1XLYA

X-ray structure of the rna-binding protein she2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
232
structure length
224
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHE2p
publication title She2p is a novel RNA binding protein with a basic helical hairpin motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 92
structure length 224
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 1xlyA00
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH superfamily
2VD6A 5D6BA 2FUSA 1HY0A 4EFCA 5F92A 1B8FA 2J91A 1JSWA 4FLCA 1YFMA 1C3UA 2O6YA 3E04A 1C3CA 1Y2MA 2OHYA 2NYFA 1GK2A 2PTSA 1TJWA 1FUQA 4APBA 1U15A 3R6VA 4NLEA 5EYTA 3KDYA 4BABA 4C5UA 3QBPA 3CZOA 4EEIA 1GK3A 1Q5NA 2QGAB 5M0IA 1XLYA 4HGVA 2O7DA 4C5SA 1XWOA 2O78A 2QVEA 4BAAA 3R6YA 2O7EA 4V2RA 3OCEA 1HY1A 4WNLA 1TJVA 1T6PA 2HVGA 1AUWA 2X75A 1GKMA 4ADLA 2O7FA 1FUOA 4NSLA 5M0JA 5EYVA 1I0AA 1DOFA 3NO9A 1FURA 3GTDA 4V2QA 4CQ5A 4C6GA 4FFXA 3R6QA 1EB4A 1KQ7A 4APAA 5F91A 2RJSA 4C5RA 1GKJA 3NZ4A 2NYNA 2RJRA 1VDKA 1FUPA 2O7BA 1TJ7A 2PTQA 2PFMA 3GZHA 3UNVA 4ADMA 2PTRA 3OCFA 3C8TA 3RD8A 3RRPA 2FELA 4MX2A 1U16A 1YFEA 2E9FA 1J3UA 3KDZA 3BHGA 3TV2A 2YIIA 1T6JA 1K7WA 1TJUA 1DCNA 5HW2A 1YISA 1W27A 1RE5A 1K62A 2FENA
chains in the Genus database with same CATH topology
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
#chains in the Genus database with same CATH topology
 2VD6 A;  5D6B A;  2FUS A;  1HY0 A;  4EFC A;  5F92 A;  1B8F A;  2J91 A;  1JSW A;  4FLC A;  1YFM A;  1C3U A;  2O6Y A;  3E04 A;  1C3C A;  1Y2M A;  2OHY A;  2NYF A;  1GK2 A;  2PTS A;  1TJW A;  1FUQ A;  4APB A;  1U15 A;  3R6V A;  4NLE A;  5EYT A;  3KDY A;  4BAB A;  4C5U A;  3QBP A;  3CZO A;  4EEI A;  1GK3 A;  1Q5N A;  2QGA B;  5M0I A;  1XLY A;  4HGV A;  2O7D A;  4C5S A;  1XWO A;  2O78 A;  2QVE A;  4BAA A;  3R6Y A;  2O7E A;  4V2R A;  3OCE A;  1HY1 A;  4WNL A;  1TJV A;  1T6P A;  2HVG A;  1AUW A;  2X75 A;  1GKM A;  4ADL A;  2O7F A;  1FUO A;  4NSL A;  5M0J A;  5EYV A;  1I0A A;  1DOF A;  3NO9 A;  1FUR A;  3GTD A;  4V2Q A;  4CQ5 A;  4C6G A;  4FFX A;  3R6Q A;  1EB4 A;  1KQ7 A;  4APA A;  5F91 A;  2RJS A;  4C5R A;  1GKJ A;  3NZ4 A;  2NYN A;  2RJR A;  1VDK A;  1FUP A;  2O7B A;  1TJ7 A;  2PTQ A;  2PFM A;  3GZH A;  3UNV A;  4ADM A;  2PTR A;  3OCF A;  3C8T A;  3RD8 A;  3RRP A;  2FEL A;  4MX2 A;  1U16 A;  1YFE A;  2E9F A;  1J3U A;  3KDZ A;  3BHG A;  3TV2 A;  2YII A;  1T6J A;  1K7W A;  1TJU A;  1DCN A;  5HW2 A;  1YIS A;  1W27 A;  1RE5 A;  1K62 A;  2FEN A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...