5D6GA

Crystal structure of fragment of ribosomal protein p0 in complex with 74nt 23s rna from methanococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
APWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords 50S ribosomal protein L10
publication title CRYSTAL STRUCTURE OF FRAGMENT OF RIBOSOMAL PROTEIN P0 IN COMPLEX WITH 74NT 23S RNA FROM METHANOCOCCUS JANNASCHII
rcsb
source organism Methanocaldococcus jannaschii
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d6gA01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d6gA02
3J7Z5 4NWBA 5GAEI 4UY85 3J7YI 2QA4G 4V19J 1ZAXA 5D8HB 1ZAWA 5D6GA 3A1YG 1ZAVA 5GADI 3JSYA 5GAHI 5GAGI
chains in the Genus database with same CATH superfamily
5ETLA 2HVDA 1CS4A 3Q8QB 5D6GA 1PO6A 1U7LA 1T05A 2ZWOA 1SKSA 1PILA 5IT4A 3E2EA 5B0EA 2N82B 1M5OC 4TLRA 2FLOA 4DCPB 4NYOA 4M5JA 1IBMF 4F02A 2N7CA 3HSJA 4ZOSA 4TN2A 1B64A 4IFYA 5A6WA 3M8QA 1A7GE 3DOKA 1HBMB 4ZVUB 2V2QA 4CLKA 4KGMA 3G6YA 3MXHP 4DR1F 3DXBA 3U1MA 1T3OA 2QFJA 2AEMA 3FCVA 3S1TA 2J6TA 3C6TA 2AJQA 4F67A 2R2UA 4WF9Q 2M88A 2M70A 1RP5A 4WWSA 1P8GA 1DARA 4H4KA 3G82B 4C8NA 4ZHRB 3M8SA 2F9JA 2HEKA 2PE8A 1U2FA 4WK1A 3RB4A 4J9KA 6FD1A 2FJWA 1RT1B 1ZAWA 3PW4A 2A1BA 1HL6A 3DYAA 3MMCB 5HLFB 2VBZA 1AROP 5E7OB 1VBXA 3T5JA 5K8PA 1TKXA 3M2VA 3BQ2A 4QWEA 2W9CB 1JKHA 3GSDA 4DFMA 4BWJA 1XC9A 3I9ZA 2GMLA 4Q43A 1S6OA 3CMES 4J9UE 1NKBA 1I1GA 4LR8A 1F3FA 1SKUB 1FXDA 4LQ9A 2HVZA 1DBDA 5C24A 1L3SA 4U8YA 4UZCA 1B0PA 3OFGA 2VICA 1JLFB 2PDAA 3GJQB 3AHPA 1NJXA 4U7UD 5HI7A 3V6DA 3EGVA 2J0SD 4WXWA 4DXLA 3JB9k 2V2VA 4RX6A 4TVAB 2MHNA 3J7Z5 4UY8T 3V4IB 2EG2A 4E8UA 4M5DB 3KLIB 4B02A 4CT9A 1SVDA 3OVSA 1P27B 3M9OB 1KVKA 3UCUP 4IUFA 2Y0SD 3FBEA 4DV1J 1B70B 1M5VC 1S9EB 2BXJA 3GG1A 3UFCX 5HO4A 3AA8A 4HYKA 3GFHA 1HNZJ 3UQSA 1D09B 2HQCA 3JTNA 3LGHA 2VFUA 3O44A 5D4PA 3KJNB 3TAMA 4K0KJ 1BUXA 