4FFXA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
469
structure length
457
Chain Sequence
DHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 156
structure length 457
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4ffxA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4ffxA02
5EYVA 1GKMA 2FUSA 2RJSA 4C5UA 1VDKA 1C3CA 1Y2MA 4ADLA 2NYFA 3RD8A 1T6JA 5D6BA 1GK2A 2PTQA 5HW2A 2X75A 4ADMA 1FUPA 1FUQA 1I0AA 3UNVA 1AUWA 1T6PA 5EYTA 3GZHA 4NLEA 3E04A 4C5RA 2VD6A 3NO9A 1EB4A 1RE5A 1W27A 1YFEA 1FUOA 2O6YA 1K7WA 1TJUA 3R6VA 4FFXA 1C3UA 2PTRA 2QGAB 3GTDA 1DCNA 1DOFA 2RJRA 4MX2A 1B8FA 1TJWA 3C8TA 1GK3A 1HY0A 2YIIA 2QVEA 2O78A 3R6QA 1TJ7A 1TJVA 3OCEA 3KDYA 4APBA 1JSWA 2O7FA 1FURA 3TV2A 5F91A 2J91A 2HVGA 4V2QA 1J3UA 2E9FA 1KQ7A 1Q5NA 1XWOA 4EFCA 1HY1A 3QBPA 4C5SA 4CQ5A 2O7EA 1K62A 4EEIA 3RRPA 2O7DA 3NZ4A 4V2RA 2NYNA 1U16A 4BAAA 4APAA 2PTSA 1YFMA 5F92A 1GKJA 1U15A 3R6YA 4NSLA 3OCFA 1YISA 4C6GA 2O7BA 2OHYA 2PFMA 4BABA 3CZOA 3BHGA 4FLCA 3KDZA 4HGVA
chains in the Genus database with same CATH superfamily
5EYVA 1XLYA 1GKMA 2FENA 2FUSA 2RJSA 4C5UA 1VDKA 1C3CA 1Y2MA 4ADLA 2NYFA 3RD8A 1XMDA 1XL8A 1T6JA 2VL7A 5D6BA 1GK2A 1XMCA 2VSFA 2PTQA 5HW2A 2X75A 4ADMA 1FUPA 1FUQA 1I0AA 3UNVA 1AUWA 1T6PA 5EYTA 3GZHA 4NLEA 3E04A 4A15A 4FLCA 4C5RA 2VD6A 3NO9A 1EB4A 1RE5A 1W27A 1YFEA 1FUOA 2FELA 2O6YA 1K7WA 1TJUA 3R6VA 4FFXA 5H8WA 1C3UA 2PTRA 2QGAB 3GTDA 1DCNA 1DOFA 2RJRA 4MX2A 1B8FA 1TJWA 3C8TA 1GK3A 1HY0A 1XL7A 5M0JA 2YIIA 2O78A 4WNLA 3R6QA 1TJ7A 1TJVA 3CRW1 3OCEA 3KDYA 4APBA 1JSWA 2O7FA 1FURA 3TV2A 5F91A 2J91A 2HVGA 4V2QA 1J3UA 2E9FA 1KQ7A 1Q5NA 1XWOA 4EFCA 1HY1A 3QBPA 4C5SA 4CQ5A 2O7EA 1K62A 4EEIA 3RRPA 2O7DA 3NZ4A 4V2RA 2NYNA 1U16A 4BAAA 4APAA 2PTSA 1YFMA 3CRVA 5F92A 1GKJA 1U15A 3R6YA 5M0IA 4NSLA 3OCFA 1YISA 4C6GA 2O7BA 2OHYA 2PFMA 4BABA 3CZOA 3BHGA 2QVEA 3KDZA 4HGVA
chains in the Genus database with same CATH topology
