2VD6A

Human adenylosuccinate lyase in complex with its substrate n6-(1,2- dicarboxyethyl)-amp, and its products amp and fumarate.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
470
structure length
461
Chain Sequence
GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLOSUCCINATE LYASE
publication title Human Adenylosuccinate Lyase in Complex with its Substrate N6-(1,2-Dicarboxyethyl)-AMP, and its Products AMP and Fumarate.
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 185
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2vd6A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2vd6A02
1TJVA 4ADMA 2O7FA 5HW2A 1Y2MA 3KDZA 3RD8A 1XWOA 2O7DA 4CQ5A 2RJSA 3GTDA 1TJUA 2X75A 1JSWA 4ADLA 3R6YA 1I0AA 1TJWA 5F91A 1YFMA 3UNVA 3BHGA 2E9FA 4HGVA 4C6GA 2NYFA 3E04A 5F92A 1YISA 4BAAA 4FLCA 2QGAB 1GK3A 3C8TA 4EEIA 1FUPA 2J91A 5EYTA 4APAA 4BABA 3OCFA 3CZOA 1J3UA 1GKJA 2HVGA 3OCEA 4C5RA 4NSLA 4APBA 1K7WA 2VD6A 2FUSA 1B8FA 2O7EA 1RE5A 1KQ7A 4V2RA 1AUWA 5EYVA 4NLEA 3R6QA 3R6VA 1C3UA 1GK2A 2PTQA 2O6YA 2RJRA 1FUQA 1TJ7A 1Q5NA 2PFMA 3NO9A 2O7BA 1DOFA 4C5SA 3TV2A 2O78A 1VDKA 1YFEA 2PTSA 4EFCA 1DCNA 1FUOA 1EB4A 2QVEA 1U16A 1FURA 5D6BA 4V2QA 2PTRA 4MX2A 1C3CA 1K62A 1T6JA 2YIIA 1GKMA 3GZHA 4C5UA 2NYNA 1W27A 1U15A 1HY0A 2OHYA 3KDYA 1T6PA 3NZ4A 3QBPA 1HY1A 3RRPA 4FFXA
chains in the Genus database with same CATH superfamily
1TJVA 2FELA 4ADMA 2O7FA 5HW2A 1Y2MA 3KDZA 3RD8A 1XWOA 2O7DA 4CQ5A 2RJSA 3CRVA 3GTDA 1TJUA 2X75A 1JSWA 1XL7A 4ADLA 3R6YA 1I0AA 1TJWA 4WNLA 5F91A 1YFMA 3UNVA 3BHGA 2E9FA 4HGVA 4C6GA 1XMCA 2NYFA 5M0IA 3E04A 5F92A 1YISA 4BAAA 4FLCA 2QGAB 1GK3A 3C8TA 4EEIA 1FUPA 2J91A 5EYTA 4APAA 4BABA 2VL7A 3OCFA 3CZOA 1J3UA 1GKJA 1XMDA 2HVGA 3OCEA 4C5RA 4NSLA 4APBA 1K7WA 2VD6A 2FUSA 1B8FA 2O7EA 1RE5A 5M0JA 1KQ7A 4A15A 4V2RA 1AUWA 5EYVA 4NLEA 3R6QA 3R6VA 1C3UA 1GK2A 2PTQA 2O6YA 2RJRA 1FUQA 1TJ7A 1Q5NA 2PFMA 2VSFA 3NO9A 2O7BA 1DOFA 4C5SA 3TV2A 2O78A 1VDKA 1XLYA 1YFEA 3CRW1 2PTSA 4EFCA 1DCNA 1FUOA 1EB4A 2QVEA 2FENA 1U16A 1FURA 5D6BA 4V2QA 2PTRA 4MX2A 1C3CA 1K62A 1T6JA 2YIIA 1GKMA 3GZHA 4C5UA 1XL8A 2NYNA 1W27A 1U15A 1HY0A 2OHYA 3KDYA 1T6PA 3NZ4A 3QBPA 5H8WA 1HY1A 3RRPA 4FFXA