2JWNA 4JI4F 4Z7YA 5J1EA 3MR2A 1NZAA 4LBHA 2BDPA 2YWHA 1RAJA 1RWPB 3OL6A 3E01A 4TK3A 2JZ5A 2UUCJ 2KN4A 3CIMA 3CJKB 1PG5B 4A48A 5LXYA 4P9SA 1ZA1B 4CYUB 3KK1B 4IFVA 1LFPA 3OL7A 4Q8FA 1K1QA 5B0AA 2MKYA 3P6YC 1S0MA 1XI8A 3U7JA 3BYPA 4FYYB 3QWPA 4K59A 3ZXWA 1LWEA 1KBRA 4OL8A 5KOWA 1ZZFA 5J1NA 1SJQA 3ILIA 2CJ9A 4NL5A 1CJTB 1NK8A 2NCKL 1SQFA 5KFUA 1WI6A 2QYCA 2RQCA 5IV4A 1LXJA 4PKDB 3HJFA 4QR0A 2R8JA 3KLFB 3NEKA 2HZVA 2PA3A 4KYZA 1AFIA 3IWLA 1I94F 2KHCA 4DR3J 1JJ2R 2APOA 2W2PP 5KT4A 1PSDA 3CWJA 3TQ1A 1U1PA 2ZITA 3JXOA 4ZVGA 1Z1ZA 1CQNA 4UT4A 2IC3A 2M9KA 5F9NA 4X66J 1VFJA 3IFEA 4Z2XA 2WAQD 1H6KX 2VFRA 4CO0A 4F0KA 1UVLA 3DLGA 4AQYJ 3RU0A 2ABYA 3HHKA 4KPYA 2A2CA 5KFYA 4CNZA 1VJWA 2V4JA 1BE4A 2UZAA 1HBNA 3SDEA 3LGNA 2YWEA 3OTOJ 1UVJA 2UVRA 1KOHA 3U1LA 2C1EB 1KHWA 3IWXA 5ERRA 1O8BA 4RU9A 1X4DA 4P72A 5IM0B 1WG4A 1KSPA 3GR0A 3BR9A 2JDJA 3T1YF 4MKVA 3PW5A 2X3DA 3BGFA 1GMWA 2JVRA 4F4XA 4XAKA 4XIUA 4EO8A 3DI6A 1N56A 4NI2A 4NLSA 4J9RA 2XNRA 3DU6A 3WDOA 3HVRA 4DHVA 1EIYB 1P6TA 2JVOA 3AAWB 1IKXB 5DG9A 3H5YA 1FRXA 4LFAJ 4Q45A 4DG1A 4GMKA 3J81Y 2XGPA 4ZIWA 5CYMA 4OHZA 2GIFA 1XNRJ 2JRSA 1IBKJ 2D9OA 1H2UX 1H7WA 1DY3A 4WYWA 4ZCLA 3MOJB 2NXEA 3BKUA 1BXNA 1UPPA 3BBFA 5E2QA 3QO9A 3AJ2A 4UOFA 1RQ0A 1N34F 1FJCA 2MQNA 1VBKA 3L7UA 2YNFA 3H7HB 1LXNA 2QG9B 2RVJA 4DLGA 2RH3A 1N33F 3LQVA 5M2PA 3NNAA 1VQYA 3K0JA 3MM8B 4P73A 4WXOA 3QIDA 1QAXA 4Y00A 1QM9A 2V4QA 4NEZA 1F5BA 3AOBA 1P1LA 2ASLA 1VQ7S 2QE5A 1JJCB 2UUAF 1ACMB 1OS5A 1KS2A 4NLPA 2A3JA 2GIQA 4KO0A 2VDHA 3H59A 2E5LF 2YXLA 2HFUA 2ZBCA 2DR5A 5DDQC 4DV6J 2AJ0A 2VH7A 5HMZA 5A8RB 1RT5A 3IM9A 1NHKL 2LQJA 4I64A 1RZMA 4O44A 4C3LA 1D9FA 2AYMA 5L9NA 2WSCC 3T9NA 4C8YA 2D3ZA 1A6LA 1VJQA 2DXDA 3VWSA 1N54B 1S5ZA 1UJ5A 2A2DA 1F5AA 5BYRA 1Y00A 4Q2MA 2ATLA 4X4PA 4OI0A 5G4DA 4W98A 1MU2A 4J9LA 2RILA 3AD8C 5LT5A 4O4GB 4URQU 1ZBTA 3EICA 2HZCA 3IR6B 