2FELA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
337
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 337
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2felA00
2FENA 2FELA
chains in the Genus database with same CATH superfamily
2PTQA 3R6VA 1YISA 4FFXA 1J3UA 1XLYA 1HY0A 4EFCA 1RE5A 4APAA 4C5SA 2FUSA 1DCNA 4EEIA 2O7EA 4FLCA 2FENA 1VDKA 4HGVA 3RRPA 1TJUA 1U16A 1FUQA 5D6BA 1Y2MA 3OCEA 1I0AA 1K7WA 1HY1A 5HW2A 3KDZA 3QBPA 1AUWA 1GK3A 5EYVA 3GZHA 4MX2A 3TV2A 1FURA 2RJSA 2QGAB 2OHYA 5F92A 2FELA 3CZOA 1FUPA 1GKJA 5F91A 3R6YA 3OCFA 3C8TA 4WNLA 1B8FA 2PTSA 2YIIA 1Q5NA 4V2QA 3BHGA 3GTDA 3RD8A 1GK2A 3NZ4A 2X75A 2VD6A 1TJVA 2O7BA 1YFMA 1W27A 2O6YA 1FUOA 5M0IA 3E04A 2QVEA 2PTRA 1T6PA 1C3UA 2O7DA 1EB4A 4APBA 1JSWA 3NO9A 1T6JA 4V2RA 4NSLA 2NYFA 2HVGA 1XWOA 4ADLA 1U15A 2O78A 2E9FA 4NLEA 5M0JA 1GKMA 1TJ7A 2RJRA 2O7FA 4C5UA 1YFEA 1DOFA 4ADMA 4BABA 3R6QA 4BAAA 4C5RA 2NYNA 1C3CA 2J91A 4C6GA 1TJWA 4CQ5A 3UNVA 1KQ7A 2PFMA 1K62A 3KDYA 5EYTA
chains in the Genus database with same CATH topology
2FENA 2FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEN A;  2FEL A; 
#chains in the Genus database with same CATH topology
 2PTQ A;  3R6V A;  1YIS A;  4FFX A;  1J3U A;  1XLY A;  1HY0 A;  4EFC A;  1RE5 A;  4APA A;  4C5S A;  2FUS A;  1DCN A;  4EEI A;  2O7E A;  4FLC A;  2FEN A;  1VDK A;  4HGV A;  3RRP A;  1TJU A;  1U16 A;  1FUQ A;  5D6B A;  1Y2M A;  3OCE A;  1I0A A;  1K7W A;  1HY1 A;  5HW2 A;  3KDZ A;  3QBP A;  1AUW A;  1GK3 A;  5EYV A;  3GZH A;  4MX2 A;  3TV2 A;  1FUR A;  2RJS A;  2QGA B;  2OHY A;  5F92 A;  2FEL A;  3CZO A;  1FUP A;  1GKJ A;  5F91 A;  3R6Y A;  3OCF A;  3C8T A;  4WNL A;  1B8F A;  2PTS A;  2YII A;  1Q5N A;  4V2Q A;  3BHG A;  3GTD A;  3RD8 A;  1GK2 A;  3NZ4 A;  2X75 A;  2VD6 A;  1TJV A;  2O7B A;  1YFM A;  1W27 A;  2O6Y A;  1FUO A;  5M0I A;  3E04 A;  2QVE A;  2PTR A;  1T6P A;  1C3U A;  2O7D A;  1EB4 A;  4APB A;  1JSW A;  3NO9 A;  1T6J A;  4V2R A;  4NSL A;  2NYF A;  2HVG A;  1XWO A;  4ADL A;  1U15 A;  2O78 A;  2E9F A;  4NLE A;  5M0J A;  1GKM A;  1TJ7 A;  2RJR A;  2O7F A;  4C5U A;  1YFE A;  1DOF A;  4ADM A;  4BAB A;  3R6Q A;  4BAA A;  4C5R A;  2NYN A;  1C3C A;  2J91 A;  4C6G A;  1TJW A;  4CQ5 A;  3UNV A;  1KQ7 A;  2PFM A;  1K62 A;  3KDY A;  5EYT A; 
#chains in the Genus database with same CATH homology
 2FEN A;  2FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...