2FELA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
337
Chain Sequence
b'SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
total genus 126
structure length 337
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2felA00
2FENA 2FELA
chains in the Genus database with same CATH superfamily
1GK2A 2YIIA 1TJVA 3R6VA 2O6YA 3E04A 4EFCA 1C3UA 1Y2MA 1VDKA 4V2QA 4NLEA 1Q5NA 4FLCA 1FUQA 5D6BA 1FURA 2RJSA 4NSLA 5EYTA 2PTSA 3KDYA 5M0IA 1T6JA 2PFMA 2PTRA 4HGVA 4EEIA 4C5RA 4ADMA 1TJWA 4V2RA 1GKJA 2QGAB 3R6QA 3KDZA 1FUPA 1DOFA 4BAAA 1J3UA 2VD6A 2O7EA 1K7WA 2HVGA 1HY0A 4C6GA 5F92A 3GZHA 1JSWA 1W27A 3GTDA 2QVEA 1T6PA 1I0AA 3RRPA 2E9FA 1B8FA 4CQ5A 3OCEA 4MX2A 3CZOA 1XLYA 3C8TA 3RD8A 4C5SA 3NZ4A 5EYVA 2O7DA 1TJUA 2NYNA 1C3CA 2RJRA 4BABA 5F91A 1YFEA 5M0JA 3NO9A 4C5UA 1K62A 2J91A 2FENA 1EB4A 2O78A 2OHYA 2O7BA 1GKMA 3R6YA 1YFMA 2X75A 1KQ7A 2FELA 4APBA 2NYFA 1XWOA 4WNLA 2O7FA 1TJ7A 4FFXA 1DCNA 1AUWA 5HW2A 1FUOA 1U15A 3BHGA 3OCFA 1YISA 2FUSA 3QBPA 4APAA 3UNVA 1RE5A 1U16A 1HY1A 3TV2A 2PTQA 1GK3A 4ADLA
chains in the Genus database with same CATH topology
2FENA 2FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEN A;  2FEL A; 
#chains in the Genus database with same CATH topology
 1GK2 A;  2YII A;  1TJV A;  3R6V A;  2O6Y A;  3E04 A;  4EFC A;  1C3U A;  1Y2M A;  1VDK A;  4V2Q A;  4NLE A;  1Q5N A;  4FLC A;  1FUQ A;  5D6B A;  1FUR A;  2RJS A;  4NSL A;  5EYT A;  2PTS A;  3KDY A;  5M0I A;  1T6J A;  2PFM A;  2PTR A;  4HGV A;  4EEI A;  4C5R A;  4ADM A;  1TJW A;  4V2R A;  1GKJ A;  2QGA B;  3R6Q A;  3KDZ A;  1FUP A;  1DOF A;  4BAA A;  1J3U A;  2VD6 A;  2O7E A;  1K7W A;  2HVG A;  1HY0 A;  4C6G A;  5F92 A;  3GZH A;  1JSW A;  1W27 A;  3GTD A;  2QVE A;  1T6P A;  1I0A A;  3RRP A;  2E9F A;  1B8F A;  4CQ5 A;  3OCE A;  4MX2 A;  3CZO A;  1XLY A;  3C8T A;  3RD8 A;  4C5S A;  3NZ4 A;  5EYV A;  2O7D A;  1TJU A;  2NYN A;  1C3C A;  2RJR A;  4BAB A;  5F91 A;  1YFE A;  5M0J A;  3NO9 A;  4C5U A;  1K62 A;  2J91 A;  2FEN A;  1EB4 A;  2O78 A;  2OHY A;  2O7B A;  1GKM A;  3R6Y A;  1YFM A;  2X75 A;  1KQ7 A;  2FEL A;  4APB A;  2NYF A;  1XWO A;  4WNL A;  2O7F A;  1TJ7 A;  4FFX A;  1DCN A;  1AUW A;  5HW2 A;  1FUO A;  1U15 A;  3BHG A;  3OCF A;  1YIS A;  2FUS A;  3QBP A;  4APA A;  3UNV A;  1RE5 A;  1U16 A;  1HY1 A;  3TV2 A;  2PTQ A;  1GK3 A;  4ADL A; 
#chains in the Genus database with same CATH homology
 2FEN A;  2FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...