1NK4A 4D3GA 1FO1A 3NGTA 1OMSA 1IJEB 1WHWA 4FDFA 2GA7A 4F26A 4BC7A 1JWWA 4CIOA 3OT9A 3TI0A 1PC5A 5DS7A 1WKJA 5KFIA 2W2OP 2VIHA 4OX9F 1CJVB 4ZLPA 2P9CA 3NBPB 3CCMS 2QLWA 8AT1B 1N48A 9RUBA 2WVFA 4UOHA 4F0MA 2CQ0A 4DX8H 4DV2F 3O6QA 1ZAXA 2KRBA 3V6KA 4DR2J 1ZA2B 2Z8QA 1IKYB 2CFXA 5IC6B 3ELHA 3MEDA 3PM9A 3R27A 1REGX 2BEFA 2HIQA 2E9ZA 1PIEA 4FPRA 3ZZ0A 1N36J 1SPBP 2OSRA 1T03B 1OY6A 3KHGA 2CZ4A 5KFHA 3UD3P 4PEOA 3WX4A 2AP6A 3C6UA 3UD4P 1HHQA 3VGTA 3MCSA 1UVNA 2C2ZB 1H73A 4NLOA 5U47A 1F5CA 3K5LA 4ZP7A 2B7CB 1RK8A 3K5NA 1HNWF 2W25A 1IR0A 2K1RA 5AE1A 5CZVA 2BM0A 2IAJB 2C3OA 4LF6F 1WC6A 3F0NA 4Y2AA 3VAHA 1PYSB 1DTQB 3L7PA 4QW9A 2VZ9A 1GH8A 2FJDB 3W66A 1N6QB 4Q8EA 2CPDA 2QA4G 3I87A 2R8IA 1DZ5A 2GVDB 3IR5B 4RLEA 2M4MA 3KFWX 3QFWA 1H2VZ 3U02A 4LT6A 2DRDA 2XEXA 3CSKA 5CQGA 5D3GA 2B5JB 4O3QA 2I0XA 1HPZB 2XY5A 1EETA 3IXQA 4K4VA 4CLSA 3FCWA 1F1BB 5HBMA 2FHOB 1S1VA 4KV8A 4FXDA 2K7KA 3QGGA 4JYAF 1FX2A 3BS9A 4LIWA 2YKMB 3M32B 3PKMA 4OV1A 2MKCA 3G4SS 2Y8YA 1WDDA 1BY9A 2B7BB 3G71S 4TU8A 4RW8A 2ASJA 4TYBA 5ETRA 1S6UA 2CG8A 2QYGA 1FVQA 1LNQA 2VONA 5KG4A 1JMTA 5LMNF 4CLYA 2ADCA 3OJSA 3HI9A 4B3RF 2GHWA 2UXBJ 4U90A 4RWXA 1D9DA 3GONA 4RPFA 1TL7B 2KDOA 1OYEA 4CZCA 4DUZJ 2OP5A 3SSSA 5KG1A 3UR0A 3A3OB 4WP8A 1GT8A 3KHHA 4PR6A 4O3OA 1X4CA 2UVWA 3BSOA 3KMSA 2D3O1 2PEBA 4V1Ak 3G6ES 1UWAA 4OYIA 2ZOGA 5DGBA 2CJKA 3S7RA 1T9VA 4X64J 2FQQB 3H0PA 2ZVSA 4KE5A 2JC0A 4URSA 1NPRA 4EGLA 1SCJB 4ZPWR 4PWDB 4ZVPB 2BJ7A 1YBUA 4NMLA 1RTDA 2ZUGA 4GVBB 4NEYA 4M5GA 3P49B 1NK9A 4ZJLA 5DM7Q 2V94A 3OFHA 3CEDA 4Y6IA 5BYQA 2BABA 2P2CB 2UV8A 4RKUC 3GYGA 1T94A 4HI2A 4N8OA 4UOGA 2VODA 2B56A 4K4WA 1RHMB 3CXCR 3K57A 1HQEA 2UXDJ 5CD4H 3IS9B 3PEJA 4KKOB 3BDPA 2KTQA 4Q0BB 2C42A 2OPPB 4JV5F 1S1XB 1N52B 1HWKA 5A6PA 2R7VA 4GC7A 4R25A 2V2ZA 3DFEA 4L3NA 1R8CA 3OVAA 2ZHAA 5KFQA 2RS2A 2Q66A 4CTAB 2YVSA 5KFNA 2ZE2A 1DFDA 4G1QA 