5M0JA

Crystal structure of the cytoplasmic complex with she2p, she3p, and the ash1 mrna e3-localization element
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
238
structure length
223
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
molecule tags Rna binding protein
molecule keywords SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
total genus 95
structure length 223
sequence length 238
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0jA00
5M0IA 1XLYA 4WNLA 5M0JA
chains in the Genus database with same CATH superfamily
2O7DA 1JSWA 1I0AA 1GK3A 3UNVA 3NZ4A 1B8FA 2PFMA 5D6BA 1KQ7A 4WNLA 3BHGA 2NYFA 5EYTA 2RJRA 2FENA 4ADMA 1VDKA 2E9FA 5M0IA 3NO9A 1U15A 4C5UA 1TJ7A 1K62A 3RRPA 2HVGA 2O6YA 1J3UA 4BABA 4FLCA 3GZHA 1TJWA 5HW2A 2O78A 1FURA 3GTDA 4FFXA 3TV2A 3C8TA 1TJUA 1XWOA 3R6QA 1AUWA 1GKJA 4ADLA 4V2RA 5EYVA 2PTSA 1DCNA 1W27A 1K7WA 1YFMA 5F92A 2RJSA 1T6JA 1FUOA 1HY1A 2O7BA 3KDYA 4EEIA 1YFEA 1DOFA 1T6PA 3RD8A 4C6GA 2O7EA 2X75A 3E04A 2VD6A 3R6YA 1EB4A 2PTQA 1YISA 1HY0A 3CZOA 1FUPA 2YIIA 1Y2MA 3R6VA 4BAAA 1C3UA 4APBA 3QBPA 2QVEA 4NSLA 2PTRA 4HGVA 4V2QA 1C3CA 4C5SA 2NYNA 2FUSA 2J91A 1RE5A 2O7FA 1GK2A 2OHYA 4CQ5A 1FUQA 1TJVA 4C5RA 4APAA 4MX2A 3OCFA 5M0JA 5F91A 1U16A 4NLEA 2FELA 3OCEA 2QGAB 3KDZA 1Q5NA 1XLYA 1GKMA 4EFCA
chains in the Genus database with same CATH topology
5M0IA 1XLYA 4WNLA 5M0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0I A;  1XLY A;  4WNL A;  5M0J A; 
#chains in the Genus database with same CATH topology
 2O7D A;  1JSW A;  1I0A A;  1GK3 A;  3UNV A;  3NZ4 A;  1B8F A;  2PFM A;  5D6B A;  1KQ7 A;  4WNL A;  3BHG A;  2NYF A;  5EYT A;  2RJR A;  2FEN A;  4ADM A;  1VDK A;  2E9F A;  5M0I A;  3NO9 A;  1U15 A;  4C5U A;  1TJ7 A;  1K62 A;  3RRP A;  2HVG A;  2O6Y A;  1J3U A;  4BAB A;  4FLC A;  3GZH A;  1TJW A;  5HW2 A;  2O78 A;  1FUR A;  3GTD A;  4FFX A;  3TV2 A;  3C8T A;  1TJU A;  1XWO A;  3R6Q A;  1AUW A;  1GKJ A;  4ADL A;  4V2R A;  5EYV A;  2PTS A;  1DCN A;  1W27 A;  1K7W A;  1YFM A;  5F92 A;  2RJS A;  1T6J A;  1FUO A;  1HY1 A;  2O7B A;  3KDY A;  4EEI A;  1YFE A;  1DOF A;  1T6P A;  3RD8 A;  4C6G A;  2O7E A;  2X75 A;  3E04 A;  2VD6 A;  3R6Y A;  1EB4 A;  2PTQ A;  1YIS A;  1HY0 A;  3CZO A;  1FUP A;  2YII A;  1Y2M A;  3R6V A;  4BAA A;  1C3U A;  4APB A;  3QBP A;  2QVE A;  4NSL A;  2PTR A;  4HGV A;  4V2Q A;  1C3C A;  4C5S A;  2NYN A;  2FUS A;  2J91 A;  1RE5 A;  2O7F A;  1GK2 A;  2OHY A;  4CQ5 A;  1FUQ A;  1TJV A;  4C5R A;  4APA A;  4MX2 A;  3OCF A;  5M0J A;  5F91 A;  1U16 A;  4NLE A;  2FEL A;  3OCE A;  2QGA B;  3KDZ A;  1Q5N A;  1XLY A;  1GKM A;  4EFC A; 
#chains in the Genus database with same CATH homology
 5M0I A;  1XLY A;  4WNL A;  5M0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...