1XLYA

X-ray structure of the rna-binding protein she2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
232
structure length
224
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title She2p is a novel RNA binding protein with a basic helical hairpin motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords SHE2p
total genus 92
structure length 224
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 1xlyA00
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH superfamily
1AUWA 2O7BA 1I0AA 1FURA 2PFMA 2HVGA 4WNLA 5M0IA 4FLCA 1U16A 2J91A 1TJ7A 1HY1A 2RJSA 4C5RA 3QBPA 4ADLA 1K7WA 1W27A 3E04A 3NO9A 1XWOA 2X75A 4C5SA 4CQ5A 1DCNA 1TJVA 1YFEA 4EFCA 3BHGA 1GK3A 1FUOA 1VDKA 2FUSA 1JSWA 5F91A 4EEIA 2O7FA 1FUPA 2YIIA 2O6YA 1RE5A 5M0JA 4HGVA 3OCEA 1T6PA 3GZHA 3RRPA 3KDYA 1XLYA 1Y2MA 3KDZA 1GKMA 3R6QA 5EYTA 1EB4A 3GTDA 2O78A 4BABA 2PTSA 1K62A 3C8TA 2E9FA 1T6JA 4V2QA 4V2RA 3OCFA 2PTQA 3UNVA 2O7DA 4BAAA 1TJUA 1Q5NA 2RJRA 1DOFA 1YISA 3NZ4A 1FUQA 4C5UA 2QVEA 1B8FA 4NLEA 2OHYA 1C3UA 2NYNA 2NYFA 4FFXA 5HW2A 5F92A 2VD6A 2FELA 1TJWA 2O7EA 3RD8A 4ADMA 1YFMA 4MX2A 1C3CA 3TV2A 3R6VA 1KQ7A 4C6GA 2PTRA 3R6YA 4APAA 5D6BA 4APBA 1GKJA 1U15A 5EYVA 1HY0A 2FENA 1J3UA 1GK2A 2QGAB 4NSLA 3CZOA
chains in the Genus database with same CATH topology
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
#chains in the Genus database with same CATH topology
 1AUW A;  2O7B A;  1I0A A;  1FUR A;  2PFM A;  2HVG A;  4WNL A;  5M0I A;  4FLC A;  1U16 A;  2J91 A;  1TJ7 A;  1HY1 A;  2RJS A;  4C5R A;  3QBP A;  4ADL A;  1K7W A;  1W27 A;  3E04 A;  3NO9 A;  1XWO A;  2X75 A;  4C5S A;  4CQ5 A;  1DCN A;  1TJV A;  1YFE A;  4EFC A;  3BHG A;  1GK3 A;  1FUO A;  1VDK A;  2FUS A;  1JSW A;  5F91 A;  4EEI A;  2O7F A;  1FUP A;  2YII A;  2O6Y A;  1RE5 A;  5M0J A;  4HGV A;  3OCE A;  1T6P A;  3GZH A;  3RRP A;  3KDY A;  1XLY A;  1Y2M A;  3KDZ A;  1GKM A;  3R6Q A;  5EYT A;  1EB4 A;  3GTD A;  2O78 A;  4BAB A;  2PTS A;  1K62 A;  3C8T A;  2E9F A;  1T6J A;  4V2Q A;  4V2R A;  3OCF A;  2PTQ A;  3UNV A;  2O7D A;  4BAA A;  1TJU A;  1Q5N A;  2RJR A;  1DOF A;  1YIS A;  3NZ4 A;  1FUQ A;  4C5U A;  2QVE A;  1B8F A;  4NLE A;  2OHY A;  1C3U A;  2NYN A;  2NYF A;  4FFX A;  5HW2 A;  5F92 A;  2VD6 A;  2FEL A;  1TJW A;  2O7E A;  3RD8 A;  4ADM A;  1YFM A;  4MX2 A;  1C3C A;  3TV2 A;  3R6V A;  1KQ7 A;  4C6G A;  2PTR A;  3R6Y A;  4APA A;  5D6B A;  4APB A;  1GKJ A;  1U15 A;  5EYV A;  1HY0 A;  2FEN A;  1J3U A;  1GK2 A;  2QGA B;  4NSL A;  3CZO A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...