2FENA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
342
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSGGGKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
total genus 126
structure length 342
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2fenA00
2FELA 2FENA
chains in the Genus database with same CATH superfamily
3R6YA 1FUQA 1I0AA 3E04A 1C3UA 2PTRA 2RJRA 3GTDA 4APAA 1JSWA 1Y2MA 1YFEA 1B8FA 4NLEA 3NZ4A 3RD8A 3R6VA 1HY1A 5M0JA 1TJWA 4EEIA 1DCNA 4APBA 4BAAA 2O7FA 2FENA 2OHYA 2O7EA 1T6PA 1TJ7A 3R6QA 2PFMA 1Q5NA 1U15A 1VDKA 2VD6A 1W27A 5M0IA 2E9FA 1AUWA 3GZHA 3QBPA 4HGVA 1DOFA 5F91A 4V2RA 2O7BA 1HY0A 2O78A 3CZOA 4NSLA 3BHGA 4CQ5A 1YFMA 4C5UA 1FUOA 2NYNA 4C6GA 2HVGA 3TV2A 1KQ7A 3OCFA 4FLCA 2FELA 2X75A 2YIIA 5EYVA 1XWOA 2O7DA 2PTSA 1TJUA 4BABA 5HW2A 1K7WA 1GK2A 5D6BA 1EB4A 1FURA 3RRPA 3OCEA 1GKMA 2PTQA 1GK3A 1T6JA 4FFXA 2QVEA 3UNVA 1GKJA 3KDYA 1FUPA 1RE5A 1J3UA 2NYFA 4C5RA 1XLYA 4V2QA 5F92A 4ADLA 2J91A 2QGAB 3KDZA 2FUSA 4C5SA 1TJVA 2O6YA 4WNLA 5EYTA 1YISA 2RJSA 3C8TA 1K62A 1U16A 4EFCA 1C3CA 4ADMA 4MX2A 3NO9A
chains in the Genus database with same CATH topology
2FELA 2FENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEL A;  2FEN A; 
#chains in the Genus database with same CATH topology
 3R6Y A;  1FUQ A;  1I0A A;  3E04 A;  1C3U A;  2PTR A;  2RJR A;  3GTD A;  4APA A;  1JSW A;  1Y2M A;  1YFE A;  1B8F A;  4NLE A;  3NZ4 A;  3RD8 A;  3R6V A;  1HY1 A;  5M0J A;  1TJW A;  4EEI A;  1DCN A;  4APB A;  4BAA A;  2O7F A;  2FEN A;  2OHY A;  2O7E A;  1T6P A;  1TJ7 A;  3R6Q A;  2PFM A;  1Q5N A;  1U15 A;  1VDK A;  2VD6 A;  1W27 A;  5M0I A;  2E9F A;  1AUW A;  3GZH A;  3QBP A;  4HGV A;  1DOF A;  5F91 A;  4V2R A;  2O7B A;  1HY0 A;  2O78 A;  3CZO A;  4NSL A;  3BHG A;  4CQ5 A;  1YFM A;  4C5U A;  1FUO A;  2NYN A;  4C6G A;  2HVG A;  3TV2 A;  1KQ7 A;  3OCF A;  4FLC A;  2FEL A;  2X75 A;  2YII A;  5EYV A;  1XWO A;  2O7D A;  2PTS A;  1TJU A;  4BAB A;  5HW2 A;  1K7W A;  1GK2 A;  5D6B A;  1EB4 A;  1FUR A;  3RRP A;  3OCE A;  1GKM A;  2PTQ A;  1GK3 A;  1T6J A;  4FFX A;  2QVE A;  3UNV A;  1GKJ A;  3KDY A;  1FUP A;  1RE5 A;  1J3U A;  2NYF A;  4C5R A;  1XLY A;  4V2Q A;  5F92 A;  4ADL A;  2J91 A;  2QGA B;  3KDZ A;  2FUS A;  4C5S A;  1TJV A;  2O6Y A;  4WNL A;  5EYT A;  1YIS A;  2RJS A;  3C8T A;  1K62 A;  1U16 A;  4EFC A;  1C3C A;  4ADM A;  4MX2 A;  3NO9 A; 
#chains in the Genus database with same CATH homology
 2FEL A;  2FEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...