2VD6A

Human adenylosuccinate lyase in complex with its substrate n6-(1,2- dicarboxyethyl)-amp, and its products amp and fumarate.
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
470
structure length
461
Chain Sequence
GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEPYKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords ADENYLOSUCCINATE LYASE
publication title Human Adenylosuccinate Lyase in Complex with its Substrate N6-(1,2-Dicarboxyethyl)-AMP, and its Products AMP and Fumarate.
rcsb
source organism Homo sapiens
total genus 185
structure length 461
sequence length 470
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2007-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 2vd6A01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 2vd6A02
4BAAA 1W27A 2VD6A 2PFMA 4V2RA 1YFMA 4C6GA 2E9FA 1KQ7A 1EB4A 1FUOA 4NSLA 2O6YA 5EYVA 1K7WA 4APBA 4FLCA 4HGVA 1B8FA 1U15A 3OCFA 4CQ5A 1I0AA 4C5SA 1FUQA 3KDYA 3OCEA 2NYNA 2HVGA 2PTSA 2YIIA 4EEIA 3KDZA 1VDKA 1TJ7A 3E04A 2NYFA 4ADMA 3C8TA 2QVEA 4C5UA 1HY1A 3NO9A 1RE5A 1FURA 5F91A 2O78A 3UNVA 1T6PA 4EFCA 2PTQA 2RJSA 1JSWA 2FUSA 5F92A 3GTDA 2O7EA 1T6JA 1YISA 4C5RA 4NLEA 3BHGA 4APAA 4V2QA 2O7FA 3R6YA 2PTRA 2O7BA 3RRPA 2QGAB 4ADLA 2OHYA 3RD8A 4FFXA 1GK3A 2O7DA 4MX2A 1XWOA 1FUPA 1TJWA 2RJRA 1K62A 3R6QA 1TJVA 1HY0A 3TV2A 3QBPA 1C3UA 2J91A 1Y2MA 1U16A 1C3CA 3CZOA 1DOFA 1AUWA 3NZ4A 1GK2A 5HW2A 1DCNA 1J3UA 1Q5NA 5EYTA 1GKJA 1TJUA 3R6VA 3GZHA 1GKMA 5D6BA 1YFEA 4BABA 2X75A
chains in the Genus database with same CATH superfamily
4BAAA 1W27A 2VD6A 2PFMA 4V2RA 1YFMA 4C6GA 2E9FA 2VSFA 1KQ7A 2FENA 2VL7A 1EB4A 1FUOA 4NSLA 2O6YA 5EYVA 4A15A 1K7WA 4APBA 4FLCA 4HGVA 1B8FA 1U15A 3OCFA 5M0JA 4CQ5A 1I0AA 4C5SA 1FUQA 3KDYA 3OCEA 2NYNA 2HVGA 2PTSA 2YIIA 4EEIA 3KDZA 1VDKA 1TJ7A 3E04A 2NYFA 4ADMA 3C8TA 2QVEA 4C5UA 1XL7A 1HY1A 3NO9A 1RE5A 1FURA 5F91A 2O78A 3UNVA 1T6PA 1XMDA 5M0IA 4EFCA 2PTQA 2RJSA 1XLYA 1JSWA 2FUSA 5F92A 3GTDA 2O7EA 1T6JA 1YISA 4C5RA 4NLEA 3BHGA 2FELA 1XL8A 4APAA 4V2QA 2O7FA 3R6YA 2PTRA 2O7BA 3RRPA 2QGAB 4ADLA 2OHYA 4WNLA 3RD8A 4FFXA 1GK3A 2O7DA 4MX2A 3CRVA 1XWOA 1FUPA 1TJWA 2RJRA 3CRW1 1K62A 3R6QA 1TJVA 1HY0A 3TV2A 1XMCA 3QBPA 1C3UA 2J91A 5H8WA 1Y2MA 1U16A 1C3CA 3CZOA 1DOFA 1AUWA 3NZ4A 1GK2A 5HW2A 1DCNA 1J3UA 1Q5NA 5EYTA 1GKJA 1TJUA 3R6VA 3GZHA 1GKMA 5D6BA 1YFEA 4BABA 2X75A
