2VD6A

Human adenylosuccinate lyase in complex with its substrate n6-(1,2- dicarboxyethyl)-amp, and its products amp and fumarate.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
470
structure length
461
Chain Sequence
b'GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENYLOSUCCINATE LYASE
publication title Human Adenylosuccinate Lyase in Complex with its Substrate N6-(1,2-Dicarboxyethyl)-AMP, and its Products AMP and Fumarate.
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 185
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2vd6A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2vd6A02
3OCEA 2O78A 2E9FA 1K62A 4MX2A 2HVGA 1T6JA 2X75A 3KDYA 1Y2MA 5EYVA 3GZHA 3TV2A 1DOFA 1GKMA 2O6YA 3E04A 1T6PA 1KQ7A 5HW2A 2O7EA 2RJRA 1JSWA 1EB4A 3UNVA 4APAA 2FUSA 2YIIA 2PTRA 4EFCA 3R6YA 1K7WA 2QGAB 2O7DA 2PTQA 1FURA 1YFEA 1C3CA 1RE5A 1TJWA 2PFMA 1HY1A 1YFMA 1U16A 3RRPA 4V2RA 2QVEA 1FUOA 1TJVA 2RJSA 1FUPA 1VDKA 1TJ7A 4ADLA 3R6QA 3KDZA 2PTSA 1GK2A 1GK3A 4C6GA 1Q5NA 4FFXA 1DCNA 3BHGA 4APBA 4EEIA 4C5RA 3NO9A 5D6BA 1AUWA 4NLEA 2J91A 3C8TA 2NYNA 1I0AA 4C5SA 1GKJA 4ADMA 1TJUA 3RD8A 3OCFA 1XWOA 3R6VA 1J3UA 4V2QA 4BABA 5F91A 2O7FA 5F92A 3GTDA 5EYTA 4C5UA 2VD6A 1C3UA 3NZ4A 1W27A 4CQ5A 1B8FA 1YISA 2NYFA 1HY0A 4BAAA 4FLCA 2O7BA 1U15A 4NSLA 1FUQA 2OHYA 4HGVA 3CZOA 3QBPA
chains in the Genus database with same CATH superfamily
3OCEA 2O78A 2E9FA 1K62A 4MX2A 2HVGA 2FENA 1T6JA 2X75A 3KDYA 1Y2MA 5EYVA 1XL7A 3GZHA 3TV2A 1DOFA 1GKMA 5M0IA 2O6YA 3E04A 1T6PA 1KQ7A 5HW2A 2O7EA 2RJRA 1JSWA 1EB4A 3UNVA 4APAA 2FUSA 2YIIA 2PTRA 4EFCA 3R6YA 1K7WA 3CRVA 2QGAB 2O7DA 2PTQA 2VL7A 1FURA 1YFEA 1C3CA 1RE5A 1TJWA 2PFMA 1HY1A 1YFMA 1U16A 3RRPA 4V2RA 2QVEA 1FUOA 1TJVA 2RJSA 2VSFA 1FUPA 1VDKA 1TJ7A 4ADLA 3R6QA 3KDZA 2PTSA 1GK2A 1GK3A 4C6GA 2FELA 1Q5NA 4FFXA 1DCNA 3BHGA 4APBA 4EEIA 4C5RA 3NO9A 5D6BA 1AUWA 3CRW1 4NLEA 2J91A 3C8TA 2NYNA 1XMCA 1I0AA 4C5SA 1GKJA 4ADMA 1TJUA 3RD8A 3OCFA 1XL8A 1XWOA 3R6VA 1J3UA 4V2QA 4BABA 5F91A 2O7FA 5F92A 3GTDA 5M0JA 5EYTA 4A15A 4C5UA 2VD6A 1C3UA 1XLYA 3NZ4A 1W27A 4CQ5A 1B8FA 1YISA 2NYFA 1HY0A 5H8WA 4BAAA 4FLCA 2O7BA 1U15A 4NSLA 1FUQA 2OHYA 4HGVA 4WNLA 1XMDA 3CZOA 3QBPA
