4FFXA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
469
structure length
457
Chain Sequence
DHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 156
structure length 457
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4ffxA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4ffxA02
2J91A 1TJVA 4C5RA 1FURA 3GZHA 1Y2MA 2O7DA 1HY1A 2O7EA 1XWOA 1AUWA 1GK2A 1J3UA 1TJ7A 1T6PA 1GKMA 1I0AA 2VD6A 2OHYA 4C5UA 2E9FA 2FUSA 4EFCA 4NSLA 1C3CA 1GK3A 3TV2A 4ADMA 2PTSA 4C6GA 1YISA 5F92A 5HW2A 3NZ4A 3RD8A 2QGAB 1C3UA 2O7BA 1GKJA 1DOFA 4APBA 5EYVA 1DCNA 3R6VA 1YFMA 2HVGA 3E04A 3R6YA 2X75A 3CZOA 1FUQA 1T6JA 1K62A 2RJRA 3BHGA 3RRPA 3OCEA 1K7WA 3KDZA 3C8TA 4APAA 3GTDA 5D6BA 3R6QA 4C5SA 2O78A 4BAAA 2O7FA 1YFEA 1U16A 1FUOA 4ADLA 2NYNA 4MX2A 4V2RA 1TJWA 2PTRA 2YIIA 2NYFA 2O6YA 1B8FA 5EYTA 1VDKA 1Q5NA 1KQ7A 3QBPA 1EB4A 1HY0A 2QVEA 4V2QA 4NLEA 1TJUA 4CQ5A 2PTQA 1FUPA 1W27A 3NO9A 4HGVA 2RJSA 1JSWA 4FFXA 2PFMA 5F91A 4BABA 3UNVA 1RE5A 4EEIA 3OCFA 4FLCA 1U15A 3KDYA
chains in the Genus database with same CATH superfamily
2J91A 1TJVA 4C5RA 1FURA 3GZHA 1Y2MA 2O7DA 1HY1A 2O7EA 1XMCA 1XWOA 1AUWA 1XMDA 1GK2A 1J3UA 1TJ7A 1T6PA 1GKMA 1I0AA 2VD6A 2OHYA 4C5UA 2FENA 5M0JA 2E9FA 2FUSA 4EFCA 4NSLA 4A15A 1C3CA 1GK3A 3TV2A 4ADMA 2PTSA 4C6GA 1YISA 5F92A 5HW2A 3CRW1 2FELA 3NZ4A 3RD8A 2QGAB 1C3UA 2O7BA 2VSFA 1GKJA 1DOFA 4APBA 5EYVA 1DCNA 2VL7A 1XL7A 3R6VA 1YFMA 2HVGA 3E04A 3R6YA 2X75A 3CZOA 1FUQA 1T6JA 1K62A 2RJRA 3BHGA 3RRPA 3OCEA 1K7WA 3KDZA 3C8TA 4APAA 1XL8A 3GTDA 5D6BA 3R6QA 4C5SA 2O78A 4BAAA 2O7FA 1YFEA 1U16A 5M0IA 1FUOA 4ADLA 2NYNA 4MX2A 4V2RA 1TJWA 2PTRA 2YIIA 2NYFA 2O6YA 1B8FA 5EYTA 1VDKA 1Q5NA 1KQ7A 3QBPA 1EB4A 4WNLA 1HY0A 2QVEA 4V2QA 4NLEA 1TJUA 4CQ5A 2PTQA 1FUPA 1W27A 3NO9A 4HGVA 2RJSA 1JSWA 4FFXA 2PFMA 5F91A 4BABA 3UNVA 1XLYA 1RE5A 4EEIA 3CRVA 3OCFA 4FLCA 1U15A 5H8WA 3KDYA
chains in the Genus database with same CATH topology
