5M0JA

Crystal structure of the cytoplasmic complex with she2p, she3p, and the ash1 mrna e3-localization element
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
238
structure length
223
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
molecule tags Rna binding protein
total genus 95
structure length 223
sequence length 238
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0jA00
4WNLA 5M0IA 5M0JA 1XLYA
chains in the Genus database with same CATH superfamily
4EFCA 3RRPA 1TJVA 3R6QA 4BABA 2NYFA 1HY1A 5F92A 1YISA 5EYVA 4ADLA 3NO9A 1GKMA 2PTRA 5F91A 3R6VA 4MX2A 2E9FA 1EB4A 1U16A 3R6YA 4V2QA 3KDZA 2YIIA 1DCNA 4APBA 3UNVA 1DOFA 3C8TA 1I0AA 2PTQA 2O7DA 4HGVA 1B8FA 2O7EA 4WNLA 1W27A 2PFMA 2PTSA 2O7FA 1HY0A 2O78A 2RJSA 4C5SA 1JSWA 4V2RA 4C6GA 1Q5NA 2O6YA 2RJRA 5D6BA 3CZOA 4C5UA 1Y2MA 4BAAA 1TJUA 1XWOA 1T6JA 2HVGA 3RD8A 4C5RA 2FENA 1KQ7A 1GK2A 1J3UA 1TJWA 1RE5A 1FURA 1K62A 1YFEA 5HW2A 4NLEA 2J91A 1XLYA 3QBPA 1YFMA 5M0IA 2FUSA 3OCEA 1TJ7A 4ADMA 1AUWA 1T6PA 3E04A 1VDKA 4CQ5A 2OHYA 1FUPA 4NSLA 1C3UA 2O7BA 5EYTA 3GTDA 1U15A 2FELA 3NZ4A 4EEIA 3GZHA 2QVEA 5M0JA 2VD6A 1FUQA 1GKJA 3BHGA 1C3CA 2NYNA 2X75A 4APAA 1FUOA 3OCFA 1GK3A 4FFXA 1K7WA 4FLCA 3TV2A 2QGAB 3KDYA
chains in the Genus database with same CATH topology
4WNLA 5M0IA 5M0JA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0I A;  5M0J A;  1XLY A; 
#chains in the Genus database with same CATH topology
 4EFC A;  3RRP A;  1TJV A;  3R6Q A;  4BAB A;  2NYF A;  1HY1 A;  5F92 A;  1YIS A;  5EYV A;  4ADL A;  3NO9 A;  1GKM A;  2PTR A;  5F91 A;  3R6V A;  4MX2 A;  2E9F A;  1EB4 A;  1U16 A;  3R6Y A;  4V2Q A;  3KDZ A;  2YII A;  1DCN A;  4APB A;  3UNV A;  1DOF A;  3C8T A;  1I0A A;  2PTQ A;  2O7D A;  4HGV A;  1B8F A;  2O7E A;  4WNL A;  1W27 A;  2PFM A;  2PTS A;  2O7F A;  1HY0 A;  2O78 A;  2RJS A;  4C5S A;  1JSW A;  4V2R A;  4C6G A;  1Q5N A;  2O6Y A;  2RJR A;  5D6B A;  3CZO A;  4C5U A;  1Y2M A;  4BAA A;  1TJU A;  1XWO A;  1T6J A;  2HVG A;  3RD8 A;  4C5R A;  2FEN A;  1KQ7 A;  1GK2 A;  1J3U A;  1TJW A;  1RE5 A;  1FUR A;  1K62 A;  1YFE A;  5HW2 A;  4NLE A;  2J91 A;  1XLY A;  3QBP A;  1YFM A;  5M0I A;  2FUS A;  3OCE A;  1TJ7 A;  4ADM A;  1AUW A;  1T6P A;  3E04 A;  1VDK A;  4CQ5 A;  2OHY A;  1FUP A;  4NSL A;  1C3U A;  2O7B A;  5EYT A;  3GTD A;  1U15 A;  2FEL A;  3NZ4 A;  4EEI A;  3GZH A;  2QVE A;  5M0J A;  2VD6 A;  1FUQ A;  1GKJ A;  3BHG A;  1C3C A;  2NYN A;  2X75 A;  4APA A;  1FUO A;  3OCF A;  1GK3 A;  4FFX A;  1K7W A;  4FLC A;  3TV2 A;  2QGA B;  3KDY A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0I A;  5M0J A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...