA 2PHOA 4Q3SA 4ITYA 3THJA 2CEVA 4MXRA 1WOIA 3NIQA 4DZ4A 1HQHA 3F80A 1R1OA 1TA1A 1WVAA 4Q41A 4MYLA 1GQ6A 2EF5A 3NIPA 1GQ7A 4GSMA 3LP4A 4GWCA 3E6VA 4Q3PA 1HQGA 4RLAA 3GN0A 4HXQA 4MYNA 4FCIA 3E9BA 4MYKA 1HQXA 3LP7A 1D3VA 1TBJA 3THEA 4GWDA 2EIVA 4IXVA 3SJTA 1PQ3A 1T4PA 4IE1A 4RHKA 1T5FA 3THHA 3M1RA 1P8SA 3SL1A 3E8ZA 4RHIA 1WVBA 5CEVA 1T4RA 3PZLA 4IU4A 2RLAA 4G3HA 2AEBA 3NIOA 4GSVA 1HQ5A 4Q3QA 3GMZA 2PHAA 1HQFA 4IXUA 3SKKA 1ZPEA 4RHMA 3SL0A 1XFKA 4IE3A 3MFVA 4Q40A 4Q3RA 3KV2A 4IU5A 4I06A 4IU0A 4Q3TA 1WOHA 1P8MA 3CEVA 4CEVA 1RLAA 4HZEA 1P8NA
chains in the Genus database with same CATH superfamily
3TF3A 3Q9CA 5G0JA 2VQWG 3MFWA 4RN2A 3MZ6A 4Q3UA 1T5GA 5HJ9A 3E6KA 5EFKB 3Q9BA 1WOGA 5RLAA 1T4TA 1ZPGA 1T67A 1CEVA 2EF4A 4RHLA 3E8QA 5DC7A 5DC6A 2ZAVA 5A2SA 4Q3RC 4Q42A 5G0HA 3MZ7A 5EF7A 4MYFA 3MJLA 4IU1A 3TH7A 5D1DA 5EFGA 4ZUMA 5DC5A 1P8RA 3LHLA 1T69A 1P8OA 3DJ8A 5G0IA 5IWGA 5G1BA 1VKGA 4HWWA 3MZ4A 2VQOA 4FCKA 1TBLA 2PLLA 4CBYA 1T4SA 1TBHA 2A0MA 4QA4A 2VCGA 5G0YA 4GSZA 4QA2A 3RLAA 3F0RA 1P8QA 5EF8A 4RHJA 4IE2A 3MMRA 5HJAA 1P8PA 4Q3VA 4RHQA 5D1BA 4ZURA 2PHOA 4Q3SA 4ITYA 5EFNA 5G11A 3THJA 4LXZA 2CEVA 4CQFA 4MXRA 1T64A 5G10A 4LY1A 5EENA 1WOIA 3NIQA 3SFHA 4DZ4A 5FCWA 1HQHA 4BZ8A 5ICNB 3F80A 3EWFA 4BKXB 4BZ6A 1R1OA 3SFFA 5EEIA 4QA1A 1TA1A 1WVAA 4Q41A 4MYLA 3EZTA 5DC8A 3C0ZA 5G12A 5G17A 1GQ6A 2V5XA 2EF5A 2VQMA 3C0YA 3NIPA 4QA7A 1GQ7A 4BZ7A 1C3PA 5EFBD 4GSMA 4QA6A 3LP4A 4GWCA 3Q9EA 3E6VA 5EFJD 4Q3PA 5BWZA 2V5WA 3F07A 1W22A 1HQGA 2VQQA 5EFHA 4RLAA 5FUEA 5THTA 5EEKA 3GN0A 5THUA 5THSA 4HXQA 5G3WA 5G1CA 4RN0A 4MYNA 4FCIA 3E9BA 4MYKA 1HQXA 3LP7A 4ZUOA 3F06A 3Q9FA 1D3VA 1TBJA 5G1AA 3THEA 4GWDA 2EIVA 4IXVA 3SJTA 5JI5A 3RQDA 1PQ3A 1T4PA 4IE1A 4RHKA 4ZUQA 3EZPA 4QA3A 1T5FA 3THHA 3M1RA 5G0GA 1P8SA 5THVA 3SL1A 3E8ZA 4BZ5A 4BZ9A 4CBTA 4QA5A 3ZNSA 4RHIA 1WVBA 1ZZ3A 2VQJA 5G0XA 1T4RA 3PZLA 5CEVA 4IU4A 2RLAA 3MENA 5EEFA 4G3HA 1ZZ0A 2AEBA 3NIOA 1HQ5A 4GSVA 4Q3QA 5IX0A 3MAXA 1ZZ1A 4QA0A 3GMZA 4A69A 4ZUPA 2PHAA 5G13A 1HQFA 4IXUA 4ZUNA 3SKKA 3ZNRA 3C10A 1ZPEA 4RHMA 3SL0A 2GH6A 1XFKA 4RN1A 3MZ3A 4IE3A 3EW8A 3MFVA 4Q40A 4Q3RA 3KV2A 5D1CA 4IU5A 4I06A 2VQVA 4IU0A 4Q3TA 1WOHA 1C3RA 1P8MA 5EEMA 3CEVA 1C3SA 4CEVA 1RLAA 4HZEA 1P8NA 5LI3A
