2FENA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
342
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSGGGKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 342
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2fenA00
2FENA 2FELA
chains in the Genus database with same CATH superfamily
4ADMA 4V2QA 1HY1A 3GTDA 1C3CA 4EEIA 2RJSA 3R6YA 1AUWA 2O78A 2O7DA 5EYVA 1TJWA 3QBPA 2O7BA 3RRPA 3CZOA 1U15A 3NO9A 5F91A 1T6JA 1W27A 1JSWA 4CQ5A 1EB4A 4APBA 4EFCA 4ADLA 2OHYA 1FURA 1C3UA 1GK3A 1K62A 2QGAB 1RE5A 2VD6A 3R6QA 1K7WA 2RJRA 3OCFA 2FUSA 3BHGA 5F92A 2E9FA 1B8FA 2PFMA 1T6PA 3TV2A 2HVGA 2YIIA 1TJUA 4C5RA 1HY0A 2J91A 1TJVA 3R6VA 3RD8A 2FENA 3OCEA 1TJ7A 1I0AA 1U16A 4C6GA 1GK2A 1FUPA 1VDKA 4BAAA 1XLYA 1DOFA 1GKJA 2QVEA 1YFMA 4APAA 1KQ7A 4FFXA 2NYNA 4V2RA 3NZ4A 1DCNA 4HGVA 3UNVA 4MX2A 4FLCA 3E04A 2O7FA 3KDYA 4C5UA 1XWOA 2PTQA 1Y2MA 3C8TA 1FUOA 5M0IA 3KDZA 1Q5NA 3GZHA 5HW2A 2O6YA 5D6BA 1FUQA 4NSLA 5EYTA 2NYFA 4NLEA 2O7EA 2PTRA 1GKMA 4C5SA 2X75A 1J3UA 4BABA 1YISA 5M0JA 4WNLA 1YFEA 2FELA 2PTSA
chains in the Genus database with same CATH topology
2FENA 2FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEN A;  2FEL A; 
#chains in the Genus database with same CATH topology
 4ADM A;  4V2Q A;  1HY1 A;  3GTD A;  1C3C A;  4EEI A;  2RJS A;  3R6Y A;  1AUW A;  2O78 A;  2O7D A;  5EYV A;  1TJW A;  3QBP A;  2O7B A;  3RRP A;  3CZO A;  1U15 A;  3NO9 A;  5F91 A;  1T6J A;  1W27 A;  1JSW A;  4CQ5 A;  1EB4 A;  4APB A;  4EFC A;  4ADL A;  2OHY A;  1FUR A;  1C3U A;  1GK3 A;  1K62 A;  2QGA B;  1RE5 A;  2VD6 A;  3R6Q A;  1K7W A;  2RJR A;  3OCF A;  2FUS A;  3BHG A;  5F92 A;  2E9F A;  1B8F A;  2PFM A;  1T6P A;  3TV2 A;  2HVG A;  2YII A;  1TJU A;  4C5R A;  1HY0 A;  2J91 A;  1TJV A;  3R6V A;  3RD8 A;  2FEN A;  3OCE A;  1TJ7 A;  1I0A A;  1U16 A;  4C6G A;  1GK2 A;  1FUP A;  1VDK A;  4BAA A;  1XLY A;  1DOF A;  1GKJ A;  2QVE A;  1YFM A;  4APA A;  1KQ7 A;  4FFX A;  2NYN A;  4V2R A;  3NZ4 A;  1DCN A;  4HGV A;  3UNV A;  4MX2 A;  4FLC A;  3E04 A;  2O7F A;  3KDY A;  4C5U A;  1XWO A;  2PTQ A;  1Y2M A;  3C8T A;  1FUO A;  5M0I A;  3KDZ A;  1Q5N A;  3GZH A;  5HW2 A;  2O6Y A;  5D6B A;  1FUQ A;  4NSL A;  5EYT A;  2NYF A;  4NLE A;  2O7E A;  2PTR A;  1GKM A;  4C5S A;  2X75 A;  1J3U A;  4BAB A;  1YIS A;  5M0J A;  4WNL A;  1YFE A;  2FEL A;  2PTS A; 
#chains in the Genus database with same CATH homology
 2FEN A;  2FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...