chains in the Genus database with same CATH topology
3OCEA 2O78A 2E9FA 1K62A 4MX2A 2HVGA 1T6JA 2X75A 3KDYA 1Y2MA 5EYVA 3GZHA 3TV2A 1DOFA 1GKMA 2O6YA 3E04A 1T6PA 1KQ7A 5HW2A 2O7EA 2RJRA 1JSWA 1EB4A 3UNVA 4APAA 2FUSA 2YIIA 2PTRA 4EFCA 3R6YA 1K7WA 2QGAB 2O7DA 2PTQA 1FURA 1YFEA 1C3CA 1RE5A 1TJWA 2PFMA 1HY1A 1YFMA 1U16A 3RRPA 4V2RA 2QVEA 1FUOA 1TJVA 2RJSA 1FUPA 1VDKA 1TJ7A 4ADLA 3R6QA 3KDZA 2PTSA 1GK2A 1GK3A 4C6GA 1Q5NA 4FFXA 1DCNA 3BHGA 4APBA 4EEIA 4C5RA 3NO9A 5D6BA 1AUWA 4NLEA 2J91A 3C8TA 2NYNA 1I0AA 4C5SA 1GKJA 4ADMA 1TJUA 3RD8A 3OCFA 1XWOA 3R6VA 1J3UA 4V2QA 4BABA 5F91A 2O7FA 5F92A 3GTDA 5EYTA 4C5UA 2VD6A 1C3UA 3NZ4A 1W27A 4CQ5A 1B8FA 1YISA 2NYFA 1HY0A 4BAAA 4FLCA 2O7BA 1U15A 4NSLA 1FUQA 2OHYA 4HGVA 3CZOA 3QBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OCE A;  2O78 A;  2E9F A;  1K62 A;  4MX2 A;  2HVG A;  1T6J A;  2X75 A;  3KDY A;  1Y2M A;  5EYV A;  3GZH A;  3TV2 A;  1DOF A;  1GKM A;  2O6Y A;  3E04 A;  1T6P A;  1KQ7 A;  5HW2 A;  2O7E A;  2RJR A;  1JSW A;  1EB4 A;  3UNV A;  4APA A;  2FUS A;  2YII A;  2PTR A;  4EFC A;  3R6Y A;  1K7W A;  2QGA B;  2O7D A;  2PTQ A;  1FUR A;  1YFE A;  1C3C A;  1RE5 A;  1TJW A;  2PFM A;  1HY1 A;  1YFM A;  1U16 A;  3RRP A;  4V2R A;  2QVE A;  1FUO A;  1TJV A;  2RJS A;  1FUP A;  1VDK A;  1TJ7 A;  4ADL A;  3R6Q A;  3KDZ A;  2PTS A;  1GK2 A;  1GK3 A;  4C6G A;  1Q5N A;  4FFX A;  1DCN A;  3BHG A;  4APB A;  4EEI A;  4C5R A;  3NO9 A;  5D6B A;  1AUW A;  4NLE A;  2J91 A;  3C8T A;  2NYN A;  1I0A A;  4C5S A;  1GKJ A;  4ADM A;  1TJU A;  3RD8 A;  3OCF A;  1XWO A;  3R6V A;  1J3U A;  4V2Q A;  4BAB A;  5F91 A;  2O7F A;  5F92 A;  3GTD A;  5EYT A;  4C5U A;  2VD6 A;  1C3U A;  3NZ4 A;  1W27 A;  4CQ5 A;  1B8F A;  1YIS A;  2NYF A;  1HY0 A;  4BAA A;  4FLC A;  2O7B A;  1U15 A;  4NSL A;  1FUQ A;  2OHY A;  4HGV A;  3CZO A;  3QBP A; 
#chains in the Genus database with same CATH topology
