1XLYA

X-ray structure of the rna-binding protein she2p
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
232
structure length
224
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINEGKNELDPEADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords SHE2p
publication title She2p is a novel RNA binding protein with a basic helical hairpin motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 92
structure length 224
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 1xlyA00
1XLYA 5M0IA 5M0JA 4WNLA
chains in the Genus database with same CATH superfamily
3TV2A 2O7FA 2E9FA 1Q5NA 1U15A 2FELA 2QGAB 3RRPA 5D6BA 1W27A 1XLYA 1YFEA 4FFXA 1VDKA 5F92A 1K7WA 1DOFA 1FURA 1C3CA 3UNVA 4C5RA 1HY0A 3GZHA 3KDZA 4APAA 4CQ5A 2O7EA 1C3UA 1GK3A 1GKJA 1EB4A 3NZ4A 2O7DA 2VD6A 2FUSA 1J3UA 1AUWA 4V2RA 1GKMA 2NYNA 3OCEA 4MX2A 4C5UA 3R6QA 4APBA 2O6YA 1T6JA 4C5SA 5HW2A 1YISA 1FUPA 1TJWA 1K62A 4EFCA 1T6PA 4EEIA 2YIIA 5M0IA 2OHYA 3RD8A 1B8FA 2J91A 3NO9A 1GK2A 2X75A 4NSLA 4BAAA 5EYVA 3C8TA 1YFMA 2PTQA 1FUOA 3R6VA 3GTDA 2O78A 1TJVA 4FLCA 4ADMA 3BHGA 1RE5A 1DCNA 5F91A 3E04A 1XWOA 2PFMA 3CZOA 1FUQA 2NYFA 2HVGA 1TJUA 3KDYA 5EYTA 1U16A 1TJ7A 2FENA 1I0AA 2RJRA 5M0JA 1JSWA 4NLEA 4V2QA 2QVEA 2PTRA 3R6YA 4BABA 4HGVA 2RJSA 3OCFA 2O7BA 4ADLA 1HY1A 1Y2MA 2PTSA 3QBPA 4C6GA 1KQ7A 4WNLA
chains in the Genus database with same CATH topology
1XLYA 5M0IA 5M0JA 4WNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLY A;  5M0I A;  5M0J A;  4WNL A; 
#chains in the Genus database with same CATH topology
 3TV2 A;  2O7F A;  2E9F A;  1Q5N A;  1U15 A;  2FEL A;  2QGA B;  3RRP A;  5D6B A;  1W27 A;  1XLY A;  1YFE A;  4FFX A;  1VDK A;  5F92 A;  1K7W A;  1DOF A;  1FUR A;  1C3C A;  3UNV A;  4C5R A;  1HY0 A;  3GZH A;  3KDZ A;  4APA A;  4CQ5 A;  2O7E A;  1C3U A;  1GK3 A;  1GKJ A;  1EB4 A;  3NZ4 A;  2O7D A;  2VD6 A;  2FUS A;  1J3U A;  1AUW A;  4V2R A;  1GKM A;  2NYN A;  3OCE A;  4MX2 A;  4C5U A;  3R6Q A;  4APB A;  2O6Y A;  1T6J A;  4C5S A;  5HW2 A;  1YIS A;  1FUP A;  1TJW A;  1K62 A;  4EFC A;  1T6P A;  4EEI A;  2YII A;  5M0I A;  2OHY A;  3RD8 A;  1B8F A;  2J91 A;  3NO9 A;  1GK2 A;  2X75 A;  4NSL A;  4BAA A;  5EYV A;  3C8T A;  1YFM A;  2PTQ A;  1FUO A;  3R6V A;  3GTD A;  2O78 A;  1TJV A;  4FLC A;  4ADM A;  3BHG A;  1RE5 A;  1DCN A;  5F91 A;  3E04 A;  1XWO A;  2PFM A;  3CZO A;  1FUQ A;  2NYF A;  2HVG A;  1TJU A;  3KDY A;  5EYT A;  1U16 A;  1TJ7 A;  2FEN A;  1I0A A;  2RJR A;  5M0J A;  1JSW A;  4NLE A;  4V2Q A;  2QVE A;  2PTR A;  3R6Y A;  4BAB A;  4HGV A;  2RJS A;  3OCF A;  2O7B A;  4ADL A;  1HY1 A;  1Y2M A;  2PTS A;  3QBP A;  4C6G A;  1KQ7 A;  4WNL A; 
#chains in the Genus database with same CATH homology
 1XLY A;  5M0I A;  5M0J A;  4WNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...