5M0IA

Crystal structure of the nuclear complex with she2p and the ash1 mrna e3-localization element
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
241
structure length
225
Chain Sequence
b'LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFIADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SWI5-dependent HO expression protein 2
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 96
structure length 225
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0iA00
5M0IA 1XLYA 5M0JA 4WNLA
chains in the Genus database with same CATH superfamily
2QGAB 3OCEA 3R6VA 5M0JA 3CZOA 1HY0A 1I0AA 1FUPA 1J3UA 4WNLA 4ADLA 4CQ5A 2RJRA 1GKJA 2PFMA 3E04A 1YFMA 2PTSA 1DCNA 2FELA 1Q5NA 1XWOA 2NYFA 3OCFA 1TJVA 1TJWA 4NLEA 2O7DA 3BHGA 1YISA 1GKMA 1RE5A 1TJUA 2FUSA 4HGVA 4EEIA 2RJSA 1TJ7A 3GZHA 1XLYA 4V2QA 2E9FA 1Y2MA 2VD6A 2O6YA 2OHYA 4FLCA 3RRPA 1DOFA 3R6QA 4C5RA 1HY1A 2O78A 3R6YA 1JSWA 1GK3A 2J91A 1B8FA 5EYTA 2X75A 1VDKA 1U16A 2FENA 2HVGA 2O7FA 1AUWA 5HW2A 1GK2A 3GTDA 3RD8A 4EFCA 1U15A 1W27A 5M0IA 1C3CA 1K62A 4BABA 4NSLA 4ADMA 1FURA 3NZ4A 5F91A 1FUQA 1T6PA 3NO9A 1FUOA 3KDYA 4APAA 5EYVA 2O7BA 4C5UA 1C3UA 4C6GA 3C8TA 2O7EA 3KDZA 1KQ7A 4APBA 4BAAA 2QVEA 3TV2A 2YIIA 1YFEA 1T6JA 3UNVA 4FFXA 5D6BA 2PTRA 2PTQA 5F92A 4C5SA 2NYNA 4MX2A 1K7WA 3QBPA 4V2RA 1EB4A
chains in the Genus database with same CATH topology
5M0IA 1XLYA 5M0JA 4WNLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0I A;  1XLY A;  5M0J A;  4WNL A; 
#chains in the Genus database with same CATH topology
 2QGA B;  3OCE A;  3R6V A;  5M0J A;  3CZO A;  1HY0 A;  1I0A A;  1FUP A;  1J3U A;  4WNL A;  4ADL A;  4CQ5 A;  2RJR A;  1GKJ A;  2PFM A;  3E04 A;  1YFM A;  2PTS A;  1DCN A;  2FEL A;  1Q5N A;  1XWO A;  2NYF A;  3OCF A;  1TJV A;  1TJW A;  4NLE A;  2O7D A;  3BHG A;  1YIS A;  1GKM A;  1RE5 A;  1TJU A;  2FUS A;  4HGV A;  4EEI A;  2RJS A;  1TJ7 A;  3GZH A;  1XLY A;  4V2Q A;  2E9F A;  1Y2M A;  2VD6 A;  2O6Y A;  2OHY A;  4FLC A;  3RRP A;  1DOF A;  3R6Q A;  4C5R A;  1HY1 A;  2O78 A;  3R6Y A;  1JSW A;  1GK3 A;  2J91 A;  1B8F A;  5EYT A;  2X75 A;  1VDK A;  1U16 A;  2FEN A;  2HVG A;  2O7F A;  1AUW A;  5HW2 A;  1GK2 A;  3GTD A;  3RD8 A;  4EFC A;  1U15 A;  1W27 A;  5M0I A;  1C3C A;  1K62 A;  4BAB A;  4NSL A;  4ADM A;  1FUR A;  3NZ4 A;  5F91 A;  1FUQ A;  1T6P A;  3NO9 A;  1FUO A;  3KDY A;  4APA A;  5EYV A;  2O7B A;  4C5U A;  1C3U A;  4C6G A;  3C8T A;  2O7E A;  3KDZ A;  1KQ7 A;  4APB A;  4BAA A;  2QVE A;  3TV2 A;  2YII A;  1YFE A;  1T6J A;  3UNV A;  4FFX A;  5D6B A;  2PTR A;  2PTQ A;  5F92 A;  4C5S A;  2NYN A;  4MX2 A;  1K7W A;  3QBP A;  4V2R A;  1EB4 A; 
#chains in the Genus database with same CATH homology
 5M0I A;  1XLY A;  5M0J A;  4WNL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...