2FELA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
337
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
molecule tags Isomerase
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
total genus 126
structure length 337
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2felA00
2FENA 2FELA
chains in the Genus database with same CATH superfamily
1GKMA 4C5UA 3OCFA 4BAAA 1I0AA 2J91A 1YFEA 2RJRA 1Y2MA 5EYTA 3KDZA 2PTQA 1HY1A 1FUPA 3RRPA 5HW2A 1FURA 1GK2A 3UNVA 3CZOA 1FUOA 2O7FA 5M0IA 2FUSA 4MX2A 5M0JA 4APAA 1TJ7A 2O7BA 2O7EA 2RJSA 2O7DA 1TJWA 2HVGA 3GTDA 3R6YA 4WNLA 4EFCA 4V2RA 4CQ5A 1T6PA 5F92A 1JSWA 2YIIA 4C6GA 4C5SA 4EEIA 4V2QA 1B8FA 5EYVA 4ADMA 1W27A 1TJUA 1U15A 2X75A 1T6JA 1C3UA 1GK3A 3NO9A 1TJVA 2PTSA 3E04A 1XLYA 2FENA 3KDYA 1HY0A 1DCNA 4NSLA 2OHYA 1EB4A 3QBPA 1DOFA 1AUWA 1Q5NA 4FLCA 4APBA 3GZHA 2O6YA 3BHGA 3RD8A 2PFMA 3NZ4A 1VDKA 1YISA 2PTRA 2NYNA 4C5RA 3OCEA 1YFMA 1K62A 4ADLA 4HGVA 2E9FA 1GKJA 4FFXA 1RE5A 2QVEA 4NLEA 2QGAB 2VD6A 5F91A 1U16A 5D6BA 1J3UA 3C8TA 1KQ7A 3R6QA 4BABA 3R6VA 1K7WA 2O78A 1XWOA 2FELA 2NYFA 1C3CA 3TV2A 1FUQA
chains in the Genus database with same CATH topology
2FENA 2FELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEN A;  2FEL A; 
#chains in the Genus database with same CATH topology
 1GKM A;  4C5U A;  3OCF A;  4BAA A;  1I0A A;  2J91 A;  1YFE A;  2RJR A;  1Y2M A;  5EYT A;  3KDZ A;  2PTQ A;  1HY1 A;  1FUP A;  3RRP A;  5HW2 A;  1FUR A;  1GK2 A;  3UNV A;  3CZO A;  1FUO A;  2O7F A;  5M0I A;  2FUS A;  4MX2 A;  5M0J A;  4APA A;  1TJ7 A;  2O7B A;  2O7E A;  2RJS A;  2O7D A;  1TJW A;  2HVG A;  3GTD A;  3R6Y A;  4WNL A;  4EFC A;  4V2R A;  4CQ5 A;  1T6P A;  5F92 A;  1JSW A;  2YII A;  4C6G A;  4C5S A;  4EEI A;  4V2Q A;  1B8F A;  5EYV A;  4ADM A;  1W27 A;  1TJU A;  1U15 A;  2X75 A;  1T6J A;  1C3U A;  1GK3 A;  3NO9 A;  1TJV A;  2PTS A;  3E04 A;  1XLY A;  2FEN A;  3KDY A;  1HY0 A;  1DCN A;  4NSL A;  2OHY A;  1EB4 A;  3QBP A;  1DOF A;  1AUW A;  1Q5N A;  4FLC A;  4APB A;  3GZH A;  2O6Y A;  3BHG A;  3RD8 A;  2PFM A;  3NZ4 A;  1VDK A;  1YIS A;  2PTR A;  2NYN A;  4C5R A;  3OCE A;  1YFM A;  1K62 A;  4ADL A;  4HGV A;  2E9F A;  1GKJ A;  4FFX A;  1RE5 A;  2QVE A;  4NLE A;  2QGA B;  2VD6 A;  5F91 A;  1U16 A;  5D6B A;  1J3U A;  3C8T A;  1KQ7 A;  3R6Q A;  4BAB A;  3R6V A;  1K7W A;  2O78 A;  1XWO A;  2FEL A;  2NYF A;  1C3C A;  3TV2 A;  1FUQ A; 
#chains in the Genus database with same CATH homology
 2FEN A;  2FEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...