2FENA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
342
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSGGGKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
total genus 126
structure length 342
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2fenA00
2FELA 2FENA
chains in the Genus database with same CATH superfamily
4ADLA 2PTQA 1DOFA 2O78A 1KQ7A 2FENA 4APAA 4BABA 5F92A 2FUSA 1T6PA 1HY0A 2O7FA 4C5UA 1U16A 2RJRA 3UNVA 1YFMA 3CZOA 3NZ4A 1DCNA 5EYTA 4NLEA 2O7EA 4C6GA 2YIIA 1YISA 1YFEA 1T6JA 1U15A 1W27A 3R6QA 2PFMA 1TJ7A 5D6BA 4HGVA 4EEIA 5F91A 1FURA 2O6YA 4BAAA 3OCFA 1Y2MA 1AUWA 1TJVA 4NSLA 3C8TA 1GKJA 4V2QA 3GZHA 1RE5A 3QBPA 5EYVA 2OHYA 3KDZA 4C5SA 1TJUA 4V2RA 1GK2A 3OCEA 2PTSA 1GKMA 2QGAB 1I0AA 1K7WA 3TV2A 3E04A 1XWOA 1C3UA 3KDYA 2VD6A 2X75A 1FUQA 5M0JA 2NYFA 1J3UA 4FFXA 4FLCA 1K62A 3BHGA 1B8FA 1JSWA 2QVEA 4CQ5A 3R6YA 1XLYA 2E9FA 2NYNA 2RJSA 4MX2A 3GTDA 1TJWA 1FUPA 2O7BA 2FELA 3RRPA 3NO9A 4WNLA 4APBA 2HVGA 4ADMA 1C3CA 1VDKA 4C5RA 4EFCA 5M0IA 5HW2A 1FUOA 1Q5NA 3R6VA 1HY1A 1EB4A 1GK3A 2O7DA 2J91A 3RD8A 2PTRA
chains in the Genus database with same CATH topology
2FELA 2FENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEL A;  2FEN A; 
#chains in the Genus database with same CATH topology
 4ADL A;  2PTQ A;  1DOF A;  2O78 A;  1KQ7 A;  2FEN A;  4APA A;  4BAB A;  5F92 A;  2FUS A;  1T6P A;  1HY0 A;  2O7F A;  4C5U A;  1U16 A;  2RJR A;  3UNV A;  1YFM A;  3CZO A;  3NZ4 A;  1DCN A;  5EYT A;  4NLE A;  2O7E A;  4C6G A;  2YII A;  1YIS A;  1YFE A;  1T6J A;  1U15 A;  1W27 A;  3R6Q A;  2PFM A;  1TJ7 A;  5D6B A;  4HGV A;  4EEI A;  5F91 A;  1FUR A;  2O6Y A;  4BAA A;  3OCF A;  1Y2M A;  1AUW A;  1TJV A;  4NSL A;  3C8T A;  1GKJ A;  4V2Q A;  3GZH A;  1RE5 A;  3QBP A;  5EYV A;  2OHY A;  3KDZ A;  4C5S A;  1TJU A;  4V2R A;  1GK2 A;  3OCE A;  2PTS A;  1GKM A;  2QGA B;  1I0A A;  1K7W A;  3TV2 A;  3E04 A;  1XWO A;  1C3U A;  3KDY A;  2VD6 A;  2X75 A;  1FUQ A;  5M0J A;  2NYF A;  1J3U A;  4FFX A;  4FLC A;  1K62 A;  3BHG A;  1B8F A;  1JSW A;  2QVE A;  4CQ5 A;  3R6Y A;  1XLY A;  2E9F A;  2NYN A;  2RJS A;  4MX2 A;  3GTD A;  1TJW A;  1FUP A;  2O7B A;  2FEL A;  3RRP A;  3NO9 A;  4WNL A;  4APB A;  2HVG A;  4ADM A;  1C3C A;  1VDK A;  4C5R A;  4EFC A;  5M0I A;  5HW2 A;  1FUO A;  1Q5N A;  3R6V A;  1HY1 A;  1EB4 A;  1GK3 A;  2O7D A;  2J91 A;  3RD8 A;  2PTR A; 
#chains in the Genus database with same CATH homology
 2FEL A;  2FEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...