2FENA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
342
Chain Sequence
b'SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSGGGKQNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 342
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2fenA00
2FENA 2FELA
chains in the Genus database with same CATH superfamily
5M0IA 4MX2A 4HGVA 2FELA 1TJ7A 1DOFA 1W27A 1Y2MA 1B8FA 2O7FA 2O7DA 4C6GA 3OCFA 2OHYA 4C5UA 1TJVA 1XWOA 4V2RA 2E9FA 1FUPA 4FLCA 1XLYA 3E04A 1KQ7A 1I0AA 2HVGA 3R6QA 4EEIA 3KDZA 2O78A 4BAAA 1HY1A 1YISA 1FURA 2O7EA 4C5SA 1AUWA 1TJUA 1JSWA 2PTSA 3QBPA 1J3UA 5EYTA 1HY0A 1GKMA 1C3UA 2O7BA 5F91A 1YFEA 1Q5NA 1YFMA 2PTQA 1K62A 3TV2A 1T6PA 2QVEA 3OCEA 2QGAB 1GK3A 4CQ5A 1EB4A 4APAA 4ADMA 3CZOA 5EYVA 2NYNA 3RD8A 2FENA 3RRPA 3KDYA 4WNLA 5D6BA 4NSLA 4FFXA 4V2QA 5F92A 3BHGA 3R6YA 1FUOA 1RE5A 2X75A 1U16A 1VDKA 2RJSA 2FUSA 1U15A 2PTRA 1TJWA 4EFCA 2O6YA 3GZHA 5M0JA 2J91A 4NLEA 2NYFA 1T6JA 4ADLA 2VD6A 1FUQA 2PFMA 3GTDA 3R6VA 1K7WA 1GKJA 1DCNA 1GK2A 3C8TA 3UNVA 4BABA 5HW2A 2RJRA 1C3CA 3NZ4A 4C5RA 2YIIA 3NO9A 4APBA
chains in the Genus database with same CATH topology
2FENA 2FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEN A;  2FEL A; 
#chains in the Genus database with same CATH topology
 5M0I A;  4MX2 A;  4HGV A;  2FEL A;  1TJ7 A;  1DOF A;  1W27 A;  1Y2M A;  1B8F A;  2O7F A;  2O7D A;  4C6G A;  3OCF A;  2OHY A;  4C5U A;  1TJV A;  1XWO A;  4V2R A;  2E9F A;  1FUP A;  4FLC A;  1XLY A;  3E04 A;  1KQ7 A;  1I0A A;  2HVG A;  3R6Q A;  4EEI A;  3KDZ A;  2O78 A;  4BAA A;  1HY1 A;  1YIS A;  1FUR A;  2O7E A;  4C5S A;  1AUW A;  1TJU A;  1JSW A;  2PTS A;  3QBP A;  1J3U A;  5EYT A;  1HY0 A;  1GKM A;  1C3U A;  2O7B A;  5F91 A;  1YFE A;  1Q5N A;  1YFM A;  2PTQ A;  1K62 A;  3TV2 A;  1T6P A;  2QVE A;  3OCE A;  2QGA B;  1GK3 A;  4CQ5 A;  1EB4 A;  4APA A;  4ADM A;  3CZO A;  5EYV A;  2NYN A;  3RD8 A;  2FEN A;  3RRP A;  3KDY A;  4WNL A;  5D6B A;  4NSL A;  4FFX A;  4V2Q A;  5F92 A;  3BHG A;  3R6Y A;  1FUO A;  1RE5 A;  2X75 A;  1U16 A;  1VDK A;  2RJS A;  2FUS A;  1U15 A;  2PTR A;  1TJW A;  4EFC A;  2O6Y A;  3GZH A;  5M0J A;  2J91 A;  4NLE A;  2NYF A;  1T6J A;  4ADL A;  2VD6 A;  1FUQ A;  2PFM A;  3GTD A;  3R6V A;  1K7W A;  1GKJ A;  1DCN A;  1GK2 A;  3C8T A;  3UNV A;  4BAB A;  5HW2 A;  2RJR A;  1C3C A;  3NZ4 A;  4C5R A;  2YII A;  3NO9 A;  4APB A; 
#chains in the Genus database with same CATH homology
 2FEN A;  2FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...