2J91A 1TJVA 4C5RA 1FURA 3GZHA 1Y2MA 2O7DA 1HY1A 2O7EA 1XWOA 1AUWA 1GK2A 1J3UA 1TJ7A 1T6PA 1GKMA 1I0AA 2VD6A 2OHYA 4C5UA 2E9FA 2FUSA 4EFCA 4NSLA 1C3CA 1GK3A 3TV2A 4ADMA 2PTSA 4C6GA 1YISA 5F92A 5HW2A 3NZ4A 3RD8A 2QGAB 1C3UA 2O7BA 1GKJA 1DOFA 4APBA 5EYVA 1DCNA 3R6VA 1YFMA 2HVGA 3E04A 3R6YA 2X75A 3CZOA 1FUQA 1T6JA 1K62A 2RJRA 3BHGA 3RRPA 3OCEA 1K7WA 3KDZA 3C8TA 4APAA 3GTDA 5D6BA 3R6QA 4C5SA 2O78A 4BAAA 2O7FA 1YFEA 1U16A 1FUOA 4ADLA 2NYNA 4MX2A 4V2RA 1TJWA 2PTRA 2YIIA 2NYFA 2O6YA 1B8FA 5EYTA 1VDKA 1Q5NA 1KQ7A 3QBPA 1EB4A 1HY0A 2QVEA 4V2QA 4NLEA 1TJUA 4CQ5A 2PTQA 1FUPA 1W27A 3NO9A 4HGVA 2RJSA 1JSWA 4FFXA 2PFMA 5F91A 4BABA 3UNVA 1RE5A 4EEIA 3OCFA 4FLCA 1U15A 3KDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J91 A;  1TJV A;  4C5R A;  1FUR A;  3GZH A;  1Y2M A;  2O7D A;  1HY1 A;  2O7E A;  1XWO A;  1AUW A;  1GK2 A;  1J3U A;  1TJ7 A;  1T6P A;  1GKM A;  1I0A A;  2VD6 A;  2OHY A;  4C5U A;  2E9F A;  2FUS A;  4EFC A;  4NSL A;  1C3C A;  1GK3 A;  3TV2 A;  4ADM A;  2PTS A;  4C6G A;  1YIS A;  5F92 A;  5HW2 A;  3NZ4 A;  3RD8 A;  2QGA B;  1C3U A;  2O7B A;  1GKJ A;  1DOF A;  4APB A;  5EYV A;  1DCN A;  3R6V A;  1YFM A;  2HVG A;  3E04 A;  3R6Y A;  2X75 A;  3CZO A;  1FUQ A;  1T6J A;  1K62 A;  2RJR A;  3BHG A;  3RRP A;  3OCE A;  1K7W A;  3KDZ A;  3C8T A;  4APA A;  3GTD A;  5D6B A;  3R6Q A;  4C5S A;  2O78 A;  4BAA A;  2O7F A;  1YFE A;  1U16 A;  1FUO A;  4ADL A;  2NYN A;  4MX2 A;  4V2R A;  1TJW A;  2PTR A;  2YII A;  2NYF A;  2O6Y A;  1B8F A;  5EYT A;  1VDK A;  1Q5N A;  1KQ7 A;  3QBP A;  1EB4 A;  1HY0 A;  2QVE A;  4V2Q A;  4NLE A;  1TJU A;  4CQ5 A;  2PTQ A;  1FUP A;  1W27 A;  3NO9 A;  4HGV A;  2RJS A;  1JSW A;  4FFX A;  2PFM A;  5F91 A;  4BAB A;  3UNV A;  1RE5 A;  4EEI A;  3OCF A;  4FLC A;  1U15 A;  3KDY A; 
#chains in the Genus database with same CATH topology
 2J91 A;  1TJV A;  4C5R A;  1FUR A;  3GZH A;  1Y2M A;  2O7D A;  1HY1 A;  2O7E A;  1XMC A;  1XWO A;  1AUW A;  1XMD A;  1GK2 A;  1J3U A;  1TJ7 A;  1T6P A;  1GKM A;  1I0A A;  2VD6 A;  2OHY A;  4C5U A;  2FEN A;  5M0J A;  2E9F A;  2FUS A;  4EFC A;  4NSL A;  4A15 A;  1C3C A;  1GK3 A;  3TV2 A;  4ADM A;  