1XLYA

X-ray structure of the rna-binding protein she2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
232
structure length
224
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title She2p is a novel RNA binding protein with a basic helical hairpin motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords SHE2p
total genus 92
structure length 224
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 1xlyA00
5M0JA 5M0IA 4WNLA 1XLYA
chains in the Genus database with same CATH superfamily
1HY1A 2FENA 4ADMA 2J91A 4V2RA 2HVGA 3CZOA 1J3UA 3C8TA 3KDZA 1B8FA 2QGAB 4BAAA 3OCEA 4BABA 5EYTA 3RD8A 2VD6A 2PFMA 5M0IA 1JSWA 4NLEA 1Y2MA 4APBA 1K62A 1I0AA 1AUWA 5D6BA 4EFCA 1T6PA 2PTQA 4WNLA 4NSLA 2OHYA 3E04A 1FURA 1FUOA 1RE5A 3GTDA 3R6YA 1VDKA 3NO9A 5M0JA 2NYNA 1T6JA 1YFMA 4EEIA 4C5UA 1XLYA 4CQ5A 1YFEA 1GKJA 1TJ7A 2X75A 3TV2A 1HY0A 2FUSA 1U15A 3OCFA 2O6YA 5F92A 1U16A 1Q5NA 3QBPA 1K7WA 4APAA 1TJVA 1EB4A 1KQ7A 1DOFA 2NYFA 4C6GA 2PTSA 1XWOA 3R6VA 1GK2A 1YISA 4FFXA 2FELA 3BHGA 3R6QA 5EYVA 2O7DA 4FLCA 1C3UA 2QVEA 4V2QA 1DCNA 4HGVA 5F91A 4ADLA 2YIIA 2RJRA 4C5RA 4MX2A 3GZHA 1FUPA 3KDYA 3NZ4A 3RRPA 1C3CA 1TJWA 1GK3A 1W27A 2O7EA 1TJUA 2O7FA 2PTRA 2O78A 1FUQA 4C5SA 2E9FA 2O7BA 1GKMA 2RJSA 5HW2A 3UNVA
chains in the Genus database with same CATH topology
5M0JA 5M0IA 4WNLA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0J A;  5M0I A;  4WNL A;  1XLY A; 
#chains in the Genus database with same CATH topology
 1HY1 A;  2FEN A;  4ADM A;  2J91 A;  4V2R A;  2HVG A;  3CZO A;  1J3U A;  3C8T A;  3KDZ A;  1B8F A;  2QGA B;  4BAA A;  3OCE A;  4BAB A;  5EYT A;  3RD8 A;  2VD6 A;  2PFM A;  5M0I A;  1JSW A;  4NLE A;  1Y2M A;  4APB A;  1K62 A;  1I0A A;  1AUW A;  5D6B A;  4EFC A;  1T6P A;  2PTQ A;  4WNL A;  4NSL A;  2OHY A;  3E04 A;  1FUR A;  1FUO A;  1RE5 A;  3GTD A;  3R6Y A;  1VDK A;  3NO9 A;  5M0J A;  2NYN A;  1T6J A;  1YFM A;  4EEI A;  4C5U A;  1XLY A;  4CQ5 A;  1YFE A;  1GKJ A;  1TJ7 A;  2X75 A;  3TV2 A;  1HY0 A;  2FUS A;  1U15 A;  3OCF A;  2O6Y A;  5F92 A;  1U16 A;  1Q5N A;  3QBP A;  1K7W A;  4APA A;  1TJV A;  1EB4 A;  1KQ7 A;  1DOF A;  2NYF A;  4C6G A;  2PTS A;  1XWO A;  3R6V A;  1GK2 A;  1YIS A;  4FFX A;  2FEL A;  3BHG A;  3R6Q A;  5EYV A;  2O7D A;  4FLC A;  1C3U A;  2QVE A;  4V2Q A;  1DCN A;  4HGV A;  5F91 A;  4ADL A;  2YII A;  2RJR A;  4C5R A;  4MX2 A;  3GZH A;  1FUP A;  3KDY A;  3NZ4 A;  3RRP A;  1C3C A;  1TJW A;  1GK3 A;  1W27 A;  2O7E A;  1TJU A;  2O7F A;  2PTR A;  2O78 A;  1FUQ A;  4C5S A;  2E9F A;  2O7B A;  1GKM A;  2RJS A;  5HW2 A;  3UNV A; 
#chains in the Genus database with same CATH homology
 5M0J A;  5M0I A;  4WNL A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...