5M0JA

Crystal structure of the cytoplasmic complex with she2p, she3p, and the ash1 mrna e3-localization element
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
238
structure length
223
Chain Sequence
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
molecule tags Rna binding protein
molecule keywords SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
total genus 95
structure length 223
sequence length 238
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0jA00
4WNLA 5M0JA 5M0IA 1XLYA
chains in the Genus database with same CATH superfamily
4EFCA 4V2QA 3CZOA 2RJRA 2YIIA 2NYFA 1YISA 5M0IA 2FUSA 3OCEA 1K7WA 3GTDA 1W27A 5HW2A 4FLCA 1FUOA 3R6VA 1GK2A 2E9FA 1FUPA 4CQ5A 2O7FA 1T6PA 1EB4A 1XLYA 1XWOA 1AUWA 3BHGA 1TJ7A 4NLEA 3KDZA 4BAAA 4EEIA 4WNLA 1VDKA 4APBA 1YFEA 5F92A 1YFMA 1HY0A 3NZ4A 4APAA 2O78A 1RE5A 2PTQA 1TJVA 3C8TA 3E04A 1DOFA 1FUQA 3RD8A 4HGVA 1B8FA 3NO9A 1T6JA 2FENA 1KQ7A 1TJWA 1FURA 1I0AA 2NYNA 5D6BA 2O7DA 4C5UA 5M0JA 1U15A 3OCFA 1J3UA 1HY1A 1C3CA 1DCNA 3GZHA 2O7BA 4V2RA 2VD6A 2PTRA 4NSLA 3UNVA 1K62A 4C5RA 1Y2MA 3QBPA 2QGAB 5F91A 2J91A 1U16A 2QVEA 2RJSA 4ADLA 2FELA 2O7EA 1GKJA 3R6QA 2OHYA 1TJUA 4BABA 4ADMA 1C3UA 4MX2A 2O6YA 4C6GA 3TV2A 4C5SA 1GKMA 2PTSA 3RRPA 5EYTA 5EYVA 4FFXA 3KDYA 2X75A 1JSWA 1GK3A 2PFMA 3R6YA 2HVGA 1Q5NA
chains in the Genus database with same CATH topology
4WNLA 5M0JA 5M0IA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0J A;  5M0I A;  1XLY A; 
#chains in the Genus database with same CATH topology
 4EFC A;  4V2Q A;  3CZO A;  2RJR A;  2YII A;  2NYF A;  1YIS A;  5M0I A;  2FUS A;  3OCE A;  1K7W A;  3GTD A;  1W27 A;  5HW2 A;  4FLC A;  1FUO A;  3R6V A;  1GK2 A;  2E9F A;  1FUP A;  4CQ5 A;  2O7F A;  1T6P A;  1EB4 A;  1XLY A;  1XWO A;  1AUW A;  3BHG A;  1TJ7 A;  4NLE A;  3KDZ A;  4BAA A;  4EEI A;  4WNL A;  1VDK A;  4APB A;  1YFE A;  5F92 A;  1YFM A;  1HY0 A;  3NZ4 A;  4APA A;  2O78 A;  1RE5 A;  2PTQ A;  1TJV A;  3C8T A;  3E04 A;  1DOF A;  1FUQ A;  3RD8 A;  4HGV A;  1B8F A;  3NO9 A;  1T6J A;  2FEN A;  1KQ7 A;  1TJW A;  1FUR A;  1I0A A;  2NYN A;  5D6B A;  2O7D A;  4C5U A;  5M0J A;  1U15 A;  3OCF A;  1J3U A;  1HY1 A;  1C3C A;  1DCN A;  3GZH A;  2O7B A;  4V2R A;  2VD6 A;  2PTR A;  4NSL A;  3UNV A;  1K62 A;  4C5R A;  1Y2M A;  3QBP A;  2QGA B;  5F91 A;  2J91 A;  1U16 A;  2QVE A;  2RJS A;  4ADL A;  2FEL A;  2O7E A;  1GKJ A;  3R6Q A;  2OHY A;  1TJU A;  4BAB A;  4ADM A;  1C3U A;  4MX2 A;  2O6Y A;  4C6G A;  3TV2 A;  4C5S A;  1GKM A;  2PTS A;  3RRP A;  5EYT A;  5EYV A;  4FFX A;  3KDY A;  2X75 A;  1JSW A;  1GK3 A;  2PFM A;  3R6Y A;  2HVG A;  1Q5N A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0J A;  5M0I A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...