4FFXA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
469
structure length
457
Chain Sequence
DHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
total genus 156
structure length 457
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4ffxA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4ffxA02
5HW2A 2O7BA 1Y2MA 1DCNA 1I0AA 1TJWA 1FURA 3KDYA 1TJUA 1GK2A 3R6QA 1KQ7A 1FUPA 4ADMA 3E04A 1HY1A 1T6PA 1C3CA 1GKJA 4FFXA 3KDZA 2FUSA 4NSLA 2YIIA 3TV2A 2PTQA 3BHGA 2O7EA 2NYNA 3GTDA 3OCFA 2E9FA 1JSWA 2VD6A 4BABA 4V2QA 2O7FA 5F91A 1GK3A 4EFCA 4EEIA 1YISA 2PTSA 1VDKA 1EB4A 4APAA 1FUQA 2NYFA 3R6YA 2J91A 5D6BA 2OHYA 3GZHA 2X75A 3RRPA 2QGAB 1GKMA 1Q5NA 3NZ4A 2RJRA 1TJVA 1T6JA 3C8TA 2O7DA 1HY0A 3CZOA 4MX2A 1XWOA 3RD8A 4NLEA 1DOFA 4CQ5A 1AUWA 3UNVA 2QVEA 1YFEA 3OCEA 4C6GA 2PFMA 3R6VA 2HVGA 1C3UA 2O78A 4V2RA 4FLCA 4C5RA 4BAAA 5F92A 4APBA 1RE5A 1FUOA 5EYVA 1J3UA 3NO9A 4C5UA 4ADLA 1U15A 2RJSA 2PTRA 3QBPA 4HGVA 1TJ7A 1K62A 5EYTA 1W27A 1K7WA 4C5SA 1YFMA 1U16A 2O6YA 1B8FA
chains in the Genus database with same CATH superfamily
5HW2A 2O7BA 1Y2MA 1DCNA 1I0AA 1TJWA 1FURA 3KDYA 1TJUA 1GK2A 2VSFA 3R6QA 1KQ7A 1FUPA 4ADMA 3E04A 1HY1A 1T6PA 1C3CA 1GKJA 4FFXA 3KDZA 2VL7A 3CRVA 2FUSA 4NSLA 2YIIA 3TV2A 2PTQA 3BHGA 2O7EA 2NYNA 3GTDA 3OCFA 2E9FA 1JSWA 2VD6A 4BABA 4V2QA 2O7FA 5F91A 1GK3A 4EFCA 4EEIA 1YISA 2PTSA 1VDKA 1EB4A 4APAA 1FUQA 2NYFA 3R6YA 2J91A 5D6BA 2OHYA 3GZHA 2X75A 3RRPA 2QGAB 1GKMA 1Q5NA 3NZ4A 2RJRA 1TJVA 1T6JA 3C8TA 2O7DA 1XLYA 1HY0A 1XMCA 3CZOA 1XMDA 4MX2A 1XWOA 3RD8A 4NLEA 1DOFA 4CQ5A 1AUWA 3UNVA 1XL8A 1YFEA 2QVEA 3OCEA 4C6GA 2PFMA 3R6VA 4WNLA 2HVGA 1C3UA 2O78A 4V2RA 4FLCA 4C5RA 2FENA 4BAAA 5F92A 4APBA 5H8WA 1RE5A 5M0IA 1FUOA 5EYVA 1J3UA 1XL7A 5M0JA 3NO9A 4C5UA 4ADLA 3CRW1 1U15A 2RJSA 2PTRA 3QBPA 4HGVA 1TJ7A 1K62A 5EYTA 2FELA 1W27A 1K7WA 4C5SA 4A15A 1YFMA 1U16A 2O6YA 1B8FA
chains in the Genus database with same CATH topology