1U0SA 4H4MB 3CJQA 4NCGB 4TQSA 2XY6A 1QY7A 4C8LA 2UUTA 1KONA 2M8HA 3M9MB 2HBYB 2B3TB 2Z0GA 4P7TA 3KTQA 2AX1A 2IBKA 2WONA 2EPIA 3R7NB 1RAHB 5B0DA 2Y1RI 2XI3A 3KUEA 4EMDA 4AT1B 4YP3A 2W9BA 1PGZA 3KLVA 3DLHA 3T1HF 7FD1A 1IBLF 4CT8A 4FF3A 1MG7A 4HLBA 3NY0A 5H1SV 1VQMS 1EAYC 2DHAA 3P8BB 3NGUA 2BJ9A 4DX5A 3IG1B 2AJ1A 2X3LA 5EN1A 1XR6A 3H4BA 2HNZB 4IOCQ 4NLRA 5M2UA 4DSLA 1VCTA 3R5BA 2DHGA 3CCSS 4DR6F 1YWXA 1AUDA 4X4TA 4YHHF 1N0UA 3TUIC 1TK0A 2L9WA 2MZ1A 3ITHB 1VQNS 3MR7A 4EWTA 3MURP 4OZNA 4OJHA 1NEEA 1RWKB 1KQFB 3T6BA 2QL5B 2YQ0A 2QT7A 1URRA 2GJ2A 4A8OA 4I56A 1O5JA 5CABA 4B3TF 3BB5A 5A0YB 1VRQC 5KT5A 3M30A 5AT1B 4JI1F 4CM2A 4LUBA 2RU9A 2ZJPQ 3GWCA 3DM2B 1GEHA 3MM5B 2F4FA 2DNZA 2OGUA 3G8TA 1PJ7A 4Y2KA 3MPVA 2MGZA 2E1AA 1VQ9S 1VQ8S 3GIRA 2OJ3A 5J2QA 4B9TA 4USVA 3RYLA 3CCUS 5I3UA 2V8GA 3V6HA 1IQZA 1VLYA 2VA2A 1ZM9A 2GO8A 2QN6B 5A76A 2QLXA 2I1RA 4I7FA 2KM8B 1GAOA 3OHAA 1JX4A 4DV0J 3LPYA 1TTHB 5LSRA 4C7QA 4DPUA 4USJC 1J5OB 4XPCA 4AL6A 3EUNA 3UI3A 1D0EA 1SL2A 5HQMA 4MIBA 4XO0A 4R5PB 1Q8BA 1T8EA 2C3PA 1KQGB 3CF5Q 1SL1A 2DVIA 5D0GA 2MHEA 2O1PA 3BPDA 2U1AA 2QLBB 3W2VB 1M1HA 3Q8UA 4QQBA 4QIWD 4GC6A 2P5VA 3EWGA 1VMBA 4P2SA 4PXCA 3FBCA 4CLPA 3AT1B 2V68A 3JQJA 4NWBA 2H48B 3PY8A 4OYBA 4IG0A 1RISA 3TVKA 5L39A 3G6XA 3LP0A 4DV3F 1NK6A 2GHVC 3I5AA 5L8RC 2E5JA 3N4WA 4U96A 1R31A 2YBVA 3GB0A 3WHIA 3PR4A 4B3SJ 4YY3F 5DETA 3SV3A 2AQ4A 1RI7A 1GNKA 2OFHX 3MPUB 2VU5A 4ZP8A 3CC7S 4KBIA 1G3OA 4PG7A 2W01A 2G0CA 3RR8A 4PD1A 3KXDA 3E8OA 4LF5F 3DCAA 2XSJA 2WB1D 1YDLA 3GP9A 4QIGA 2CA9A 2CWKA 1X9MA 4O0IA 2VG6B 4ECQA 4Q7AA 5B09A 4A8MP 2BUNA 2HPUA 3KDOA 1HR0J 4CQ1A 2NUHA 4MMOA 3QIPB 3Q2SC 2XYPB 5K14B 3KJVA 3W5XA 1RTHB 2W4PA 3M8PA 4DV4F 4ER8A 2EC2A 3ZTRA 5FDLB 5ERTA 5KFZA 3V6JA 1S1TA 2HNYB 2Q43A 2DK2A 4USWA 2QZ8A 1HI8A 2HFZA 2ZKTA 3DRPB 3GYNA 2J9CA 2MSTA 3NGKA 1N8RT 4X4OA 5FLXU 3KYLA 3HHLB 