The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
95
|
sequence length |
238
|
structure length |
223
|
Chain Sequence |
DIKVTPGTSELVEQILALLSRYLSSYIHVLNKFISHLRRVATLRFERTTLIKFVKKLRFYNDSVLSYNASEFINADSFDKVILPIASMFVKSVETFDLLNYYLTQSLQKEILSKTLNEDLTLTAESILAIDDTYNHFVKFSQWMIESLRIGSNLLDLEVVQFAIKSADEDGDNIFLQEILPVNSEEEFQTLSAAWHSILDGKLSALDEEFDVVATKWHDKFGK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular architecture and dynamics of ASH1 mRNA recognition by its mRNA-transport complex.
pubmed doi rcsb |
| molecule keywords |
SWI5-dependent HO expression protein 2,SWI5-dependent HO exp
|
| molecule tags |
Rna binding protein
|
| source organism |
Saccharomyces cerevisiae (strain rm11-1a)
|
| total genus |
95
|
| structure length |
223
|
| sequence length |
238
|
| chains with identical sequence |
B, C, D, G, H, I, J
|
| ec nomenclature | |
| pdb deposition date | 2016-10-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11435 | She2p | RNA binding protein She2p |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Fumarase C; Chain A, domain 2 | She2 domain |
#chains in the Genus database with same CATH superfamily 5M0I A; 4WNL A; 5M0J A; 1XLY A; #chains in the Genus database with same CATH topology 3GZH A; 4HGV A; 2O78 A; 1J3U A; 1VDK A; 3KDZ A; 4C5U A; 1U15 A; 4BAB A; 1TJU A; 4APB A; 1W27 A; 2YII A; 4WNL A; 2J91 A; 2RJR A; 1U16 A; 1YFM A; 1YIS A; 1EB4 A; 2QVE A; 5HW2 A; 1C3U A; 5D6B A; 2O7F A; 1GKJ A; 4ADL A; 3QBP A; 3TV2 A; 4MX2 A; 3NO9 A; 3E04 A; 2O7B A; 2PTS A; 4C5S A; 1HY1 A; 4C5R A; 2NYF A; 4ADM A; 2O7D A; 3OCF A; 1Q5N A; 1T6P A; 4C6G A; 1RE5 A; 1GK2 A; 1TJW A; 1B8F A; 2O6Y A; 4APA A; 3UNV A; 1DCN A; 5M0I A; 1JSW A; 1GKM A; 3KDY A; 2NYN A; 2HVG A; 3R6V A; 1GK3 A; 4EFC A; 4FFX A; 4FLC A; 4NSL A; 2FUS A; 1TJV A; 1FUO A; 1FUP A; 5EYV A; 1C3C A; 4V2R A; 4CQ5 A; 4EEI A; 2O7E A; 5F92 A; 2X75 A; 3CZO A; 1Y2M A; 3GTD A; 3RRP A; 1YFE A; 3OCE A; 2PTR A; 1XWO A; 1HY0 A; 1FUR A; 1FUQ A; 2PFM A; 1TJ7 A; 4NLE A; 2E9F A; 1XLY A; 3RD8 A; 2VD6 A; 4V2Q A; 3R6Y A; 1AUW A; 3R6Q A; 2QGA B; 1T6J A; 5F91 A; 5M0J A; 2FEL A; 1KQ7 A; 3C8T A; 2OHY A; 1I0A A; 1K7W A; 2PTQ A; 2FEN A; 2RJS A; 1K62 A; 5EYT A; 4BAA A; 1DOF A; 3BHG A; 3NZ4 A; #chains in the Genus database with same CATH homology 5M0I A; 4WNL A; 5M0J A; 1XLY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...