4FFXA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
469
structure length
457
Chain Sequence
b'DHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 156
structure length 457
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4ffxA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4ffxA02
4NSLA 2PFMA 2O6YA 1TJUA 4C5SA 1GK3A 1KQ7A 3C8TA 4CQ5A 1K62A 3BHGA 1TJVA 1FUQA 1TJ7A 3TV2A 4C5RA 3RD8A 1C3CA 2RJRA 5D6BA 4BABA 1XWOA 1HY1A 3RRPA 1FUOA 2O7EA 2VD6A 2O7BA 4MX2A 1GK2A 1U16A 1GKMA 3GTDA 2NYFA 2QGAB 3OCFA 2X75A 4APBA 1AUWA 2OHYA 4EFCA 1W27A 3GZHA 4EEIA 4FLCA 2PTQA 4V2RA 4C6GA 3R6VA 1DOFA 3KDYA 2NYNA 1RE5A 3NO9A 4HGVA 2RJSA 2J91A 3R6QA 4ADMA 2PTRA 1I0AA 2PTSA 2QVEA 1YISA 1K7WA 1VDKA 1JSWA 1Y2MA 4BAAA 4APAA 1GKJA 1C3UA 2O78A 1J3UA 1DCNA 1EB4A 1U15A 2YIIA 2E9FA 2O7FA 1FURA 3KDZA 3QBPA 1T6JA 3NZ4A 5EYTA 3E04A 5HW2A 1HY0A 5EYVA 1T6PA 1TJWA 3UNVA 1FUPA 2O7DA 4FFXA 1YFEA 2HVGA 1Q5NA 5F92A 2FUSA 5F91A 4V2QA 3OCEA 4C5UA 1YFMA 3R6YA 4NLEA 4ADLA 3CZOA 1B8FA
chains in the Genus database with same CATH superfamily
4NSLA 5M0JA 2PFMA 2O6YA 2FENA 1TJUA 4C5SA 1GK3A 1KQ7A 3C8TA 4CQ5A 1K62A 3BHGA 1TJVA 1FUQA 1TJ7A 3TV2A 4C5RA 5H8WA 3RD8A 1C3CA 2RJRA 5D6BA 4BABA 1XWOA 1HY1A 5M0IA 3RRPA 1FUOA 2O7EA 2VD6A 3CRW1 1XL7A 2O7BA 4MX2A 1GK2A 2FELA 1U16A 1GKMA 3GTDA 2NYFA 2QGAB 3OCFA 2X75A 4APBA 1AUWA 2OHYA 4EFCA 1W27A 3GZHA 4EEIA 4FLCA 1XMDA 2PTQA 4V2RA 4C6GA 3R6VA 1DOFA 3KDYA 2NYNA 1RE5A 3NO9A 4HGVA 2RJSA 2J91A 3R6QA 4ADMA 2PTRA 1I0AA 2PTSA 2VL7A 2QVEA 1YISA 1XLYA 1K7WA 1VDKA 1JSWA 1Y2MA 4BAAA 4APAA 1GKJA 1C3UA 2O78A 1J3UA 1DCNA 4WNLA 1XL8A 2VSFA 1EB4A 1U15A 2YIIA 2E9FA 2O7FA 1FURA 3KDZA 4A15A 3QBPA 1T6JA 1XMCA 3CRVA 3NZ4A 5EYTA 3E04A 5HW2A 1HY0A 5EYVA 1T6PA 1TJWA 3UNVA 1FUPA 2O7DA 4FFXA 1YFEA 2HVGA 1Q5NA 5F92A 2FUSA 5F91A 4V2QA 3OCEA 4C5UA 1YFMA 3R6YA 4NLEA 4ADLA 3CZOA 1B8FA
chains in the Genus database with same CATH topology