4DU8A 4I1TA 3I5BA 3Q8SB 4DV7J 3BO2A 4ZN3A 4DR5F 2NPFA 1SH0A 1NPPA 4DS4A 3TA2A 4ZCKA 2DHSA 1J5EJ 3PX0A 4ENOA 5HL7Q 1AW0A 3KK3B 2MJUA 2Y8WA 3QJJA 3DRRA 3DMJB 4X62J 4DQPA 3AH6A 1VRUB 4QWBA 1HNVB 4WP3A 4UQGA 2YX7A 3AJ1A 3JYTA 1EZZB 4UQTA 4KR0B 3AB2B 2ZC3A 4CO2A 1FVSA 3NGDA 2F63A 1Y10A 1MMDA 3FQKA 5EHHA 4IO1A 1S12A 2GQ2A 1RTIA 3LP2B 4RL1A 3LP1A 1R7IA 1QD1A 4HTIA 2CQ1A 2B8PA 2J9EA 4GKJJ 1TKTB 1TL5A 1FKOA 3LTOA 2DNKA 1S9GA 3NS6A 5D4OA 3PRVA 3TEHB 2QC3A 4MK8A 5LSOA 4YB5A 3NL0A 5C25A 1Q79A 4F4AA 4IRKA 5IWAF 2Q1LA 2GJIA 3VQSA 3GJTB 4K7QA 1M1KT 1KTQA 4J9SA 3N9UC 5DDPC 4PG4A 1HQUA 3PYDA 4DV5J 5IT0A 1S99A 2XSFA 1CC7A 4RBVA 2XHWA 2J6SA 5KG7A 4JI7F 2NRSA 1VBYA 4NLVA 3LH2S 4MIWA 2CG4A 3JS9A 2IMWP 2WVEA 4EZ6A 4DSFA 5F8NA 3HZEA 4UF4A 3C15A 2VPXB 2NZ4A 1HI0P 1QSLA 4PUOA 1FRKA 3AOAA 3MAAB 4RNOA 2XS5A 2UU9F 4I6WA 4PWWA 1JXLA 2V6AA 2D69A 3D1HA 3ISND 1UETA 4HHHA 1IWAA 1RT7B 1WEYA 3I4PA 2BQ3A 1VQKS 2W1BA 2ZNYA 4IDKA 4GVLA 1XJWB 1NK7A 2RU3A 1ULRA 4KT0C 4OHWA 1U1NA 4V19J 3C16B 2WOMA 2YH0A 1BD6A 4A4JA 1RXOB 2XB2D 2DGSA 2HBQB 4NASA 3A3NB 3DU5A 4DL2A 2CYYA 3PJXA 4LF8J 3D1OA 4RNFA 3H25A 3OR1A 2NQPA 2PMWA 5RUBA 5ETSA 3CCLS 1NSKL 2M0GB 1WD6A 4JI5F 5EX3A 2ZC4A 3NCRA 1JJ4A 2BE2A 2DNPA 4TYAA 2AJ2A 3JSYA 4ERDA 2VC0A 3K5OA 2WCXA 1HLWA 4WZMA 3HZGA 2ZZMA 1K9MT 2I2YA 4PQUA 2RDJA 4DL0C 4BC9A 3T5HA 4HDHA 4X84A 4JI3J 2YNIA 3BZQA 4RW9A 2JOQA 1SQEA 4LF9J 2CPIA 1TU0B 3QT8A 1E6VA 3PNIA 3ZZRA 4DL6A 4NYPA 4DQSA 1X31C 2DXEA 4F50A 1M1GA 3MEGB 3MCNA 1KQKA 4I2PB 1R27B 1BHNA 3KK2B 1S59A 4LF4J 2I9SA 5G0RA 2DH8A 2WVCA 5IV3A 1PAEX 4OYPA 2QTWA 1FEHA 2UV8G 3SFGA 2CUYA 2VBXA 1XIQA 4W92B 1PJ6A 5HMXA 2QGFB 3HM9A 3BBBA 4E98A 3A12A 3L09A 2ZH2A 1C1CB 1N5YB 2ZBRA 1TL1B 3NS7B 4WFYA 2HNDB 2D3UA 3CE8A 3TAQA 1Q95G 1S48A 3MMBB 2OKQA 4I6YA 2UUBF 2XYGB 2FGCA 5HP1A 3CMQA 2Q79A 1NUEA 1N5TA 3D4JA 1GX6A 1G2EA 3FSYA 3MUTP 4OX8A 