chains in the Genus database with same CATH topology
1TJVA 4ADMA 2O7FA 5HW2A 1Y2MA 3KDZA 3RD8A 1XWOA 2O7DA 4CQ5A 2RJSA 3GTDA 1TJUA 2X75A 1JSWA 4ADLA 3R6YA 1I0AA 1TJWA 5F91A 1YFMA 3UNVA 3BHGA 2E9FA 4HGVA 4C6GA 2NYFA 3E04A 5F92A 1YISA 4BAAA 4FLCA 2QGAB 1GK3A 3C8TA 4EEIA 1FUPA 2J91A 5EYTA 4APAA 4BABA 3OCFA 3CZOA 1J3UA 1GKJA 2HVGA 3OCEA 4C5RA 4NSLA 4APBA 1K7WA 2VD6A 2FUSA 1B8FA 2O7EA 1RE5A 1KQ7A 4V2RA 1AUWA 5EYVA 4NLEA 3R6QA 3R6VA 1C3UA 1GK2A 2PTQA 2O6YA 2RJRA 1FUQA 1TJ7A 1Q5NA 2PFMA 3NO9A 2O7BA 1DOFA 4C5SA 3TV2A 2O78A 1VDKA 1YFEA 2PTSA 4EFCA 1DCNA 1FUOA 1EB4A 2QVEA 1U16A 1FURA 5D6BA 4V2QA 2PTRA 4MX2A 1C3CA 1K62A 1T6JA 2YIIA 1GKMA 3GZHA 4C5UA 2NYNA 1W27A 1U15A 1HY0A 2OHYA 3KDYA 1T6PA 3NZ4A 3QBPA 1HY1A 3RRPA 4FFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TJV A;  4ADM A;  2O7F A;  5HW2 A;  1Y2M A;  3KDZ A;  3RD8 A;  1XWO A;  2O7D A;  4CQ5 A;  2RJS A;  3GTD A;  1TJU A;  2X75 A;  1JSW A;  4ADL A;  3R6Y A;  1I0A A;  1TJW A;  5F91 A;  1YFM A;  3UNV A;  3BHG A;  2E9F A;  4HGV A;  4C6G A;  2NYF A;  3E04 A;  5F92 A;  1YIS A;  4BAA A;  4FLC A;  2QGA B;  1GK3 A;  3C8T A;  4EEI A;  1FUP A;  2J91 A;  5EYT A;  4APA A;  4BAB A;  3OCF A;  3CZO A;  1J3U A;  1GKJ A;  2HVG A;  3OCE A;  4C5R A;  4NSL A;  4APB A;  1K7W A;  2VD6 A;  2FUS A;  1B8F A;  2O7E A;  1RE5 A;  1KQ7 A;  4V2R A;  1AUW A;  5EYV A;  4NLE A;  3R6Q A;  3R6V A;  1C3U A;  1GK2 A;  2PTQ A;  2O6Y A;  2RJR A;  1FUQ A;  1TJ7 A;  1Q5N A;  2PFM A;  3NO9 A;  2O7B A;  1DOF A;  4C5S A;  3TV2 A;  2O78 A;  1VDK A;  1YFE A;  2PTS A;  4EFC A;  1DCN A;  1FUO A;  1EB4 A;  2QVE A;  1U16 A;  1FUR A;  5D6B A;  4V2Q A;  2PTR A;  4MX2 A;  1C3C A;  1K62 A;  1T6J A;  2YII A;  1GKM A;  3GZH A;  4C5U A;  2NYN A;  1W27 A;  1U15 A;  1HY0 A;  2OHY A;  3KDY A;  1T6P A;  3NZ4 A;  3QBP A;  1HY1 A;  3RRP A;  4FFX A; 
#chains in the Genus database with same CATH topology
