4FFXA

Structural and biochemical characterization of human adenylosuccinate lyase (adsl) and the r303c adsl deficiency associated mutation
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
469
structure length
457
Chain Sequence
DHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFKRNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Biochemical Characterization of Human Adenylosuccinate Lyase (ADSL) and the R303C ADSL Deficiency-Associated Mutation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 156
structure length 457
sequence length 469
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF10397 ADSL_C Adenylosuccinate lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4ffxA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4ffxA02
1GK2A 1U16A 2RJRA 2RJSA 3R6YA 1JSWA 1C3UA 2PFMA 3R6QA 2PTSA 4NLEA 1YFMA 3BHGA 1GKJA 1TJVA 4V2RA 1AUWA 4FLCA 3R6VA 4BABA 1TJWA 1K62A 2O7FA 4FFXA 2PTQA 1C3CA 2NYFA 2FUSA 1W27A 1DCNA 1Q5NA 1VDKA 3KDYA 1K7WA 5HW2A 1DOFA 1GK3A 4NSLA 5F92A 1TJ7A 1U15A 3CZOA 2O78A 3OCEA 4APBA 5D6BA 2J91A 1XWOA 4C5RA 4HGVA 2X75A 3GTDA 3RD8A 2OHYA 4MX2A 3KDZA 4CQ5A 4BAAA 1KQ7A 1FUOA 3E04A 3TV2A 2PTRA 5EYVA 3UNVA 1YISA 1YFEA 4V2QA 4C5UA 1EB4A 2O6YA 4EEIA 1FUPA 5F91A 3NZ4A 1HY0A 1I0AA 3RRPA 2E9FA 4ADMA 1T6JA 2QGAB 4EFCA 1T6PA 1GKMA 2O7DA 4ADLA 2NYNA 4APAA 1Y2MA 3C8TA 5EYTA 3OCFA 4C6GA 1FUQA 2VD6A 4C5SA 3NO9A 1RE5A 2O7EA 1FURA 2QVEA 2YIIA 1J3UA 2HVGA 3QBPA 3GZHA 2O7BA 1HY1A 1TJUA 1B8FA
chains in the Genus database with same CATH superfamily
1GK2A 1U16A 2RJRA 2RJSA 3R6YA 1JSWA 4WNLA 1C3UA 2PFMA 4A15A 3R6QA 2PTSA 4NLEA 1YFMA 3BHGA 1GKJA 1TJVA 4V2RA 1AUWA 4FLCA 3R6VA 4BABA 1XMDA 2VSFA 1TJWA 1K62A 2O7FA 4FFXA 2PTQA 1C3CA 3CRVA 2NYFA 2FUSA 1W27A 1DCNA 1Q5NA 1VDKA 3KDYA 1K7WA 5HW2A 1DOFA 1GK3A 4NSLA 5F92A 1TJ7A 1U15A 3CZOA 2O78A 3OCEA 4APBA 5D6BA 2J91A 1XWOA 4C5RA 2FENA 4HGVA 1XMCA 5M0IA 2X75A 3GTDA 1XL8A 2OHYA 4MX2A 3KDZA 3RD8A 4CQ5A 4BAAA 1KQ7A 1FUOA 3E04A 3TV2A 2PTRA 5EYVA 3UNVA 1YISA 1YFEA 4V2QA 4C5UA 1EB4A 2O6YA 4EEIA 1FUPA 5F91A 3NZ4A 1HY0A 1I0AA 5M0JA 3RRPA 2E9FA 4ADMA 1T6JA 2QGAB 4EFCA 3CRW1 1T6PA 1GKMA 2O7DA 2VL7A 4ADLA 2NYNA 4APAA 1Y2MA 3C8TA 5EYTA 3OCFA 4C6GA 1FUQA 2FELA 1XLYA 2VD6A 4C5SA 3NO9A 1RE5A 5H8WA 2O7EA 1FURA 2QVEA 2YIIA 1J3UA 2HVGA 3QBPA 3GZHA 2O7BA 1HY1A 1TJUA 1XL7A 1B8FA