5EYVA 1GKMA 2FUSA 2RJSA 4C5UA 1VDKA 1C3CA 1Y2MA 4ADLA 2NYFA 3RD8A 1T6JA 5D6BA 1GK2A 2PTQA 5HW2A 2X75A 4ADMA 1FUPA 1FUQA 1I0AA 3UNVA 1AUWA 1T6PA 5EYTA 3GZHA 4NLEA 3E04A 4C5RA 2VD6A 3NO9A 1EB4A 1RE5A 1W27A 1YFEA 1FUOA 2O6YA 1K7WA 1TJUA 3R6VA 4FFXA 1C3UA 2PTRA 2QGAB 3GTDA 1DCNA 1DOFA 2RJRA 4MX2A 1B8FA 1TJWA 3C8TA 1GK3A 1HY0A 2YIIA 2QVEA 2O78A 3R6QA 1TJ7A 1TJVA 3OCEA 3KDYA 4APBA 1JSWA 2O7FA 1FURA 3TV2A 5F91A 2J91A 2HVGA 4V2QA 1J3UA 2E9FA 1KQ7A 1Q5NA 1XWOA 4EFCA 1HY1A 3QBPA 4C5SA 4CQ5A 2O7EA 1K62A 4EEIA 3RRPA 2O7DA 3NZ4A 4V2RA 2NYNA 1U16A 4BAAA 4APAA 2PTSA 1YFMA 5F92A 1GKJA 1U15A 3R6YA 4NSLA 3OCFA 1YISA 4C6GA 2O7BA 2OHYA 2PFMA 4BABA 3CZOA 3BHGA 4FLCA 3KDZA 4HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYV A;  1GKM A;  2FUS A;  2RJS A;  4C5U A;  1VDK A;  1C3C A;  1Y2M A;  4ADL A;  2NYF A;  3RD8 A;  1T6J A;  5D6B A;  1GK2 A;  2PTQ A;  5HW2 A;  2X75 A;  4ADM A;  1FUP A;  1FUQ A;  1I0A A;  3UNV A;  1AUW A;  1T6P A;  5EYT A;  3GZH A;  4NLE A;  3E04 A;  4C5R A;  2VD6 A;  3NO9 A;  1EB4 A;  1RE5 A;  1W27 A;  1YFE A;  1FUO A;  2O6Y A;  1K7W A;  1TJU A;  3R6V A;  4FFX A;  1C3U A;  2PTR A;  2QGA B;  3GTD A;  1DCN A;  1DOF A;  2RJR A;  4MX2 A;  1B8F A;  1TJW A;  3C8T A;  1GK3 A;  1HY0 A;  2YII A;  2QVE A;  2O78 A;  3R6Q A;  1TJ7 A;  1TJV A;  3OCE A;  3KDY A;  4APB A;  1JSW A;  2O7F A;  1FUR A;  3TV2 A;  5F91 A;  2J91 A;  2HVG A;  4V2Q A;  1J3U A;  2E9F A;  1KQ7 A;  1Q5N A;  1XWO A;  4EFC A;  1HY1 A;  3QBP A;  4C5S A;  4CQ5 A;  2O7E A;  1K62 A;  4EEI A;  3RRP A;  2O7D A;  3NZ4 A;  4V2R A;  2NYN A;  1U16 A;  4BAA A;  4APA A;  2PTS A;  1YFM A;  5F92 A;  1GKJ A;  1U15 A;  3R6Y A;  4NSL A;  3OCF A;  1YIS A;  4C6G A;  2O7B A;  2OHY A;  2PFM A;  4BAB A;  3CZO A;  3BHG A;  4FLC A;  3KDZ A;  4HGV A; 
#chains in the Genus database with same CATH topology
 5EYV A;  1XLY A;  1GKM A;  2FEN A;  2FUS A;  2RJS A;  4C5U A;  1VDK A;  1C3C A;  1Y2M A;  4ADL A;  2NYF A;  3RD8 A;  1XMD A;  1XL8 A;  1T6J A;  2VL7 A;  5D6B A;  1GK2 A;  1XMC A;  2VSF A;  2PTQ A;  5HW2 A;  2X75 A;  4ADM A;  1FUP A;  1FUQ A;  1I0A A;  3UNV A;  1AUW A;  1T6P A;  5EYT A;  3GZH A;  