2FELA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
337
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
total genus 126
structure length 337
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2felA00
2FELA 2FENA
chains in the Genus database with same CATH superfamily
5F91A 5HW2A 1YFMA 2HVGA 4ADMA 4APBA 1GK3A 1DOFA 2E9FA 2O78A 1GKJA 1Y2MA 1FUQA 2FUSA 3KDYA 1VDKA 4EFCA 1Q5NA 3NZ4A 1FURA 5D6BA 1HY1A 4C6GA 2O7BA 5EYTA 3R6YA 2O7EA 2QVEA 4WNLA 1XWOA 4CQ5A 1W27A 3RRPA 3OCFA 5M0JA 1FUOA 4BAAA 1TJUA 3NO9A 2NYNA 2O7FA 1HY0A 1T6JA 1K7WA 5F92A 4C5RA 3KDZA 4ADLA 2PTQA 1TJ7A 1I0AA 2FELA 2RJRA 2QGAB 4FLCA 2O6YA 1RE5A 2J91A 4NLEA 1TJWA 1DCNA 2O7DA 1U15A 1K62A 3GTDA 2VD6A 1T6PA 2RJSA 1B8FA 1FUPA 1KQ7A 3OCEA 3R6QA 2NYFA 4EEIA 2OHYA 2YIIA 1GKMA 1YISA 4MX2A 1AUWA 2X75A 4APAA 1TJVA 3TV2A 1GK2A 4FFXA 2PTRA 4C5SA 1EB4A 5EYVA 2PTSA 5M0IA 2FENA 1YFEA 3C8TA 1J3UA 1JSWA 3CZOA 4V2RA 3QBPA 4BABA 1XLYA 3R6VA 3UNVA 1C3CA 3E04A 1C3UA 4HGVA 3RD8A 4NSLA 2PFMA 4V2QA 4C5UA 3BHGA 1U16A 3GZHA
chains in the Genus database with same CATH topology
2FELA 2FENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEL A;  2FEN A; 
#chains in the Genus database with same CATH topology
 5F91 A;  5HW2 A;  1YFM A;  2HVG A;  4ADM A;  4APB A;  1GK3 A;  1DOF A;  2E9F A;  2O78 A;  1GKJ A;  1Y2M A;  1FUQ A;  2FUS A;  3KDY A;  1VDK A;  4EFC A;  1Q5N A;  3NZ4 A;  1FUR A;  5D6B A;  1HY1 A;  4C6G A;  2O7B A;  5EYT A;  3R6Y A;  2O7E A;  2QVE A;  4WNL A;  1XWO A;  4CQ5 A;  1W27 A;  3RRP A;  3OCF A;  5M0J A;  1FUO A;  4BAA A;  1TJU A;  3NO9 A;  2NYN A;  2O7F A;  1HY0 A;  1T6J A;  1K7W A;  5F92 A;  4C5R A;  3KDZ A;  4ADL A;  2PTQ A;  1TJ7 A;  1I0A A;  2FEL A;  2RJR A;  2QGA B;  4FLC A;  2O6Y A;  1RE5 A;  2J91 A;  4NLE A;  1TJW A;  1DCN A;  2O7D A;  1U15 A;  1K62 A;  3GTD A;  2VD6 A;  1T6P A;  2RJS A;  1B8F A;  1FUP A;  1KQ7 A;  3OCE A;  3R6Q A;  2NYF A;  4EEI A;  2OHY A;  2YII A;  1GKM A;  1YIS A;  4MX2 A;  1AUW A;  2X75 A;  4APA A;  1TJV A;  3TV2 A;  1GK2 A;  4FFX A;  2PTR A;  4C5S A;  1EB4 A;  5EYV A;  2PTS A;  5M0I A;  2FEN A;  1YFE A;  3C8T A;  1J3U A;  1JSW A;  3CZO A;  4V2R A;  3QBP A;  4BAB A;  1XLY A;  3R6V A;  3UNV A;  1C3C A;  3E04 A;  1C3U A;  4HGV A;  3RD8 A;  4NSL A;  2PFM A;  4V2Q A;  4C5U A;  3BHG A;  1U16 A;  3GZH A; 
#chains in the Genus database with same CATH homology
 2FEL A;  2FEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...