4NSLA 2PFMA 2O6YA 1TJUA 4C5SA 1GK3A 1KQ7A 3C8TA 4CQ5A 1K62A 3BHGA 1TJVA 1FUQA 1TJ7A 3TV2A 4C5RA 3RD8A 1C3CA 2RJRA 5D6BA 4BABA 1XWOA 1HY1A 3RRPA 1FUOA 2O7EA 2VD6A 2O7BA 4MX2A 1GK2A 1U16A 1GKMA 3GTDA 2NYFA 2QGAB 3OCFA 2X75A 4APBA 1AUWA 2OHYA 4EFCA 1W27A 3GZHA 4EEIA 4FLCA 2PTQA 4V2RA 4C6GA 3R6VA 1DOFA 3KDYA 2NYNA 1RE5A 3NO9A 4HGVA 2RJSA 2J91A 3R6QA 4ADMA 2PTRA 1I0AA 2PTSA 2QVEA 1YISA 1K7WA 1VDKA 1JSWA 1Y2MA 4BAAA 4APAA 1GKJA 1C3UA 2O78A 1J3UA 1DCNA 1EB4A 1U15A 2YIIA 2E9FA 2O7FA 1FURA 3KDZA 3QBPA 1T6JA 3NZ4A 5EYTA 3E04A 5HW2A 1HY0A 5EYVA 1T6PA 1TJWA 3UNVA 1FUPA 2O7DA 4FFXA 1YFEA 2HVGA 1Q5NA 5F92A 2FUSA 5F91A 4V2QA 3OCEA 4C5UA 1YFMA 3R6YA 4NLEA 4ADLA 3CZOA 1B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSL A;  2PFM A;  2O6Y A;  1TJU A;  4C5S A;  1GK3 A;  1KQ7 A;  3C8T A;  4CQ5 A;  1K62 A;  3BHG A;  1TJV A;  1FUQ A;  1TJ7 A;  3TV2 A;  4C5R A;  3RD8 A;  1C3C A;  2RJR A;  5D6B A;  4BAB A;  1XWO A;  1HY1 A;  3RRP A;  1FUO A;  2O7E A;  2VD6 A;  2O7B A;  4MX2 A;  1GK2 A;  1U16 A;  1GKM A;  3GTD A;  2NYF A;  2QGA B;  3OCF A;  2X75 A;  4APB A;  1AUW A;  2OHY A;  4EFC A;  1W27 A;  3GZH A;  4EEI A;  4FLC A;  2PTQ A;  4V2R A;  4C6G A;  3R6V A;  1DOF A;  3KDY A;  2NYN A;  1RE5 A;  3NO9 A;  4HGV A;  2RJS A;  2J91 A;  3R6Q A;  4ADM A;  2PTR A;  1I0A A;  2PTS A;  2QVE A;  1YIS A;  1K7W A;  1VDK A;  1JSW A;  1Y2M A;  4BAA A;  4APA A;  1GKJ A;  1C3U A;  2O78 A;  1J3U A;  1DCN A;  1EB4 A;  1U15 A;  2YII A;  2E9F A;  2O7F A;  1FUR A;  3KDZ A;  3QBP A;  1T6J A;  3NZ4 A;  5EYT A;  3E04 A;  5HW2 A;  1HY0 A;  5EYV A;  1T6P A;  1TJW A;  3UNV A;  1FUP A;  2O7D A;  4FFX A;  1YFE A;  2HVG A;  1Q5N A;  5F92 A;  2FUS A;  5F91 A;  4V2Q A;  3OCE A;  4C5U A;  1YFM A;  3R6Y A;  4NLE A;  4ADL A;  3CZO A;  1B8F A; 
#chains in the Genus database with same CATH topology
 4NSL A;  5M0J A;  2PFM A;  2O6Y A;  2FEN A;  1TJU A;  4C5S A;  1GK3 A;  1KQ7 A;  3C8T A;  4CQ5 A;  1K62 A;  3BHG A;  1TJV A;  1FUQ A;  1TJ7 A;  3TV2 A;  4C5R A;  5H8W A;  3RD8 A;  1C3C A;  2RJR A;  5D6B A;  4BAB A;  1XWO A;  1HY1 A;  5M0I A;  3RRP A;  1FUO A;  2O7E A;  2VD6 A;  3CRW 1;  1XL7 A;  