5M0JA

Crystal structure of the cytoplasmic complex with she2p, she3p, and the ash1 mrna e3-localization element
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
238
structure length
223
Chain Sequence
b'DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain rm11-1a)
molecule tags Rna binding protein
total genus 95
structure length 223
sequence length 238
chains with identical sequence B, C, D, G, H, I, J
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0jA00
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH superfamily
4HGVA 1FUOA 1GK2A 1YFEA 4C5UA 1DOFA 1YISA 2E9FA 3OCFA 4NSLA 1U15A 3R6VA 1RE5A 2O7EA 1GK3A 2QGAB 1AUWA 4APAA 4ADMA 2VD6A 1KQ7A 3GZHA 4FLCA 3GTDA 2PTRA 1FUQA 1C3CA 1K62A 1Y2MA 1EB4A 1GKJA 2OHYA 4APBA 2O7BA 3R6QA 2O6YA 2RJRA 5D6BA 2O7FA 2FENA 2NYNA 3E04A 4BAAA 3CZOA 3NO9A 4WNLA 2FUSA 4ADLA 1HY0A 4NLEA 3NZ4A 2X75A 2YIIA 3BHGA 1TJWA 1B8FA 1TJ7A 4BABA 5EYTA 4EFCA 1Q5NA 1W27A 4CQ5A 1T6PA 4C5SA 1GKMA 1VDKA 4V2QA 4FFXA 1TJUA 3TV2A 2PTSA 2O7DA 1TJVA 3KDYA 3KDZA 1YFMA 1C3UA 1XLYA 3RRPA 5EYVA 5F91A 3C8TA 5M0IA 4EEIA 1DCNA 2RJSA 3QBPA 1T6JA 1U16A 1JSWA 4V2RA 2FELA 2PTQA 1HY1A 5F92A 3RD8A 3R6YA 3OCEA 5M0JA 2O78A 4C5RA 2NYFA 1FURA 1FUPA 4MX2A 4C6GA 3UNVA 1K7WA 2PFMA 1I0AA 2HVGA 5HW2A 1XWOA 2J91A 2QVEA 1J3UA
chains in the Genus database with same CATH topology
4WNLA 5M0JA 1XLYA 5M0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
#chains in the Genus database with same CATH topology
 4HGV A;  1FUO A;  1GK2 A;  1YFE A;  4C5U A;  1DOF A;  1YIS A;  2E9F A;  3OCF A;  4NSL A;  1U15 A;  3R6V A;  1RE5 A;  2O7E A;  1GK3 A;  2QGA B;  1AUW A;  4APA A;  4ADM A;  2VD6 A;  1KQ7 A;  3GZH A;  4FLC A;  3GTD A;  2PTR A;  1FUQ A;  1C3C A;  1K62 A;  1Y2M A;  1EB4 A;  1GKJ A;  2OHY A;  4APB A;  2O7B A;  3R6Q A;  2O6Y A;  2RJR A;  5D6B A;  2O7F A;  2FEN A;  2NYN A;  3E04 A;  4BAA A;  3CZO A;  3NO9 A;  4WNL A;  2FUS A;  4ADL A;  1HY0 A;  4NLE A;  3NZ4 A;  2X75 A;  2YII A;  3BHG A;  1TJW A;  1B8F A;  1TJ7 A;  4BAB A;  5EYT A;  4EFC A;  1Q5N A;  1W27 A;  4CQ5 A;  1T6P A;  4C5S A;  1GKM A;  1VDK A;  4V2Q A;  4FFX A;  1TJU A;  3TV2 A;  2PTS A;  2O7D A;  1TJV A;  3KDY A;  3KDZ A;  1YFM A;  1C3U A;  1XLY A;  3RRP A;  5EYV A;  5F91 A;  3C8T A;  5M0I A;  4EEI A;  1DCN A;  2RJS A;  3QBP A;  1T6J A;  1U16 A;  1JSW A;  4V2R A;  2FEL A;  2PTQ A;  1HY1 A;  5F92 A;  3RD8 A;  3R6Y A;  3OCE A;  5M0J A;  2O78 A;  4C5R A;  2NYF A;  1FUR A;  1FUP A;  4MX2 A;  4C6G A;  3UNV A;  1K7W A;  2PFM A;  1I0A A;  2HVG A;  5HW2 A;  1XWO A;  2J91 A;  2QVE A;  1J3U A; 
#chains in the Genus database with same CATH homology
 4WNL A;  5M0J A;  1XLY A;  5M0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...