chains in the Genus database with same CATH topology
1GK2A 1U16A 2RJRA 2RJSA 3R6YA 1JSWA 1C3UA 2PFMA 3R6QA 2PTSA 4NLEA 1YFMA 3BHGA 1GKJA 1TJVA 4V2RA 1AUWA 4FLCA 3R6VA 4BABA 1TJWA 1K62A 2O7FA 4FFXA 2PTQA 1C3CA 2NYFA 2FUSA 1W27A 1DCNA 1Q5NA 1VDKA 3KDYA 1K7WA 5HW2A 1DOFA 1GK3A 4NSLA 5F92A 1TJ7A 1U15A 3CZOA 2O78A 3OCEA 4APBA 5D6BA 2J91A 1XWOA 4C5RA 4HGVA 2X75A 3GTDA 3RD8A 2OHYA 4MX2A 3KDZA 4CQ5A 4BAAA 1KQ7A 1FUOA 3E04A 3TV2A 2PTRA 5EYVA 3UNVA 1YISA 1YFEA 4V2QA 4C5UA 1EB4A 2O6YA 4EEIA 1FUPA 5F91A 3NZ4A 1HY0A 1I0AA 3RRPA 2E9FA 4ADMA 1T6JA 2QGAB 4EFCA 1T6PA 1GKMA 2O7DA 4ADLA 2NYNA 4APAA 1Y2MA 3C8TA 5EYTA 3OCFA 4C6GA 1FUQA 2VD6A 4C5SA 3NO9A 1RE5A 2O7EA 1FURA 2QVEA 2YIIA 1J3UA 2HVGA 3QBPA 3GZHA 2O7BA 1HY1A 1TJUA 1B8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK2 A;  1U16 A;  2RJR A;  2RJS A;  3R6Y A;  1JSW A;  1C3U A;  2PFM A;  3R6Q A;  2PTS A;  4NLE A;  1YFM A;  3BHG A;  1GKJ A;  1TJV A;  4V2R A;  1AUW A;  4FLC A;  3R6V A;  4BAB A;  1TJW A;  1K62 A;  2O7F A;  4FFX A;  2PTQ A;  1C3C A;  2NYF A;  2FUS A;  1W27 A;  1DCN A;  1Q5N A;  1VDK A;  3KDY A;  1K7W A;  5HW2 A;  1DOF A;  1GK3 A;  4NSL A;  5F92 A;  1TJ7 A;  1U15 A;  3CZO A;  2O78 A;  3OCE A;  4APB A;  5D6B A;  2J91 A;  1XWO A;  4C5R A;  4HGV A;  2X75 A;  3GTD A;  3RD8 A;  2OHY A;  4MX2 A;  3KDZ A;  4CQ5 A;  4BAA A;  1KQ7 A;  1FUO A;  3E04 A;  3TV2 A;  2PTR A;  5EYV A;  3UNV A;  1YIS A;  1YFE A;  4V2Q A;  4C5U A;  1EB4 A;  2O6Y A;  4EEI A;  1FUP A;  5F91 A;  3NZ4 A;  1HY0 A;  1I0A A;  3RRP A;  2E9F A;  4ADM A;  1T6J A;  2QGA B;  4EFC A;  1T6P A;  1GKM A;  2O7D A;  4ADL A;  2NYN A;  4APA A;  1Y2M A;  3C8T A;  5EYT A;  3OCF A;  4C6G A;  1FUQ A;  2VD6 A;  4C5S A;  3NO9 A;  1RE5 A;  2O7E A;  1FUR A;  2QVE A;  2YII A;  1J3U A;  2HVG A;  3QBP A;  3GZH A;  2O7B A;  1HY1 A;  1TJU A;  1B8F A; 
#chains in the Genus database with same CATH topology