4ECVA 2HHQA 1FJGF 5AXNA 2JLGA 1T05B 4C6AA 1K0TA 3GIIA 4LVOP 2C2MB 3KLEA 2DR7A 2ZH9A 4RW4A 3TOQA 2HURA 1YJWS 1FI4A 1YJ7A 1T3EA 4ZPAA 4F04B 3DOLA 4DUYF 3POTB 5KFPA 3EM1A 2CJXB 2A10A 3DOKB 4JI8J 1C0TB 1H7XA 3LOUA 2ZM6F 1MROA 5IOLA 2DPJA 3GILA 1MN9A 3SFUA 2NRPA 2MB0B 2AGPA 1P9QC 1M5KC 1UPMB 3C6TB 5T7LA 3J7A1 1U6ZA 4DBQA 2GNKA 1ZH5A 1CJKB 4NLTA 2VPYB 2D1CA 4C0HA 2HGLA 2DPIA 1X7VA 5KT3A 1V6HA 2A6MA 1LKZA 2OAUA 4I6AA 3HSZA 1JLEA 4F25A 3VQTA 4DQQA 4QPTA 2X1AA 3B4MA 3ZZUA 2PN6A 2AYBA 3T6JA 2WW8A 1Z2ZA 1KNZA 3DYAB 2LA6A 3R2DJ 4RW6A 2XQCA 4DQRA 1F6TA 1IKWB 5MAOA 1HBMA 2RKIB 4LSLA 1L3UA 2EI5A 3RB3A 3QMQA 5E33A 1JQGA 5GADI 4NLDA 1YJRA 2BE7D 2YPZA 3ET6B 1KC8T 1RHKB 3HKZD 5BR8F 4ZHRA 1LWFB 3FNNA 1Q16B 1NSQA 1NU4A 3BYRA 1U0HA 2AWZA 3M6WA 2RHQB 3PTWA 2XGQA 5AXKA 1OJ4A 2HBZB 5C24B 3MMAB 3QFHA 2XMAA 1NB2A 4GO7X 1I6JA 2COLA 4G1IA 3Q8VA 1RT1A 2DT9A 1T9XA 1TZ0A 3IMQJ 3MMCA 5DGAA 5HLFA 3CGIA 2FYXA 1RBAA 5HQ8A 3HVTB 3V6DB 1Q8KA 4ITSA 2HLTA 1G8RA 2PGCA 2ILYA 2VKRA 1TK5A 3FRZA 2ZZTA 3MFIA 2KFYA 4I69A 2QEXS 5I42A 2W9CA 4U67Q 3ENQA 1UFKA 3DLLQ 1UEVA 1VRTA 2XMUA 1HKAA 2RDIA 5JVHQ 3QGHA 1YIJS 4ZCIA 5EX0A 3RRGA 4ZPTR 4RZRA 3SZ2A 4ID5A 1QSSA 5ETMA 3CJRA 3CJ4A 4KC5A 3RBDA 3I0SA 3F41A 4J90A 3UE2A 5J2NA 1JLFA 4USIA 4NOHA 3MHYA 1HA1A 4NPOA 2NQRA 4OYOA 2ALZA 1R43A 1UA1A 2XY7A 4WKYA 1B7YB 1T95A 1RCOB 5C42B 2K2PA 3KWMA 1VI7A 3T41A 4UZBA 2J0WA 3CCTA 5D4NA 3PDNA 3JSMB 1OO0B 2XS7A 3N01A 1X4FA 2YWFA 1WF2A 2MPUA 4AYBD 3V4IA 2QMXA 4M5DA 2HHPA 3KLIA 4P7VA 2EKNA 5F8HA 1PYTA 4ECRA 3EPIA 5F3ZA 3TA1A 4ED8A 1UJ4A 1S9EA 2ZD1B 2FJBB 4ZPVR 4AUKA 2J0QD 3HFZB 2Q6BA 1MWZA 1YBTA 3OR2B 3L95X 1HBUB 2Z2ZA 2V9WA 3M6VA 4TY9A 1C0UB 1RWVB 1O6XA 1TAQA 2R9LA 2FJXA 3EE3A 3CCES 2VPWB 2OELA 2ZH5A 1B4SA 1ZAVA 2DTJA 4M5LA 1HNIA 3J81U 2AZ3A 2ZUAA 3W2WB 1WF0A 1RADB 2VJVA 5IXUA 4LFCJ 3M6UA 1APSA 1Y7PA 1ZPWX 4RUCA 2E1PA 