5M0IA

Crystal structure of the nuclear complex with she2p and the ash1 mrna e3-localization element
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
241
structure length
225
Chain Sequence
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFIADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords SWI5-dependent HO expression protein 2
total genus 96
structure length 225
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0iA00
5M0IA 5M0JA 4WNLA 1XLYA
chains in the Genus database with same CATH superfamily
5EYVA 1C3CA 4FFXA 4HGVA 3CZOA 4ADMA 3E04A 5M0IA 1TJUA 2HVGA 1DOFA 1FURA 3R6YA 1EB4A 1TJ7A 1K7WA 1FUPA 2FUSA 1T6JA 4C5RA 2PFMA 3R6QA 3NZ4A 4NSLA 1GK3A 1U15A 2RJRA 3OCFA 5F91A 4FLCA 1VDKA 1K62A 1HY0A 2VD6A 3C8TA 3OCEA 1YFEA 2OHYA 3NO9A 2FELA 1FUOA 4V2QA 3GTDA 3GZHA 4BABA 1DCNA 1RE5A 4APBA 2E9FA 1J3UA 1B8FA 1XLYA 2NYFA 1FUQA 5HW2A 4V2RA 3KDZA 4ADLA 3BHGA 2X75A 1C3UA 4C5SA 4CQ5A 5D6BA 2O6YA 1XWOA 5M0JA 4EFCA 2FENA 3RD8A 2O78A 4MX2A 1I0AA 5F92A 3R6VA 1GKMA 1Q5NA 4WNLA 2O7BA 1U16A 4APAA 1W27A 4C6GA 2O7FA 3TV2A 3QBPA 1TJVA 1JSWA 2QGAB 1KQ7A 4EEIA 1Y2MA 2PTSA 5EYTA 2RJSA 2O7DA 1TJWA 4BAAA 1GK2A 2PTQA 1YISA 2PTRA 3RRPA 2NYNA 2QVEA 3UNVA 1AUWA 2YIIA 2O7EA 1GKJA 1YFMA 1HY1A 2J91A 1T6PA 4C5UA 4NLEA 3KDYA
chains in the Genus database with same CATH topology
5M0IA 5M0JA 4WNLA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0I A;  5M0J A;  4WNL A;  1XLY A; 
#chains in the Genus database with same CATH topology
 5EYV A;  1C3C A;  4FFX A;  4HGV A;  3CZO A;  4ADM A;  3E04 A;  5M0I A;  1TJU A;  2HVG A;  1DOF A;  1FUR A;  3R6Y A;  1EB4 A;  1TJ7 A;  1K7W A;  1FUP A;  2FUS A;  1T6J A;  4C5R A;  2PFM A;  3R6Q A;  3NZ4 A;  4NSL A;  1GK3 A;  1U15 A;  2RJR A;  3OCF A;  5F91 A;  4FLC A;  1VDK A;  1K62 A;  1HY0 A;  2VD6 A;  3C8T A;  3OCE A;  1YFE A;  2OHY A;  3NO9 A;  2FEL A;  1FUO A;  4V2Q A;  3GTD A;  3GZH A;  4BAB A;  1DCN A;  1RE5 A;  4APB A;  2E9F A;  1J3U A;  1B8F A;  1XLY A;  2NYF A;  1FUQ A;  5HW2 A;  4V2R A;  3KDZ A;  4ADL A;  3BHG A;  2X75 A;  1C3U A;  4C5S A;  4CQ5 A;  5D6B A;  2O6Y A;  1XWO A;  5M0J A;  4EFC A;  2FEN A;  3RD8 A;  2O78 A;  4MX2 A;  1I0A A;  5F92 A;  3R6V A;  1GKM A;  1Q5N A;  4WNL A;  2O7B A;  1U16 A;  4APA A;  1W27 A;  4C6G A;  2O7F A;  3TV2 A;  3QBP A;  1TJV A;  1JSW A;  2QGA B;  1KQ7 A;  4EEI A;  1Y2M A;  2PTS A;  5EYT A;  2RJS A;  2O7D A;  1TJW A;  4BAA A;  1GK2 A;  2PTQ A;  1YIS A;  2PTR A;  3RRP A;  2NYN A;  2QVE A;  3UNV A;  1AUW A;  2YII A;  2O7E A;  1GKJ A;  1YFM A;  1HY1 A;  2J91 A;  1T6P A;  4C5U A;  4NLE A;  3KDY A; 
#chains in the Genus database with same CATH homology
 5M0I A;  5M0J A;  4WNL A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...