1XLYA

X-ray structure of the rna-binding protein she2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
232
structure length
224
Chain Sequence
b'DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHE2p
publication title She2p is a novel RNA binding protein with a basic helical hairpin motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 92
structure length 224
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 1xlyA00
1XLYA 4WNLA 5M0IA 5M0JA
chains in the Genus database with same CATH superfamily
4WNLA 1KQ7A 3RRPA 2FUSA 2O7DA 3OCEA 5F91A 2PTSA 1DOFA 5HW2A 1T6JA 1I0AA 2NYFA 2RJRA 4EEIA 4FFXA 1JSWA 2OHYA 1C3UA 2FELA 1C3CA 1B8FA 2O6YA 2QGAB 4C5UA 3GTDA 3KDZA 1T6PA 2PFMA 1K62A 4V2QA 2E9FA 4V2RA 1TJWA 1YFMA 5M0JA 2QVEA 1Q5NA 1AUWA 1RE5A 3R6VA 2VD6A 5EYTA 4ADMA 1DCNA 2O7FA 1GKMA 5EYVA 4C5SA 1TJUA 1GKJA 1U16A 3UNVA 1XWOA 5M0IA 3KDYA 4C5RA 3GZHA 2NYNA 4ADLA 1U15A 3RD8A 2PTRA 5D6BA 2O78A 1FUPA 2X75A 1XLYA 1J3UA 2O7BA 2RJSA 4APAA 3NZ4A 3R6QA 1FUQA 4NLEA 2O7EA 4EFCA 4BAAA 3R6YA 2PTQA 3C8TA 3E04A 1HY0A 1Y2MA 4C6GA 4APBA 5F92A 3OCFA 1FUOA 1GK3A 3BHGA 2YIIA 2FENA 1HY1A 1FURA 2HVGA 1TJVA 4CQ5A 3TV2A 3CZOA 3QBPA 1VDKA 1EB4A 1GK2A 2J91A 4BABA 4NSLA 1YFEA 1K7WA 4FLCA 3NO9A 4MX2A 1YISA 4HGVA 1W27A 1TJ7A
chains in the Genus database with same CATH topology
1XLYA 4WNLA 5M0IA 5M0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLY A;  4WNL A;  5M0I A;  5M0J A; 
#chains in the Genus database with same CATH topology
 4WNL A;  1KQ7 A;  3RRP A;  2FUS A;  2O7D A;  3OCE A;  5F91 A;  2PTS A;  1DOF A;  5HW2 A;  1T6J A;  1I0A A;  2NYF A;  2RJR A;  4EEI A;  4FFX A;  1JSW A;  2OHY A;  1C3U A;  2FEL A;  1C3C A;  1B8F A;  2O6Y A;  2QGA B;  4C5U A;  3GTD A;  3KDZ A;  1T6P A;  2PFM A;  1K62 A;  4V2Q A;  2E9F A;  4V2R A;  1TJW A;  1YFM A;  5M0J A;  2QVE A;  1Q5N A;  1AUW A;  1RE5 A;  3R6V A;  2VD6 A;  5EYT A;  4ADM A;  1DCN A;  2O7F A;  1GKM A;  5EYV A;  4C5S A;  1TJU A;  1GKJ A;  1U16 A;  3UNV A;  1XWO A;  5M0I A;  3KDY A;  4C5R A;  3GZH A;  2NYN A;  4ADL A;  1U15 A;  3RD8 A;  2PTR A;  5D6B A;  2O78 A;  1FUP A;  2X75 A;  1XLY A;  1J3U A;  2O7B A;  2RJS A;  4APA A;  3NZ4 A;  3R6Q A;  1FUQ A;  4NLE A;  2O7E A;  4EFC A;  4BAA A;  3R6Y A;  2PTQ A;  3C8T A;  3E04 A;  1HY0 A;  1Y2M A;  4C6G A;  4APB A;  5F92 A;  3OCF A;  1FUO A;  1GK3 A;  3BHG A;  2YII A;  2FEN A;  1HY1 A;  1FUR A;  2HVG A;  1TJV A;  4CQ5 A;  3TV2 A;  3CZO A;  3QBP A;  1VDK A;  1EB4 A;  1GK2 A;  2J91 A;  4BAB A;  4NSL A;  1YFE A;  1K7W A;  4FLC A;  3NO9 A;  4MX2 A;  1YIS A;  4HGV A;  1W27 A;  1TJ7 A; 
#chains in the Genus database with same CATH homology
 1XLY A;  4WNL A;  5M0I A;  5M0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...