2FTRA 3C2PA 2LDIA 5L1JA 1HHSA 3KK1A 1EQMA 4GKKJ 1K47A 3DLGB 2JFDA 2V67A 2VBWA 3UO0A 3UDEA 2QLFB 3CW2C 1HBNB 2YKPA 2CVEA 5G2SA 2XNQA 2CJYB 1CJTA 1DJ0A 1YI2S 3GIKA 4ED4A 3FMWA 1IJFB 1V9OA 2CRLA 4FF2A 1PCAA 2DO0A 2DGOA 1BC6A 4ZVOB 4DFPA 5ERUA 3R1HA 2HBRB 1Z2LA 4HHUA 2WSFC 4P6QA 4F3QA 2DNMA 3QAEA 3LWLA 3PJWA 1SI9A 1X5TA 1FDNA 5DM6Q 3EDQB 4LF2A 5F41A 3HHLD 3M2UA 2AGQA 1SH3A 1JLCB 3LALA 3IC1A 2OPQB 4B3MF 2MZRA 3MCMA 3JTPA 2BJEA 1RUSA 2HVHA 1QE1B 1SUQB 2KG0A 2Z2MA 2HS4A 4NXMJ 1N0VC 2FHJD 2FJVA 3QGIA 4RNHA 1S76D 1AZSB 5ETKA 3TR5A 3K5PA 2FZGB 2QMWA 1OWXA 2FTSA 3G9CA 5D0HA 3V81B 5IM0A 3D7SB 1KFSA 1KWMA 4OQJA 1K8AT 1CULB 4N5SA 4PYAA 1FK9A 1MLAA 2AMCB 2F4VF 1FDAA 2P9GA 3OJUA 1IBMJ 1SV5A 1NB7A 4O3RA 3UN3A 5HQLA 4B9LA 3C46A 4UOCA 4PG8A 4F2RA 2L9DA 2FVPA 4MTPA 4DR1J 1QJHA 2G2OA 1VC0A 3MTJA 3SCIE 2F8EX 4G65A 1XMBA 2IRXA 4W4MA 1DLOB 4LREA 2AD9A 3FUYA 2CQ3A 4YMEA 5EDWA 5CXTA 2MQOA 2PC6A 3G2XA 3CUNA 1CSJA 1BWEA 2E5HA 4OYMA 2RT3A 1U45A 2PFFB 3MM8A 4C3MA 2HHUA 4QU7A 1B3TA 3QJPA 2VG5B 3QWUA 4X4NA 2LYVA 5J2MB 1J2VA 1D8ZA 1MU2B 3G87A 3V4MA 2DIUA 2VF3A 3PCOB 4CLFA 2QA2A 5I3PA 1DQ8A 3VAIA 4WE1B 1FE0A 2Y1IA 1Q7LB 1LEOA 4JV0A 2VL1A 2RF2A 5HROA 4O4RA 4KIAA 3CD7A 2Y3YA 4OI1A 3QT5A 3J80Y 2IYGA 4TKTA 2BW2A 4FVCA 5A8RA 1Y0HA 4NCBA 1HWJA 2BRLA 4Q44A 2HVEA 3FK4A 5HVFA 1HARA 1BGXT 1MNEA 3NCPA 4YDDB 2KH9A 5GAHI 3LANA 4OZ2A 1W26A 3PW0A 2IRYA 3M1VB 1CJUB 4H54A 2W2NP 4R8UB 5CA5A 4QWCA 3ISNC 3R5AA 1EP4B 2MTLA 3RW7A 3A1YG 4DI6A 1S7IA 1U09A 4O4GA 3IBWA 1WOSA 4O23A 4OYAA 4LQ3A 4QCLA 2XLJA 2F8HA 3MOZA 3KMQA 3TZZA 1FKPB 3MEDB 3H42A 3PKYA 4USHA 3HHEA 2KG1A 5LSLA 5K20B 1DHMA 1N5SA 4HI1A 4PZVA 1NDPA 3M8WA 1CVJA 2DNRA 4L3KA 4JI6F 1SJRA 5DG7A 1U02A 1K73T 1FNOA 5JVGQ 3F56A 1CJVA 2C3YA 3UVJB 3PACA 2JX2A 3JAMY 4WZQA 4YB1P 2C2DA 2JSXA 4J9VA 4NXNF 2H5JB 3C6UB 3X3UA 3KHLA 1T9YA 1S1WA 3ONQA 4JBCA 1KHVA 4ZN1A 