 1GK2 A;  1U16 A;  2RJR A;  2RJS A;  3R6Y A;  1JSW A;  4WNL A;  1C3U A;  2PFM A;  4A15 A;  3R6Q A;  2PTS A;  4NLE A;  1YFM A;  3BHG A;  1GKJ A;  1TJV A;  4V2R A;  1AUW A;  4FLC A;  3R6V A;  4BAB A;  1XMD A;  2VSF A;  1TJW A;  1K62 A;  2O7F A;  4FFX A;  2PTQ A;  1C3C A;  3CRV A;  2NYF A;  2FUS A;  1W27 A;  1DCN A;  1Q5N A;  1VDK A;  3KDY A;  1K7W A;  5HW2 A;  1DOF A;  1GK3 A;  4NSL A;  5F92 A;  1TJ7 A;  1U15 A;  3CZO A;  2O78 A;  3OCE A;  4APB A;  5D6B A;  2J91 A;  1XWO A;  4C5R A;  2FEN A;  4HGV A;  1XMC A;  5M0I A;  2X75 A;  3GTD A;  1XL8 A;  2OHY A;  4MX2 A;  3KDZ A;  3RD8 A;  4CQ5 A;  4BAA A;  1KQ7 A;  1FUO A;  3E04 A;  3TV2 A;  2PTR A;  5EYV A;  3UNV A;  1YIS A;  1YFE A;  4V2Q A;  4C5U A;  1EB4 A;  2O6Y A;  4EEI A;  1FUP A;  5F91 A;  3NZ4 A;  1HY0 A;  1I0A A;  5M0J A;  3RRP A;  2E9F A;  4ADM A;  1T6J A;  2QGA B;  4EFC A;  3CRW 1;  1T6P A;  1GKM A;  2O7D A;  2VL7 A;  4ADL A;  2NYN A;  4APA A;  1Y2M A;  3C8T A;  5EYT A;  3OCF A;  4C6G A;  1FUQ A;  2FEL A;  1XLY A;  2VD6 A;  4C5S A;  3NO9 A;  1RE5 A;  5H8W A;  2O7E A;  1FUR A;  2QVE A;  2YII A;  1J3U A;  2HVG A;  3QBP A;  3GZH A;  2O7B A;  1HY1 A;  1TJU A;  1XL7 A;  1B8F A; 
#chains in the Genus database with same CATH homology
 1GK2 A;  1U16 A;  2RJR A;  2RJS A;  3R6Y A;  1JSW A;  1C3U A;  2PFM A;  3R6Q A;  2PTS A;  4NLE A;  1YFM A;  3BHG A;  1GKJ A;  1TJV A;  4V2R A;  1AUW A;  4FLC A;  3R6V A;  4BAB A;  1TJW A;  1K62 A;  2O7F A;  4FFX A;  2PTQ A;  1C3C A;  2NYF A;  2FUS A;  1W27 A;  1DCN A;  1Q5N A;  1VDK A;  3KDY A;  1K7W A;  5HW2 A;  1DOF A;  1GK3 A;  4NSL A;  5F92 A;  1TJ7 A;  1U15 A;  3CZO A;  2O78 A;  3OCE A;  4APB A;  5D6B A;  2J91 A;  1XWO A;  4C5R A;  4HGV A;  2X75 A;  3GTD A;  3RD8 A;  2OHY A;  4MX2 A;  3KDZ A;  4CQ5 A;  4BAA A;  1KQ7 A;  1FUO A;  3E04 A;  3TV2 A;  2PTR A;  5EYV A;  3UNV A;  1YIS A;  1YFE A;  4V2Q A;  4C5U A;  1EB4 A;  2O6Y A;  4EEI A;  1FUP A;  5F91 A;  3NZ4 A;  1HY0 A;  1I0A A;  3RRP A;  2E9F A;  4ADM A;  1T6J A;  2QGA B;  4EFC A;  1T6P A;  1GKM A;  2O7D A;  4ADL A;  2NYN A;  4APA A;  1Y2M A;  3C8T A;  5EYT A;  3OCF A;  4C6G A;  1FUQ A;  2VD6 A;  4C5S A;  3NO9 A;  1RE5 A;  2O7E A;  1FUR A;  2QVE A;  2YII A;  1J3U A;  2HVG A;  3QBP A;  3GZH A;  2O7B A;  1HY1 A;  1TJU A;  1B8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...