5M0IA

Crystal structure of the nuclear complex with she2p and the ash1 mrna e3-localization element
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
241
structure length
225
Chain Sequence
LGSDIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFIADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SWI5-dependent HO expression protein 2
publication title Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 96
structure length 225
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11435 She2p RNA binding protein She2p
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.20 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 She2 domain 5m0iA00
4WNLA 1XLYA 5M0IA 5M0JA
chains in the Genus database with same CATH superfamily
1W27A 5HW2A 1GKJA 4FFXA 1B8FA 3TV2A 1GKMA 1TJVA 5EYVA 3UNVA 4APAA 1TJWA 1XWOA 3NZ4A 2NYNA 5F91A 2E9FA 2O7EA 2FUSA 1AUWA 1DCNA 2PFMA 1GK3A 4MX2A 5EYTA 2NYFA 2X75A 4EFCA 3BHGA 1TJUA 3QBPA 4BAAA 2RJRA 1YFEA 4V2RA 4EEIA 3GZHA 3R6YA 1VDKA 1C3UA 2FELA 4ADMA 1U15A 1YISA 4V2QA 1HY0A 2YIIA 2OHYA 4C5SA 2O7FA 1Y2MA 4FLCA 4APBA 1T6PA 4WNLA 2O6YA 1C3CA 1RE5A 1FUQA 5M0JA 3GTDA 2PTQA 2PTRA 3OCFA 1GK2A 4BABA 1I0AA 2O78A 1FUOA 1FUPA 1T6JA 2O7DA 3KDZA 1KQ7A 4HGVA 1J3UA 1TJ7A 1XLYA 1YFMA 3KDYA 3RD8A 3NO9A 3R6QA 4C5RA 4CQ5A 2RJSA 3E04A 1EB4A 4NLEA 5M0IA 2QGAB 3CZOA 2PTSA 4C6GA 2VD6A 3R6VA 1FURA 1JSWA 1U16A 4C5UA 1K62A 3OCEA 2QVEA 3RRPA 4NSLA 2HVGA 3C8TA 1HY1A 2O7BA 1K7WA 2FENA 1DOFA 4ADLA 1Q5NA 2J91A 5F92A 5D6BA
chains in the Genus database with same CATH topology
4WNLA 1XLYA 5M0IA 5M0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WNL A;  1XLY A;  5M0I A;  5M0J A; 
#chains in the Genus database with same CATH topology
 1W27 A;  5HW2 A;  1GKJ A;  4FFX A;  1B8F A;  3TV2 A;  1GKM A;  1TJV A;  5EYV A;  3UNV A;  4APA A;  1TJW A;  1XWO A;  3NZ4 A;  2NYN A;  5F91 A;  2E9F A;  2O7E A;  2FUS A;  1AUW A;  1DCN A;  2PFM A;  1GK3 A;  4MX2 A;  5EYT A;  2NYF A;  2X75 A;  4EFC A;  3BHG A;  1TJU A;  3QBP A;  4BAA A;  2RJR A;  1YFE A;  4V2R A;  4EEI A;  3GZH A;  3R6Y A;  1VDK A;  1C3U A;  2FEL A;  4ADM A;  1U15 A;  1YIS A;  4V2Q A;  1HY0 A;  2YII A;  2OHY A;  4C5S A;  2O7F A;  1Y2M A;  4FLC A;  4APB A;  1T6P A;  4WNL A;  2O6Y A;  1C3C A;  1RE5 A;  1FUQ A;  5M0J A;  3GTD A;  2PTQ A;  2PTR A;  3OCF A;  1GK2 A;  4BAB A;  1I0A A;  2O78 A;  1FUO A;  1FUP A;  1T6J A;  2O7D A;  3KDZ A;  1KQ7 A;  4HGV A;  1J3U A;  1TJ7 A;  1XLY A;  1YFM A;  3KDY A;  3RD8 A;  3NO9 A;  3R6Q A;  4C5R A;  4CQ5 A;  2RJS A;  3E04 A;  1EB4 A;  4NLE A;  5M0I A;  2QGA B;  3CZO A;  2PTS A;  4C6G A;  2VD6 A;  3R6V A;  1FUR A;  1JSW A;  1U16 A;  4C5U A;  1K62 A;  3OCE A;  2QVE A;  3RRP A;  4NSL A;  2HVG A;  3C8T A;  1HY1 A;  2O7B A;  1K7W A;  2FEN A;  1DOF A;  4ADL A;  1Q5N A;  2J91 A;  5F92 A;  5D6B A; 
#chains in the Genus database with same CATH homology
 4WNL A;  1XLY A;  5M0I A;  5M0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...