2FELA

3-carboxy-cis,cis-muconate lactonizing enzyme from agrobacterium radiobacter s2
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
349
structure length
337
Chain Sequence
SLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVSGLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQAADKVHFGATSQDVIDTSLMLRLKMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLLRLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIAEFANLLSLVTGTLGKFGQDIALMAEIGSEIRLSNPVNAETLVTLARFNAVQISALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords 3-carboxy-cis,cis-muconate lactonizing enzyme
publication title Structure and function of the 3-carboxy-cis,cis-muconate lactonizing enzyme from the protocatechuate degradative pathway of Agrobacterium radiobacter S2.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 126
structure length 337
sequence length 349
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2005-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.200.30 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase C; Chain A, domain 2 2felA00
2FELA 2FENA
chains in the Genus database with same CATH superfamily
2O7BA 3R6QA 3NO9A 1YFMA 1TJVA 1J3UA 3NZ4A 4APBA 4APAA 2YIIA 4ADLA 1FUOA 4BABA 2PTSA 1KQ7A 2E9FA 4V2QA 3E04A 1HY1A 2FELA 1DCNA 4EFCA 4BAAA 4C5UA 1Q5NA 2NYNA 3CZOA 5F91A 2O7DA 5EYVA 1RE5A 3OCEA 1JSWA 1B8FA 3C8TA 1Y2MA 5D6BA 1GKJA 1K62A 2J91A 1FUQA 3RRPA 3TV2A 1GK3A 2PTRA 1YISA 2VD6A 3UNVA 1TJ7A 3BHGA 5M0JA 1XLYA 5M0IA 1W27A 1T6PA 2RJSA 4C6GA 4EEIA 1GKMA 1FUPA 4WNLA 4V2RA 2O7FA 4ADMA 3QBPA 4FLCA 2HVGA 1U16A 3GZHA 4CQ5A 4HGVA 3KDZA 1T6JA 2O78A 3KDYA 1I0AA 1TJUA 1AUWA 4C5RA 1U15A 1DOFA 4C5SA 2OHYA 2PFMA 2FENA 4MX2A 4NSLA 5F92A 4NLEA 1HY0A 1TJWA 2O7EA 2QVEA 1K7WA 2QGAB 1C3UA 2X75A 1FURA 1EB4A 2PTQA 3OCFA 3R6VA 4FFXA 1XWOA 2FUSA 3RD8A 2RJRA 2NYFA 3GTDA 1VDKA 1C3CA 5HW2A 1YFEA 2O6YA 1GK2A 5EYTA 3R6YA
chains in the Genus database with same CATH topology
2FELA 2FENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FEL A;  2FEN A; 
#chains in the Genus database with same CATH topology
 2O7B A;  3R6Q A;  3NO9 A;  1YFM A;  1TJV A;  1J3U A;  3NZ4 A;  4APB A;  4APA A;  2YII A;  4ADL A;  1FUO A;  4BAB A;  2PTS A;  1KQ7 A;  2E9F A;  4V2Q A;  3E04 A;  1HY1 A;  2FEL A;  1DCN A;  4EFC A;  4BAA A;  4C5U A;  1Q5N A;  2NYN A;  3CZO A;  5F91 A;  2O7D A;  5EYV A;  1RE5 A;  3OCE A;  1JSW A;  1B8F A;  3C8T A;  1Y2M A;  5D6B A;  1GKJ A;  1K62 A;  2J91 A;  1FUQ A;  3RRP A;  3TV2 A;  1GK3 A;  2PTR A;  1YIS A;  2VD6 A;  3UNV A;  1TJ7 A;  3BHG A;  5M0J A;  1XLY A;  5M0I A;  1W27 A;  1T6P A;  2RJS A;  4C6G A;  4EEI A;  1GKM A;  1FUP A;  4WNL A;  4V2R A;  2O7F A;  4ADM A;  3QBP A;  4FLC A;  2HVG A;  1U16 A;  3GZH A;  4CQ5 A;  4HGV A;  3KDZ A;  1T6J A;  2O78 A;  3KDY A;  1I0A A;  1TJU A;  1AUW A;  4C5R A;  1U15 A;  1DOF A;  4C5S A;  2OHY A;  2PFM A;  2FEN A;  4MX2 A;  4NSL A;  5F92 A;  4NLE A;  1HY0 A;  1TJW A;  2O7E A;  2QVE A;  1K7W A;  2QGA B;  1C3U A;  2X75 A;  1FUR A;  1EB4 A;  2PTQ A;  3OCF A;  3R6V A;  4FFX A;  1XWO A;  2FUS A;  3RD8 A;  2RJR A;  2NYF A;  3GTD A;  1VDK A;  1C3C A;  5HW2 A;  1YFE A;  2O6Y A;  1GK2 A;  5EYT A;  3R6Y A; 
#chains in the Genus database with same CATH homology
 2FEL A;  2FEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...