chains in the Genus database with same CATH topology
3TF3A 3MFWA 4Q3UA 1T5GA 5HJ9A 3E6KA 5RLAA 1WOGA 1T4TA 1ZPGA 1CEVA 2EF4A 4RHLA 3E8QA 2ZAVA 4Q3RC 4Q42A 4MYFA 3MJLA 4IU1A 3TH7A 1P8RA 3LHLA 1P8OA 3DJ8A 4HWWA 4FCKA 1TBLA 2PLLA 1T4SA 1TBHA 2A0MA 4GSZA 3RLAA 1P8QA 4RHJA 4IE2A 3MMRA 5HJAA 1P8PA 4Q3VA 4RHQA 2PHOA 4Q3SA 4ITYA 3THJA 2CEVA 4MXRA 1WOIA 3NIQA 4DZ4A 1HQHA 3F80A 1R1OA 1TA1A 1WVAA 4Q41A 4MYLA 1GQ6A 2EF5A 3NIPA 1GQ7A 4GSMA 3LP4A 4GWCA 3E6VA 4Q3PA 1HQGA 4RLAA 3GN0A 4HXQA 4MYNA 4FCIA 3E9BA 4MYKA 1HQXA 3LP7A 1D3VA 1TBJA 3THEA 4GWDA 2EIVA 4IXVA 3SJTA 1PQ3A 1T4PA 4IE1A 4RHKA 1T5FA 3THHA 3M1RA 1P8SA 3SL1A 3E8ZA 4RHIA 1WVBA 5CEVA 1T4RA 3PZLA 4IU4A 2RLAA 4G3HA 2AEBA 3NIOA 4GSVA 1HQ5A 4Q3QA 3GMZA 2PHAA 1HQFA 4IXUA 3SKKA 1ZPEA 4RHMA 3SL0A 1XFKA 4IE3A 3MFVA 4Q40A 4Q3RA 3KV2A 4IU5A 4I06A 4IU0A 4Q3TA 1WOHA 1P8MA 3CEVA 4CEVA 1RLAA 4HZEA 1P8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TF3 A;  3MFW A;  4Q3U A;  1T5G A;  5HJ9 A;  3E6K A;  5RLA A;  1WOG A;  1T4T A;  1ZPG A;  1CEV A;  2EF4 A;  4RHL A;  3E8Q A;  2ZAV A;  4Q3R C;  4Q42 A;  4MYF A;  3MJL A;  4IU1 A;  3TH7 A;  1P8R A;  3LHL A;  1P8O A;  3DJ8 A;  4HWW A;  4FCK A;  1TBL A;  2PLL A;  1T4S A;  1TBH A;  2A0M A;  4GSZ A;  3RLA A;  1P8Q A;  4RHJ A;  4IE2 A;  3MMR A;  5HJA A;  1P8P A;  4Q3V A;  4RHQ A;  2PHO A;  4Q3S A;  4ITY A;  3THJ A;  2CEV A;  4MXR A;  1WOI A;  3NIQ A;  4DZ4 A;  1HQH A;  3F80 A;  1R1O A;  1TA1 A;  1WVA A;  4Q41 A;  4MYL A;  1GQ6 A;  2EF5 A;  3NIP A;  1GQ7 A;  4GSM A;  3LP4 A;  4GWC A;  3E6V A;  4Q3P A;  1HQG A;  4RLA A;  3GN0 A;  4HXQ A;  4MYN A;  4FCI A;  3E9B A;  4MYK A;  1HQX A;  3LP7 A;  1D3V A;  1TBJ A;  3THE A;  4GWD A;  2EIV A;  4IXV A;  3SJT A;  1PQ3 A;  1T4P A;  4IE1 A;  4RHK A;  1T5F A;  3THH A;  3M1R A;  1P8S A;  3SL1 A;  3E8Z A;  4RHI A;  1WVB A;  5CEV A;  1T4R A;  3PZL A;  4IU4 A;  2RLA A;  4G3H A;  2AEB A;  3NIO A;  4GSV A;  1HQ5 A;  4Q3Q A;  3GMZ A;  2PHA A;  1HQF A;  4IXU A;  3SKK A;  1ZPE A;  4RHM A;  3SL0 A;  1XFK A;  4IE3 A;  3MFV A;  4Q40 A;  4Q3R A;  3KV2 A;  4IU5 A;  4I06 A;  4IU0 A;  4Q3T A;  1WOH A;  1P8M A;  3CEV A;  4CEV A;  1RLA A;  4HZE A;  1P8N A; 