chains in the Genus database with same CATH topology
4BAAA 1W27A 2VD6A 2PFMA 4V2RA 1YFMA 4C6GA 2E9FA 1KQ7A 1EB4A 1FUOA 4NSLA 2O6YA 5EYVA 1K7WA 4APBA 4FLCA 4HGVA 1B8FA 1U15A 3OCFA 4CQ5A 1I0AA 4C5SA 1FUQA 3KDYA 3OCEA 2NYNA 2HVGA 2PTSA 2YIIA 4EEIA 3KDZA 1VDKA 1TJ7A 3E04A 2NYFA 4ADMA 3C8TA 2QVEA 4C5UA 1HY1A 3NO9A 1RE5A 1FURA 5F91A 2O78A 3UNVA 1T6PA 4EFCA 2PTQA 2RJSA 1JSWA 2FUSA 5F92A 3GTDA 2O7EA 1T6JA 1YISA 4C5RA 4NLEA 3BHGA 4APAA 4V2QA 2O7FA 3R6YA 2PTRA 2O7BA 3RRPA 2QGAB 4ADLA 2OHYA 3RD8A 4FFXA 1GK3A 2O7DA 4MX2A 1XWOA 1FUPA 1TJWA 2RJRA 1K62A 3R6QA 1TJVA 1HY0A 3TV2A 3QBPA 1C3UA 2J91A 1Y2MA 1U16A 1C3CA 3CZOA 1DOFA 1AUWA 3NZ4A 1GK2A 5HW2A 1DCNA 1J3UA 1Q5NA 5EYTA 1GKJA 1TJUA 3R6VA 3GZHA 1GKMA 5D6BA 1YFEA 4BABA 2X75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAA A;  1W27 A;  2VD6 A;  2PFM A;  4V2R A;  1YFM A;  4C6G A;  2E9F A;  1KQ7 A;  1EB4 A;  1FUO A;  4NSL A;  2O6Y A;  5EYV A;  1K7W A;  4APB A;  4FLC A;  4HGV A;  1B8F A;  1U15 A;  3OCF A;  4CQ5 A;  1I0A A;  4C5S A;  1FUQ A;  3KDY A;  3OCE A;  2NYN A;  2HVG A;  2PTS A;  2YII A;  4EEI A;  3KDZ A;  1VDK A;  1TJ7 A;  3E04 A;  2NYF A;  4ADM A;  3C8T A;  2QVE A;  4C5U A;  1HY1 A;  3NO9 A;  1RE5 A;  1FUR A;  5F91 A;  2O78 A;  3UNV A;  1T6P A;  4EFC A;  2PTQ A;  2RJS A;  1JSW A;  2FUS A;  5F92 A;  3GTD A;  2O7E A;  1T6J A;  1YIS A;  4C5R A;  4NLE A;  3BHG A;  4APA A;  4V2Q A;  2O7F A;  3R6Y A;  2PTR A;  2O7B A;  3RRP A;  2QGA B;  4ADL A;  2OHY A;  3RD8 A;  4FFX A;  1GK3 A;  2O7D A;  4MX2 A;  1XWO A;  1FUP A;  1TJW A;  2RJR A;  1K62 A;  3R6Q A;  1TJV A;  1HY0 A;  3TV2 A;  3QBP A;  1C3U A;  2J91 A;  1Y2M A;  1U16 A;  1C3C A;  3CZO A;  1DOF A;  1AUW A;  3NZ4 A;  1GK2 A;  5HW2 A;  1DCN A;  1J3U A;  1Q5N A;  5EYT A;  1GKJ A;  1TJU A;  3R6V A;  3GZH A;  1GKM A;  5D6B A;  1YFE A;  4BAB A;  2X75 A; 
#chains in the Genus database with same CATH topology
