5M0JA

Crystal structure of the cytoplasmic complex with she2p, she3p, and the ash1 mrna e3-localization element
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
238
structure length
223
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
total genus 95
structure length 223
sequence length 238
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0jA00
1XLYA 5M0JA 4WNLA 5M0IA
chains in the Genus database with same CATH superfamily
2J91A 3R6YA 4EEIA 3R6QA 5EYVA 1J3UA 2O7EA 4C5SA 3NZ4A 4ADLA 1I0AA 1YFMA 1RE5A 3UNVA 1HY0A 1TJ7A 2PFMA 3OCFA 4C6GA 4C5UA 1U15A 3C8TA 2O7BA 2PTSA 1HY1A 2YIIA 3GTDA 2QGAB 1Y2MA 3BHGA 1GKJA 3QBPA 4WNLA 3CZOA 1C3CA 4NLEA 3NO9A 2RJRA 1XWOA 2RJSA 1GKMA 1XLYA 3KDYA 4MX2A 4BABA 5F92A 2PTRA 1KQ7A 4ADMA 2FUSA 5D6BA 4FLCA 2E9FA 2X75A 2PTQA 1GK2A 1TJVA 2O7DA 1YFEA 2NYFA 4HGVA 3KDZA 1AUWA 1FUPA 3TV2A 3R6VA 4APAA 2FENA 4FFXA 2FELA 2VD6A 3RD8A 1K7WA 2OHYA 1FUOA 4CQ5A 4NSLA 4EFCA 5EYTA 2NYNA 4BAAA 1K62A 1T6JA 3RRPA 1FURA 4V2RA 4V2QA 1DOFA 1T6PA 4C5RA 1FUQA 5M0IA 1C3UA 1VDKA 2O6YA 1TJUA 1DCNA 1GK3A 2QVEA 5HW2A 1EB4A 1W27A 3E04A 1Q5NA 1TJWA 4APBA 2O7FA 2O78A 5M0JA 3GZHA 5F91A 1U16A 3OCEA 1JSWA 1YISA 1B8FA 2HVGA
chains in the Genus database with same CATH topology
1XLYA 5M0JA 4WNLA 5M0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLY A;  5M0J A;  4WNL A;  5M0I A; 
#chains in the Genus database with same CATH topology
 2J91 A;  3R6Y A;  4EEI A;  3R6Q A;  5EYV A;  1J3U A;  2O7E A;  4C5S A;  3NZ4 A;  4ADL A;  1I0A A;  1YFM A;  1RE5 A;  3UNV A;  1HY0 A;  1TJ7 A;  2PFM A;  3OCF A;  4C6G A;  4C5U A;  1U15 A;  3C8T A;  2O7B A;  2PTS A;  1HY1 A;  2YII A;  3GTD A;  2QGA B;  1Y2M A;  3BHG A;  1GKJ A;  3QBP A;  4WNL A;  3CZO A;  1C3C A;  4NLE A;  3NO9 A;  2RJR A;  1XWO A;  2RJS A;  1GKM A;  1XLY A;  3KDY A;  4MX2 A;  4BAB A;  5F92 A;  2PTR A;  1KQ7 A;  4ADM A;  2FUS A;  5D6B A;  4FLC A;  2E9F A;  2X75 A;  2PTQ A;  1GK2 A;  1TJV A;  2O7D A;  1YFE A;  2NYF A;  4HGV A;  3KDZ A;  1AUW A;  1FUP A;  3TV2 A;  3R6V A;  4APA A;  2FEN A;  4FFX A;  2FEL A;  2VD6 A;  3RD8 A;  1K7W A;  2OHY A;  1FUO A;  4CQ5 A;  4NSL A;  4EFC A;  5EYT A;  2NYN A;  4BAA A;  1K62 A;  1T6J A;  3RRP A;  1FUR A;  4V2R A;  4V2Q A;  1DOF A;  1T6P A;  4C5R A;  1FUQ A;  5M0I A;  1C3U A;  1VDK A;  2O6Y A;  1TJU A;  1DCN A;  1GK3 A;  2QVE A;  5HW2 A;  1EB4 A;  1W27 A;  3E04 A;  1Q5N A;  1TJW A;  4APB A;  2O7F A;  2O78 A;  5M0J A;  3GZH A;  5F91 A;  1U16 A;  3OCE A;  1JSW A;  1YIS A;  1B8F A;  2HVG A; 
#chains in the Genus database with same CATH homology
 1XLY A;  5M0J A;  4WNL A;  5M0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...