#chains in the Genus database with same CATH topology
 3TF3 A;  3Q9C A;  5G0J A;  2VQW G;  3MFW A;  4RN2 A;  3MZ6 A;  4Q3U A;  1T5G A;  5HJ9 A;  3E6K A;  5EFK B;  3Q9B A;  1WOG A;  5RLA A;  1T4T A;  1ZPG A;  1T67 A;  1CEV A;  2EF4 A;  4RHL A;  3E8Q A;  5DC7 A;  5DC6 A;  2ZAV A;  5A2S A;  4Q3R C;  4Q42 A;  5G0H A;  3MZ7 A;  5EF7 A;  4MYF A;  3MJL A;  4IU1 A;  3TH7 A;  5D1D A;  5EFG A;  4ZUM A;  5DC5 A;  1P8R A;  3LHL A;  1T69 A;  1P8O A;  3DJ8 A;  5G0I A;  5IWG A;  5G1B A;  1VKG A;  4HWW A;  3MZ4 A;  2VQO A;  4FCK A;  1TBL A;  2PLL A;  4CBY A;  1T4S A;  1TBH A;  2A0M A;  4QA4 A;  2VCG A;  5G0Y A;  4GSZ A;  4QA2 A;  3RLA A;  3F0R A;  1P8Q A;  5EF8 A;  4RHJ A;  4IE2 A;  3MMR A;  5HJA A;  1P8P A;  4Q3V A;  4RHQ A;  5D1B A;  4ZUR A;  2PHO A;  4Q3S A;  4ITY A;  5EFN A;  5G11 A;  3THJ A;  4LXZ A;  2CEV A;  4CQF A;  4MXR A;  1T64 A;  5G10 A;  4LY1 A;  5EEN A;  1WOI A;  3NIQ A;  3SFH A;  4DZ4 A;  5FCW A;  1HQH A;  4BZ8 A;  5ICN B;  3F80 A;  3EWF A;  4BKX B;  4BZ6 A;  1R1O A;  3SFF A;  5EEI A;  4QA1 A;  1TA1 A;  1WVA A;  4Q41 A;  4MYL A;  3EZT A;  5DC8 A;  3C0Z A;  5G12 A;  5G17 A;  1GQ6 A;  2V5X A;  2EF5 A;  2VQM A;  3C0Y A;  3NIP A;  4QA7 A;  1GQ7 A;  4BZ7 A;  1C3P A;  5EFB D;  4GSM A;  4QA6 A;  3LP4 A;  4GWC A;  3Q9E A;  3E6V A;  5EFJ D;  4Q3P A;  5BWZ A;  2V5W A;  3F07 A;  1W22 A;  1HQG A;  2VQQ A;  5EFH A;  4RLA A;  5FUE A;  5THT A;  5EEK A;  3GN0 A;  5THU A;  5THS A;  4HXQ A;  5G3W A;  5G1C A;  4RN0 A;  4MYN A;  4FCI A;  3E9B A;  4MYK A;  1HQX A;  3LP7 A;  4ZUO A;  3F06 A;  3Q9F A;  1D3V A;  1TBJ A;  5G1A A;  3THE A;  4GWD A;  2EIV A;  4IXV A;  3SJT A;  5JI5 A;  3RQD A;  1PQ3 A;  1T4P A;  4IE1 A;  4RHK A;  4ZUQ A;  3EZP A;  4QA3 A;  1T5F A;  3THH A;  3M1R