 4BAA A;  1W27 A;  2VD6 A;  2PFM A;  4V2R A;  1YFM A;  4C6G A;  2E9F A;  2VSF A;  1KQ7 A;  2FEN A;  2VL7 A;  1EB4 A;  1FUO A;  4NSL A;  2O6Y A;  5EYV A;  4A15 A;  1K7W A;  4APB A;  4FLC A;  4HGV A;  1B8F A;  1U15 A;  3OCF A;  5M0J A;  4CQ5 A;  1I0A A;  4C5S A;  1FUQ A;  3KDY A;  3OCE A;  2NYN A;  2HVG A;  2PTS A;  2YII A;  4EEI A;  3KDZ A;  1VDK A;  1TJ7 A;  3E04 A;  2NYF A;  4ADM A;  3C8T A;  2QVE A;  4C5U A;  1XL7 A;  1HY1 A;  3NO9 A;  1RE5 A;  1FUR A;  5F91 A;  2O78 A;  3UNV A;  1T6P A;  1XMD A;  5M0I A;  4EFC A;  2PTQ A;  2RJS A;  1XLY A;  1JSW A;  2FUS A;  5F92 A;  3GTD A;  2O7E A;  1T6J A;  1YIS A;  4C5R A;  4NLE A;  3BHG A;  2FEL A;  1XL8 A;  4APA A;  4V2Q A;  2O7F A;  3R6Y A;  2PTR A;  2O7B A;  3RRP A;  2QGA B;  4ADL A;  2OHY A;  4WNL A;  3RD8 A;  4FFX A;  1GK3 A;  2O7D A;  4MX2 A;  3CRV A;  1XWO A;  1FUP A;  1TJW A;  2RJR A;  3CRW 1;  1K62 A;  3R6Q A;  1TJV A;  1HY0 A;  3TV2 A;  1XMC A;  3QBP A;  1C3U A;  2J91 A;  5H8W A;  1Y2M A;  1U16 A;  1C3C A;  3CZO A;  1DOF A;  1AUW A;  3NZ4 A;  1GK2 A;  5HW2 A;  1DCN A;  1J3U A;  1Q5N A;  5EYT A;  1GKJ A;  1TJU A;  3R6V A;  3GZH A;  1GKM A;  5D6B A;  1YFE A;  4BAB A;  2X75 A; 
#chains in the Genus database with same CATH homology
 4BAA A;  1W27 A;  2VD6 A;  2PFM A;  4V2R A;  1YFM A;  4C6G A;  2E9F A;  1KQ7 A;  1EB4 A;  1FUO A;  4NSL A;  2O6Y A;  5EYV A;  1K7W A;  4APB A;  4FLC A;  4HGV A;  1B8F A;  1U15 A;  3OCF A;  4CQ5 A;  1I0A A;  4C5S A;  1FUQ A;  3KDY A;  3OCE A;  2NYN A;  2HVG A;  2PTS A;  2YII A;  4EEI A;  3KDZ A;  1VDK A;  1TJ7 A;  3E04 A;  2NYF A;  4ADM A;  3C8T A;  2QVE A;  4C5U A;  1HY1 A;  3NO9 A;  1RE5 A;  1FUR A;  5F91 A;  2O78 A;  3UNV A;  1T6P A;  4EFC A;  2PTQ A;  2RJS A;  1JSW A;  2FUS A;  5F92 A;  3GTD A;  2O7E A;  1T6J A;  1YIS A;  4C5R A;  4NLE A;  3BHG A;  4APA A;  4V2Q A;  2O7F A;  3R6Y A;  2PTR A;  2O7B A;  3RRP A;  2QGA B;  4ADL A;  2OHY A;  3RD8 A;  4FFX A;  1GK3 A;  2O7D A;  4MX2 A;  1XWO A;  1FUP A;  1TJW A;  2RJR A;  1K62 A;  3R6Q A;  1TJV A;  1HY0 A;  3TV2 A;  3QBP A;  1C3U A;  2J91 A;  1Y2M A;  1U16 A;  1C3C A;  3CZO A;  1DOF A;  1AUW A;  3NZ4 A;  1GK2 A;  5HW2 A;  1DCN A;  1J3U A;  1Q5N A;  5EYT A;  1GKJ A;  1TJU A;  3R6V A;  3GZH A;  1GKM A;  5D6B A;  1YFE A;  4BAB A;  2X75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...