5HW2A 2O7BA 1Y2MA 1DCNA 1I0AA 1TJWA 1FURA 3KDYA 1TJUA 1GK2A 3R6QA 1KQ7A 1FUPA 4ADMA 3E04A 1HY1A 1T6PA 1C3CA 1GKJA 4FFXA 3KDZA 2FUSA 4NSLA 2YIIA 3TV2A 2PTQA 3BHGA 2O7EA 2NYNA 3GTDA 3OCFA 2E9FA 1JSWA 2VD6A 4BABA 4V2QA 2O7FA 5F91A 1GK3A 4EFCA 4EEIA 1YISA 2PTSA 1VDKA 1EB4A 4APAA 1FUQA 2NYFA 3R6YA 2J91A 5D6BA 2OHYA 3GZHA 2X75A 3RRPA 2QGAB 1GKMA 1Q5NA 3NZ4A 2RJRA 1TJVA 1T6JA 3C8TA 2O7DA 1HY0A 3CZOA 4MX2A 1XWOA 3RD8A 4NLEA 1DOFA 4CQ5A 1AUWA 3UNVA 2QVEA 1YFEA 3OCEA 4C6GA 2PFMA 3R6VA 2HVGA 1C3UA 2O78A 4V2RA 4FLCA 4C5RA 4BAAA 5F92A 4APBA 1RE5A 1FUOA 5EYVA 1J3UA 3NO9A 4C5UA 4ADLA 1U15A 2RJSA 2PTRA 3QBPA 4HGVA 1TJ7A 1K62A 5EYTA 1W27A 1K7WA 4C5SA 1YFMA 1U16A 2O6YA 1B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HW2 A;  2O7B A;  1Y2M A;  1DCN A;  1I0A A;  1TJW A;  1FUR A;  3KDY A;  1TJU A;  1GK2 A;  3R6Q A;  1KQ7 A;  1FUP A;  4ADM A;  3E04 A;  1HY1 A;  1T6P A;  1C3C A;  1GKJ A;  4FFX A;  3KDZ A;  2FUS A;  4NSL A;  2YII A;  3TV2 A;  2PTQ A;  3BHG A;  2O7E A;  2NYN A;  3GTD A;  3OCF A;  2E9F A;  1JSW A;  2VD6 A;  4BAB A;  4V2Q A;  2O7F A;  5F91 A;  1GK3 A;  4EFC A;  4EEI A;  1YIS A;  2PTS A;  1VDK A;  1EB4 A;  4APA A;  1FUQ A;  2NYF A;  3R6Y A;  2J91 A;  5D6B A;  2OHY A;  3GZH A;  2X75 A;  3RRP A;  2QGA B;  1GKM A;  1Q5N A;  3NZ4 A;  2RJR A;  1TJV A;  1T6J A;  3C8T A;  2O7D A;  1HY0 A;  3CZO A;  4MX2 A;  1XWO A;  3RD8 A;  4NLE A;  1DOF A;  4CQ5 A;  1AUW A;  3UNV A;  2QVE A;  1YFE A;  3OCE A;  4C6G A;  2PFM A;  3R6V A;  2HVG A;  1C3U A;  2O78 A;  4V2R A;  4FLC A;  4C5R A;  4BAA A;  5F92 A;  4APB A;  1RE5 A;  1FUO A;  5EYV A;  1J3U A;  3NO9 A;  4C5U A;  4ADL A;  1U15 A;  2RJS A;  2PTR A;  3QBP A;  4HGV A;  1TJ7 A;  1K62 A;  5EYT A;  1W27 A;  1K7W A;  4C5S A;  1YFM A;  1U16 A;  2O6Y A;  1B8F A; 
#chains in the Genus database with same CATH topology
 5HW2 A;  2O7B A;  1Y2M A;  1DCN A;  1I0A A;  1TJW A;  1FUR A;  3KDY A;  1TJU A;  1GK2 A;  2VSF A;  3R6Q A;  1KQ7 A;  1FUP A;  4ADM A;  3E04 A;  1HY1 A;  1T6P A;  1C3C A;  1GKJ A;  4FFX A;  3KDZ A;  2VL7 A;  3CRV A;  2FUS A;  4NSL A;  2YII A;  3TV2 A;  2PTQ A;  3BHG A;  2O7E A;  2NYN A;  3GTD