4NLE A;  3E04 A;  4A15 A;  4FLC A;  4C5R A;  2VD6 A;  3NO9 A;  1EB4 A;  1RE5 A;  1W27 A;  1YFE A;  1FUO A;  2FEL A;  2O6Y A;  1K7W A;  1TJU A;  3R6V A;  4FFX A;  5H8W A;  1C3U A;  2PTR A;  2QGA B;  3GTD A;  1DCN A;  1DOF A;  2RJR A;  4MX2 A;  1B8F A;  1TJW A;  3C8T A;  1GK3 A;  1HY0 A;  1XL7 A;  5M0J A;  2YII A;  2O78 A;  4WNL A;  3R6Q A;  1TJ7 A;  1TJV A;  3CRW 1;  3OCE A;  3KDY A;  4APB A;  1JSW A;  2O7F A;  1FUR A;  3TV2 A;  5F91 A;  2J91 A;  2HVG A;  4V2Q A;  1J3U A;  2E9F A;  1KQ7 A;  1Q5N A;  1XWO A;  4EFC A;  1HY1 A;  3QBP A;  4C5S A;  4CQ5 A;  2O7E A;  1K62 A;  4EEI A;  3RRP A;  2O7D A;  3NZ4 A;  4V2R A;  2NYN A;  1U16 A;  4BAA A;  4APA A;  2PTS A;  1YFM A;  3CRV A;  5F92 A;  1GKJ A;  1U15 A;  3R6Y A;  5M0I A;  4NSL A;  3OCF A;  1YIS A;  4C6G A;  2O7B A;  2OHY A;  2PFM A;  4BAB A;  3CZO A;  3BHG A;  2QVE A;  3KDZ A;  4HGV A; 
#chains in the Genus database with same CATH homology
 5EYV A;  1GKM A;  2FUS A;  2RJS A;  4C5U A;  1VDK A;  1C3C A;  1Y2M A;  4ADL A;  2NYF A;  3RD8 A;  1T6J A;  5D6B A;  1GK2 A;  2PTQ A;  5HW2 A;  2X75 A;  4ADM A;  1FUP A;  1FUQ A;  1I0A A;  3UNV A;  1AUW A;  1T6P A;  5EYT A;  3GZH A;  4NLE A;  3E04 A;  4C5R A;  2VD6 A;  3NO9 A;  1EB4 A;  1RE5 A;  1W27 A;  1YFE A;  1FUO A;  2O6Y A;  1K7W A;  1TJU A;  3R6V A;  4FFX A;  1C3U A;  2PTR A;  2QGA B;  3GTD A;  1DCN A;  1DOF A;  2RJR A;  4MX2 A;  1B8F A;  1TJW A;  3C8T A;  1GK3 A;  1HY0 A;  2YII A;  2QVE A;  2O78 A;  3R6Q A;  1TJ7 A;  1TJV A;  3OCE A;  3KDY A;  4APB A;  1JSW A;  2O7F A;  1FUR A;  3TV2 A;  5F91 A;  2J91 A;  2HVG A;  4V2Q A;  1J3U A;  2E9F A;  1KQ7 A;  1Q5N A;  1XWO A;  4EFC A;  1HY1 A;  3QBP A;  4C5S A;  4CQ5 A;  2O7E A;  1K62 A;  4EEI A;  3RRP A;  2O7D A;  3NZ4 A;  4V2R A;  2NYN A;  1U16 A;  4BAA A;  4APA A;  2PTS A;  1YFM A;  5F92 A;  1GKJ A;  1U15 A;  3R6Y A;  4NSL A;  3OCF A;  1YIS A;  4C6G A;  2O7B A;  2OHY A;  2PFM A;  4BAB A;  3CZO A;  3BHG A;  4FLC A;  3KDZ A;  4HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...