 3OCE A;  2O78 A;  2E9F A;  1K62 A;  4MX2 A;  2HVG A;  2FEN A;  1T6J A;  2X75 A;  3KDY A;  1Y2M A;  5EYV A;  1XL7 A;  3GZH A;  3TV2 A;  1DOF A;  1GKM A;  5M0I A;  2O6Y A;  3E04 A;  1T6P A;  1KQ7 A;  5HW2 A;  2O7E A;  2RJR A;  1JSW A;  1EB4 A;  3UNV A;  4APA A;  2FUS A;  2YII A;  2PTR A;  4EFC A;  3R6Y A;  1K7W A;  3CRV A;  2QGA B;  2O7D A;  2PTQ A;  2VL7 A;  1FUR A;  1YFE A;  1C3C A;  1RE5 A;  1TJW A;  2PFM A;  1HY1 A;  1YFM A;  1U16 A;  3RRP A;  4V2R A;  2QVE A;  1FUO A;  1TJV A;  2RJS A;  2VSF A;  1FUP A;  1VDK A;  1TJ7 A;  4ADL A;  3R6Q A;  3KDZ A;  2PTS A;  1GK2 A;  1GK3 A;  4C6G A;  2FEL A;  1Q5N A;  4FFX A;  1DCN A;  3BHG A;  4APB A;  4EEI A;  4C5R A;  3NO9 A;  5D6B A;  1AUW A;  3CRW 1;  4NLE A;  2J91 A;  3C8T A;  2NYN A;  1XMC A;  1I0A A;  4C5S A;  1GKJ A;  4ADM A;  1TJU A;  3RD8 A;  3OCF A;  1XL8 A;  1XWO A;  3R6V A;  1J3U A;  4V2Q A;  4BAB A;  5F91 A;  2O7F A;  5F92 A;  3GTD A;  5M0J A;  5EYT A;  4A15 A;  4C5U A;  2VD6 A;  1C3U A;  1XLY A;  3NZ4 A;  1W27 A;  4CQ5 A;  1B8F A;  1YIS A;  2NYF A;  1HY0 A;  5H8W A;  4BAA A;  4FLC A;  2O7B A;  1U15 A;  4NSL A;  1FUQ A;  2OHY A;  4HGV A;  4WNL A;  1XMD A;  3CZO A;  3QBP A; 
#chains in the Genus database with same CATH homology
 3OCE A;  2O78 A;  2E9F A;  1K62 A;  4MX2 A;  2HVG A;  1T6J A;  2X75 A;  3KDY A;  1Y2M A;  5EYV A;  3GZH A;  3TV2 A;  1DOF A;  1GKM A;  2O6Y A;  3E04 A;  1T6P A;  1KQ7 A;  5HW2 A;  2O7E A;  2RJR A;  1JSW A;  1EB4 A;  3UNV A;  4APA A;  2FUS A;  2YII A;  2PTR A;  4EFC A;  3R6Y A;  1K7W A;  2QGA B;  2O7D A;  2PTQ A;  1FUR A;  1YFE A;  1C3C A;  1RE5 A;  1TJW A;  2PFM A;  1HY1 A;  1YFM A;  1U16 A;  3RRP A;  4V2R A;  2QVE A;  1FUO A;  1TJV A;  2RJS A;  1FUP A;  1VDK A;  1TJ7 A;  4ADL A;  3R6Q A;  3KDZ A;  2PTS A;  1GK2 A;  1GK3 A;  4C6G A;  1Q5N A;  4FFX A;  1DCN A;  3BHG A;  4APB A;  4EEI A;  4C5R A;  3NO9 A;  5D6B A;  1AUW A;  4NLE A;  2J91 A;  3C8T A;  2NYN A;  1I0A A;  4C5S A;  1GKJ A;  4ADM A;  1TJU A;  3RD8 A;  3OCF A;  1XWO A;  3R6V A;  1J3U A;  4V2Q A;  4BAB A;  5F91 A;  2O7F A;  5F92 A;  3GTD A;  5EYT A;  4C5U A;  2VD6 A;  1C3U A;  3NZ4 A;  1W27 A;  4CQ5 A;  1B8F A;  1YIS A;  2NYF A;  1HY0 A;  4BAA A;  4FLC A;  2O7B A;  1U15 A;  4NSL A;  1FUQ A;  2OHY A;  4HGV A;  3CZO A;  3QBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...