A;  3OCF A;  2E9F A;  1JSW A;  2VD6 A;  4BAB A;  4V2Q A;  2O7F A;  5F91 A;  1GK3 A;  4EFC A;  4EEI A;  1YIS A;  2PTS A;  1VDK A;  1EB4 A;  4APA A;  1FUQ A;  2NYF A;  3R6Y A;  2J91 A;  5D6B A;  2OHY A;  3GZH A;  2X75 A;  3RRP A;  2QGA B;  1GKM A;  1Q5N A;  3NZ4 A;  2RJR A;  1TJV A;  1T6J A;  3C8T A;  2O7D A;  1XLY A;  1HY0 A;  1XMC A;  3CZO A;  1XMD A;  4MX2 A;  1XWO A;  3RD8 A;  4NLE A;  1DOF A;  4CQ5 A;  1AUW A;  3UNV A;  1XL8 A;  1YFE A;  2QVE A;  3OCE A;  4C6G A;  2PFM A;  3R6V A;  4WNL A;  2HVG A;  1C3U A;  2O78 A;  4V2R A;  4FLC A;  4C5R A;  2FEN A;  4BAA A;  5F92 A;  4APB A;  5H8W A;  1RE5 A;  5M0I A;  1FUO A;  5EYV A;  1J3U A;  1XL7 A;  5M0J A;  3NO9 A;  4C5U A;  4ADL A;  3CRW 1;  1U15 A;  2RJS A;  2PTR A;  3QBP A;  4HGV A;  1TJ7 A;  1K62 A;  5EYT A;  2FEL A;  1W27 A;  1K7W A;  4C5S A;  4A15 A;  1YFM A;  1U16 A;  2O6Y A;  1B8F A; 
#chains in the Genus database with same CATH homology
 5HW2 A;  2O7B A;  1Y2M A;  1DCN A;  1I0A A;  1TJW A;  1FUR A;  3KDY A;  1TJU A;  1GK2 A;  3R6Q A;  1KQ7 A;  1FUP A;  4ADM A;  3E04 A;  1HY1 A;  1T6P A;  1C3C A;  1GKJ A;  4FFX A;  3KDZ A;  2FUS A;  4NSL A;  2YII A;  3TV2 A;  2PTQ A;  3BHG A;  2O7E A;  2NYN A;  3GTD A;  3OCF A;  2E9F A;  1JSW A;  2VD6 A;  4BAB A;  4V2Q A;  2O7F A;  5F91 A;  1GK3 A;  4EFC A;  4EEI A;  1YIS A;  2PTS A;  1VDK A;  1EB4 A;  4APA A;  1FUQ A;  2NYF A;  3R6Y A;  2J91 A;  5D6B A;  2OHY A;  3GZH A;  2X75 A;  3RRP A;  2QGA B;  1GKM A;  1Q5N A;  3NZ4 A;  2RJR A;  1TJV A;  1T6J A;  3C8T A;  2O7D A;  1HY0 A;  3CZO A;  4MX2 A;  1XWO A;  3RD8 A;  4NLE A;  1DOF A;  4CQ5 A;  1AUW A;  3UNV A;  2QVE A;  1YFE A;  3OCE A;  4C6G A;  2PFM A;  3R6V A;  2HVG A;  1C3U A;  2O78 A;  4V2R A;  4FLC A;  4C5R A;  4BAA A;  5F92 A;  4APB A;  1RE5 A;  1FUO A;  5EYV A;  1J3U A;  3NO9 A;  4C5U A;  4ADL A;  1U15 A;  2RJS A;  2PTR A;  3QBP A;  4HGV A;  1TJ7 A;  1K62 A;  5EYT A;  1W27 A;  1K7W A;  4C5S A;  1YFM A;  1U16 A;  2O6Y A;  1B8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...