2PTS A;  4C6G A;  1YIS A;  5F92 A;  5HW2 A;  3CRW 1;  2FEL A;  3NZ4 A;  3RD8 A;  2QGA B;  1C3U A;  2O7B A;  2VSF A;  1GKJ A;  1DOF A;  4APB A;  5EYV A;  1DCN A;  2VL7 A;  1XL7 A;  3R6V A;  1YFM A;  2HVG A;  3E04 A;  3R6Y A;  2X75 A;  3CZO A;  1FUQ A;  1T6J A;  1K62 A;  2RJR A;  3BHG A;  3RRP A;  3OCE A;  1K7W A;  3KDZ A;  3C8T A;  4APA A;  1XL8 A;  3GTD A;  5D6B A;  3R6Q A;  4C5S A;  2O78 A;  4BAA A;  2O7F A;  1YFE A;  1U16 A;  5M0I A;  1FUO A;  4ADL A;  2NYN A;  4MX2 A;  4V2R A;  1TJW A;  2PTR A;  2YII A;  2NYF A;  2O6Y A;  1B8F A;  5EYT A;  1VDK A;  1Q5N A;  1KQ7 A;  3QBP A;  1EB4 A;  4WNL A;  1HY0 A;  2QVE A;  4V2Q A;  4NLE A;  1TJU A;  4CQ5 A;  2PTQ A;  1FUP A;  1W27 A;  3NO9 A;  4HGV A;  2RJS A;  1JSW A;  4FFX A;  2PFM A;  5F91 A;  4BAB A;  3UNV A;  1XLY A;  1RE5 A;  4EEI A;  3CRV A;  3OCF A;  4FLC A;  1U15 A;  5H8W A;  3KDY A; 
#chains in the Genus database with same CATH homology
 2J91 A;  1TJV A;  4C5R A;  1FUR A;  3GZH A;  1Y2M A;  2O7D A;  1HY1 A;  2O7E A;  1XWO A;  1AUW A;  1GK2 A;  1J3U A;  1TJ7 A;  1T6P A;  1GKM A;  1I0A A;  2VD6 A;  2OHY A;  4C5U A;  2E9F A;  2FUS A;  4EFC A;  4NSL A;  1C3C A;  1GK3 A;  3TV2 A;  4ADM A;  2PTS A;  4C6G A;  1YIS A;  5F92 A;  5HW2 A;  3NZ4 A;  3RD8 A;  2QGA B;  1C3U A;  2O7B A;  1GKJ A;  1DOF A;  4APB A;  5EYV A;  1DCN A;  3R6V A;  1YFM A;  2HVG A;  3E04 A;  3R6Y A;  2X75 A;  3CZO A;  1FUQ A;  1T6J A;  1K62 A;  2RJR A;  3BHG A;  3RRP A;  3OCE A;  1K7W A;  3KDZ A;  3C8T A;  4APA A;  3GTD A;  5D6B A;  3R6Q A;  4C5S A;  2O78 A;  4BAA A;  2O7F A;  1YFE A;  1U16 A;  1FUO A;  4ADL A;  2NYN A;  4MX2 A;  4V2R A;  1TJW A;  2PTR A;  2YII A;  2NYF A;  2O6Y A;  1B8F A;  5EYT A;  1VDK A;  1Q5N A;  1KQ7 A;  3QBP A;  1EB4 A;  1HY0 A;  2QVE A;  4V2Q A;  4NLE A;  1TJU A;  4CQ5 A;  2PTQ A;  1FUP A;  1W27 A;  3NO9 A;  4HGV A;  2RJS A;  1JSW A;  4FFX A;  2PFM A;  5F91 A;  4BAB A;  3UNV A;  1RE5 A;  4EEI A;  3OCF A;  4FLC A;  1U15 A;  3KDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...