2O7B A;  4MX2 A;  1GK2 A;  2FEL A;  1U16 A;  1GKM A;  3GTD A;  2NYF A;  2QGA B;  3OCF A;  2X75 A;  4APB A;  1AUW A;  2OHY A;  4EFC A;  1W27 A;  3GZH A;  4EEI A;  4FLC A;  1XMD A;  2PTQ A;  4V2R A;  4C6G A;  3R6V A;  1DOF A;  3KDY A;  2NYN A;  1RE5 A;  3NO9 A;  4HGV A;  2RJS A;  2J91 A;  3R6Q A;  4ADM A;  2PTR A;  1I0A A;  2PTS A;  2VL7 A;  2QVE A;  1YIS A;  1XLY A;  1K7W A;  1VDK A;  1JSW A;  1Y2M A;  4BAA A;  4APA A;  1GKJ A;  1C3U A;  2O78 A;  1J3U A;  1DCN A;  4WNL A;  1XL8 A;  2VSF A;  1EB4 A;  1U15 A;  2YII A;  2E9F A;  2O7F A;  1FUR A;  3KDZ A;  4A15 A;  3QBP A;  1T6J A;  1XMC A;  3CRV A;  3NZ4 A;  5EYT A;  3E04 A;  5HW2 A;  1HY0 A;  5EYV A;  1T6P A;  1TJW A;  3UNV A;  1FUP A;  2O7D A;  4FFX A;  1YFE A;  2HVG A;  1Q5N A;  5F92 A;  2FUS A;  5F91 A;  4V2Q A;  3OCE A;  4C5U A;  1YFM A;  3R6Y A;  4NLE A;  4ADL A;  3CZO A;  1B8F A; 
#chains in the Genus database with same CATH homology
 4NSL A;  2PFM A;  2O6Y A;  1TJU A;  4C5S A;  1GK3 A;  1KQ7 A;  3C8T A;  4CQ5 A;  1K62 A;  3BHG A;  1TJV A;  1FUQ A;  1TJ7 A;  3TV2 A;  4C5R A;  3RD8 A;  1C3C A;  2RJR A;  5D6B A;  4BAB A;  1XWO A;  1HY1 A;  3RRP A;  1FUO A;  2O7E A;  2VD6 A;  2O7B A;  4MX2 A;  1GK2 A;  1U16 A;  1GKM A;  3GTD A;  2NYF A;  2QGA B;  3OCF A;  2X75 A;  4APB A;  1AUW A;  2OHY A;  4EFC A;  1W27 A;  3GZH A;  4EEI A;  4FLC A;  2PTQ A;  4V2R A;  4C6G A;  3R6V A;  1DOF A;  3KDY A;  2NYN A;  1RE5 A;  3NO9 A;  4HGV A;  2RJS A;  2J91 A;  3R6Q A;  4ADM A;  2PTR A;  1I0A A;  2PTS A;  2QVE A;  1YIS A;  1K7W A;  1VDK A;  1JSW A;  1Y2M A;  4BAA A;  4APA A;  1GKJ A;  1C3U A;  2O78 A;  1J3U A;  1DCN A;  1EB4 A;  1U15 A;  2YII A;  2E9F A;  2O7F A;  1FUR A;  3KDZ A;  3QBP A;  1T6J A;  3NZ4 A;  5EYT A;  3E04 A;  5HW2 A;  1HY0 A;  5EYV A;  1T6P A;  1TJW A;  3UNV A;  1FUP A;  2O7D A;  4FFX A;  1YFE A;  2HVG A;  1Q5N A;  5F92 A;  2FUS A;  5F91 A;  4V2Q A;  3OCE A;  4C5U A;  1YFM A;  3R6Y A;  4NLE A;  4ADL A;  3CZO A;  1B8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...