A;  5G0G A;  1P8S A;  5THV A;  3SL1 A;  3E8Z A;  4BZ5 A;  4BZ9 A;  4CBT A;  4QA5 A;  3ZNS A;  4RHI A;  1WVB A;  1ZZ3 A;  2VQJ A;  5G0X A;  1T4R A;  3PZL A;  5CEV A;  4IU4 A;  2RLA A;  3MEN A;  5EEF A;  4G3H A;  1ZZ0 A;  2AEB A;  3NIO A;  1HQ5 A;  4GSV A;  4Q3Q A;  5IX0 A;  3MAX A;  1ZZ1 A;  4QA0 A;  3GMZ A;  4A69 A;  4ZUP A;  2PHA A;  5G13 A;  1HQF A;  4IXU A;  4ZUN A;  3SKK A;  3ZNR A;  3C10 A;  1ZPE A;  4RHM A;  3SL0 A;  2GH6 A;  1XFK A;  4RN1 A;  3MZ3 A;  4IE3 A;  3EW8 A;  3MFV A;  4Q40 A;  4Q3R A;  3KV2 A;  5D1C A;  4IU5 A;  4I06 A;  2VQV A;  4IU0 A;  4Q3T A;  1WOH A;  1C3R A;  1P8M A;  5EEM A;  3CEV A;  1C3S A;  4CEV A;  1RLA A;  4HZE A;  1P8N A;  5LI3 A; 
#chains in the Genus database with same CATH homology
 3TF3 A;  3MFW A;  4Q3U A;  1T5G A;  5HJ9 A;  3E6K A;  5RLA A;  1WOG A;  1T4T A;  1ZPG A;  1CEV A;  2EF4 A;  4RHL A;  3E8Q A;  2ZAV A;  4Q3R C;  4Q42 A;  4MYF A;  3MJL A;  4IU1 A;  3TH7 A;  1P8R A;  3LHL A;  1P8O A;  3DJ8 A;  4HWW A;  4FCK A;  1TBL A;  2PLL A;  1T4S A;  1TBH A;  2A0M A;  4GSZ A;  3RLA A;  1P8Q A;  4RHJ A;  4IE2 A;  3MMR A;  5HJA A;  1P8P A;  4Q3V A;  4RHQ A;  2PHO A;  4Q3S A;  4ITY A;  3THJ A;  2CEV A;  4MXR A;  1WOI A;  3NIQ A;  4DZ4 A;  1HQH A;  3F80 A;  1R1O A;  1TA1 A;  1WVA A;  4Q41 A;  4MYL A;  1GQ6 A;  2EF5 A;  3NIP A;  1GQ7 A;  4GSM A;  3LP4 A;  4GWC A;  3E6V A;  4Q3P A;  1HQG A;  4RLA A;  3GN0 A;  4HXQ A;  4MYN A;  4FCI A;  3E9B A;  4MYK A;  1HQX A;  3LP7 A;  1D3V A;  1TBJ A;  3THE A;  4GWD A;  2EIV A;  4IXV A;  3SJT A;  1PQ3 A;  1T4P A;  4IE1 A;  4RHK A;  1T5F A;  3THH A;  3M1R A;  1P8S A;  3SL1 A;  3E8Z A;  4RHI A;  1WVB A;  5CEV A;  1T4R A;  3PZL A;  4IU4 A;  2RLA A;  4G3H A;  2AEB A;  3NIO A;  4GSV A;  1HQ5 A;  4Q3Q A;  3GMZ A;  2PHA A;  1HQF A;  4IXU A;  3SKK A;  1ZPE A;  4RHM A;  3SL0 A;  1XFK A;  4IE3 A;  3MFV A;  4Q40 A;  4Q3R A;  3KV2 A;  4IU5 A;  4I06 A;  4IU0 A;  4Q3T A;  1WOH A;  1P8M A;  3CEV A;  4CEV A;  1RLA A;  4HZE A;  1P8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...