5M0IA

Crystal structure of the nuclear complex with she2p and the ash1 mrna e3-localization element
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
241
structure length
225
Chain Sequence
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFIADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI5-dependent HO expression protein 2
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 96
structure length 225
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0iA00
5M0JA 4WNLA 5M0IA 1XLYA
chains in the Genus database with same CATH superfamily
1FUQA 4APBA 4EEIA 1U16A 3UNVA 2O6YA 1TJVA 1TJ7A 4V2RA 1Y2MA 3GZHA 1T6PA 2O7DA 1B8FA 4ADLA 2X75A 2VD6A 2PFMA 1XLYA 1J3UA 4C5UA 2PTSA 2O78A 1YFMA 1W27A 3BHGA 5EYVA 1RE5A 4HGVA 1GKMA 2QVEA 4C5RA 2RJRA 3QBPA 4MX2A 1K7WA 4FFXA 3RD8A 4CQ5A 3OCEA 5HW2A 4APAA 2FUSA 1Q5NA 2PTRA 1EB4A 2YIIA 4ADMA 4BAAA 2PTQA 3KDYA 3NO9A 1YISA 1FUPA 1GK2A 4BABA 1GKJA 1C3UA 5EYTA 1TJWA 4NSLA 2OHYA 4WNLA 1AUWA 4EFCA 2NYFA 2O7BA 2E9FA 5F92A 1HY1A 2RJSA 2J91A 3RRPA 1VDKA 1GK3A 1DOFA 3NZ4A 1DCNA 1XWOA 3R6VA 2FENA 1C3CA 1YFEA 1KQ7A 1JSWA 4V2QA 2QGAB 5F91A 4FLCA 4NLEA 1T6JA 3GTDA 2O7EA 3R6QA 1K62A 3R6YA 3E04A 3OCFA 4C6GA 1FUOA 1U15A 1TJUA 1HY0A 4C5SA 3TV2A 5D6BA 1FURA 3KDZA 2NYNA 5M0JA 3C8TA 2HVGA 3CZOA 2O7FA 1I0AA 5M0IA 2FELA
chains in the Genus database with same CATH topology
5M0JA 4WNLA 5M0IA 1XLYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0J A;  4WNL A;  5M0I A;  1XLY A; 
#chains in the Genus database with same CATH topology
 1FUQ A;  4APB A;  4EEI A;  1U16 A;  3UNV A;  2O6Y A;  1TJV A;  1TJ7 A;  4V2R A;  1Y2M A;  3GZH A;  1T6P A;  2O7D A;  1B8F A;  4ADL A;  2X75 A;  2VD6 A;  2PFM A;  1XLY A;  1J3U A;  4C5U A;  2PTS A;  2O78 A;  1YFM A;  1W27 A;  3BHG A;  5EYV A;  1RE5 A;  4HGV A;  1GKM A;  2QVE A;  4C5R A;  2RJR A;  3QBP A;  4MX2 A;  1K7W A;  4FFX A;  3RD8 A;  4CQ5 A;  3OCE A;  5HW2 A;  4APA A;  2FUS A;  1Q5N A;  2PTR A;  1EB4 A;  2YII A;  4ADM A;  4BAA A;  2PTQ A;  3KDY A;  3NO9 A;  1YIS A;  1FUP A;  1GK2 A;  4BAB A;  1GKJ A;  1C3U A;  5EYT A;  1TJW A;  4NSL A;  2OHY A;  4WNL A;  1AUW A;  4EFC A;  2NYF A;  2O7B A;  2E9F A;  5F92 A;  1HY1 A;  2RJS A;  2J91 A;  3RRP A;  1VDK A;  1GK3 A;  1DOF A;  3NZ4 A;  1DCN A;  1XWO A;  3R6V A;  2FEN A;  1C3C A;  1YFE A;  1KQ7 A;  1JSW A;  4V2Q A;  2QGA B;  5F91 A;  4FLC A;  4NLE A;  1T6J A;  3GTD A;  2O7E A;  3R6Q A;  1K62 A;  3R6Y A;  3E04 A;  3OCF A;  4C6G A;  1FUO A;  1U15 A;  1TJU A;  1HY0 A;  4C5S A;  3TV2 A;  5D6B A;  1FUR A;  3KDZ A;  2NYN A;  5M0J A;  3C8T A;  2HVG A;  3CZO A;  2O7F A;  1I0A A;  5M0I A;  2FEL A; 
#chains in the Genus database with same CATH homology
 5M0J A;  4WNL A;  5M0I A;  1XLY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...