 1TJV A;  2FEL A;  4ADM A;  2O7F A;  5HW2 A;  1Y2M A;  3KDZ A;  3RD8 A;  1XWO A;  2O7D A;  4CQ5 A;  2RJS A;  3CRV A;  3GTD A;  1TJU A;  2X75 A;  1JSW A;  1XL7 A;  4ADL A;  3R6Y A;  1I0A A;  1TJW A;  4WNL A;  5F91 A;  1YFM A;  3UNV A;  3BHG A;  2E9F A;  4HGV A;  4C6G A;  1XMC A;  2NYF A;  5M0I A;  3E04 A;  5F92 A;  1YIS A;  4BAA A;  4FLC A;  2QGA B;  1GK3 A;  3C8T A;  4EEI A;  1FUP A;  2J91 A;  5EYT A;  4APA A;  4BAB A;  2VL7 A;  3OCF A;  3CZO A;  1J3U A;  1GKJ A;  1XMD A;  2HVG A;  3OCE A;  4C5R A;  4NSL A;  4APB A;  1K7W A;  2VD6 A;  2FUS A;  1B8F A;  2O7E A;  1RE5 A;  5M0J A;  1KQ7 A;  4A15 A;  4V2R A;  1AUW A;  5EYV A;  4NLE A;  3R6Q A;  3R6V A;  1C3U A;  1GK2 A;  2PTQ A;  2O6Y A;  2RJR A;  1FUQ A;  1TJ7 A;  1Q5N A;  2PFM A;  2VSF A;  3NO9 A;  2O7B A;  1DOF A;  4C5S A;  3TV2 A;  2O78 A;  1VDK A;  1XLY A;  1YFE A;  3CRW 1;  2PTS A;  4EFC A;  1DCN A;  1FUO A;  1EB4 A;  2QVE A;  2FEN A;  1U16 A;  1FUR A;  5D6B A;  4V2Q A;  2PTR A;  4MX2 A;  1C3C A;  1K62 A;  1T6J A;  2YII A;  1GKM A;  3GZH A;  4C5U A;  1XL8 A;  2NYN A;  1W27 A;  1U15 A;  1HY0 A;  2OHY A;  3KDY A;  1T6P A;  3NZ4 A;  3QBP A;  5H8W A;  1HY1 A;  3RRP A;  4FFX A; 
#chains in the Genus database with same CATH homology
 1TJV A;  4ADM A;  2O7F A;  5HW2 A;  1Y2M A;  3KDZ A;  3RD8 A;  1XWO A;  2O7D A;  4CQ5 A;  2RJS A;  3GTD A;  1TJU A;  2X75 A;  1JSW A;  4ADL A;  3R6Y A;  1I0A A;  1TJW A;  5F91 A;  1YFM A;  3UNV A;  3BHG A;  2E9F A;  4HGV A;  4C6G A;  2NYF A;  3E04 A;  5F92 A;  1YIS A;  4BAA A;  4FLC A;  2QGA B;  1GK3 A;  3C8T A;  4EEI A;  1FUP A;  2J91 A;  5EYT A;  4APA A;  4BAB A;  3OCF A;  3CZO A;  1J3U A;  1GKJ A;  2HVG A;  3OCE A;  4C5R A;  4NSL A;  4APB A;  1K7W A;  2VD6 A;  2FUS A;  1B8F A;  2O7E A;  1RE5 A;  1KQ7 A;  4V2R A;  1AUW A;  5EYV A;  4NLE A;  3R6Q A;  3R6V A;  1C3U A;  1GK2 A;  2PTQ A;  2O6Y A;  2RJR A;  1FUQ A;  1TJ7 A;  1Q5N A;  2PFM A;  3NO9 A;  2O7B A;  1DOF A;  4C5S A;  3TV2 A;  2O78 A;  1VDK A;  1YFE A;  2PTS A;  4EFC A;  1DCN A;  1FUO A;  1EB4 A;  2QVE A;  1U16 A;  1FUR A;  5D6B A;  4V2Q A;  2PTR A;  4MX2 A;  1C3C A;  1K62 A;  1T6J A;  2YII A;  1GKM A;  3GZH A;  4C5U A;  2NYN A;  1W27 A;  1U15 A;  1HY0 A;  2OHY A;  3KDY A;  1T6P A;  3NZ4 A;  3QBP A;  1HY1 A;  3RRP A;  4FFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...