2YTCA 1NAQA 4JB8B 4WTYA 2YNGA 3M2RB 4CH1A 4JI4J 3DHWC 3QLHB 2YKOA 2K1RB 1SC6A 1HQMD 1TFWA 3LF0A 1Y3KA 2HZAA 2HK2A 2MKJA 1H3DA 2OUGA 3D54A 2E5GA 3R6LB 4CLLA 4HH0A 2KRRA 3FFIB 3FEYB 1HWIA 1T03A 1F3VA 4ECZA 2PO4A 1XMOF 3MAHA 1N32F 1NO8A 1CEZA 2Y1JA 2FU3A 2G0IA 4FNHA 1HYSA 2M2BA 3TA0A 2XBPA 1FJ7A 3NCQA 4HEA9 4N56A 1VK3A 3N6MA 3BH6B 1D1UA 1I94J 2HHHF 5LJ3Y 5HBMB 4ZIVA 2DKOB 2IAJA 2JEJA 2WTFA 3EGZA 2B43A 4ECTA 1RACB 3I0RA 3BGRB 1SIZA 3OTDA 1DTQA 1FRJA 1XQIA 2XM3A 1URNA 4ZVRB 1JLBB 3CCRS 1Q86T 4HACB 2QL9B 3NOCA 4IQMA 3P45B 1QVGR 2L3MA 1D8YA 2YH1A 1LW0A 2DR6A 2YWGA 3Q2TC 4DSJA 1HI1A 2GIRA 2GVDA 1RYRA 4BLGA 2HAIA 5CD4A 2QV6A 4KHPF 4KY3A 3PX6A 1HPZA 2OFGX 2V0NA 2DH7A 3G6VA 3T1YJ 2DRAA 2BA9A 1NDLA 5LM7E 5DJBA 1C1BB 4IQXA 2VQFF 3W3SA 2EVZA 1I3OB 2RRBA 1VR6A 2E9TA 3CDUA 5L1KA 4DR4F 1X0PA 4NMXA 1VOMA 7FDRA 4TLQA 5KFLA 2JEFA 3BM7A 1FRMA 2WHOA 4F4WA 3M32A 3IRXB 4FYDA 3TUJC 2VB6A 3SCJE 4TU9A 3BSNA 3VVTA 4Y3CA 1HNXF 3B6BA 5FD1A 3EYZA 1FFGB 2MMYA 4X4RA 5C5JA 2N4CA 4CO3A 3OW2R 2VFTA 2V5HG 4IH6A 3C19A 5GMKa 1YVFA 1N34J 4Y0FA 5HJYA 2E7XA 2FD2A 4TNOA 4OV6A 2KT5A 4PQAA 1HIYA 2OD6A 3BH7B 2CJAA 1VS3A 3AQPA 2WW4A 3T1AA 4PAAA 1N33J 2ROEA 1G4CA 3RAQA 2VHGA 4DSIA 1YJVA 3DLKA 3P5BP 4X4QA 1YRXA 3ZFVA 2F65A 4C8MA 3VTIA 2XI2A 3DLJA 2ZH3A 4JI2F 3D9BA 4K4TA 3PZPA 2UUAJ 3X1LB 4EFAC 1NNDA 3HXMA 3KLHB 1F9EB 3R7BB 1AYEA 2E5LJ 2KL8A 1TQLA 4PWDA 3VALA 2CQ4A 2VUGA 4M5IA 1I6VD 1VQLS 5KFTA 1UW9A 3PW7A 3M05A 5F8LA 5AXLA 2YX1A 1LK5A 3BEGB 5ETOA 4BWMA 4DUTA 2XTJP 3UR3C 2XS2A 2GGPB 2PD1A 5EWGA 1GXUA 1IVZA 1WI8A 2MSSA 5KT7A 4F36A 1VQSA 2FB0A 3ZZPA 4USMA 2KJVA 1L3VA 3EZOA 3R97A 3IS9A 2GFFA 3P96A 4ILLA 2YKNA 3JQKA 3TJ8A 4U91A 2Z4PA 1F9FA 2KM8C 3CJ3A 1ZS6A 4Q0BA 2OPPA 3D3CJ 1S1XA 1KQSR 1DTTA 2RMLA 4DSEA 3CO9A 2NSBA 1VQOS 1YHQS 3AD7C 5ETPA 2ROGA 1TL3A 1V3ZA 3FSXA 4CTAA 2ZHOA 3WQPA 2DGVA 2KT2A 4H4MA 2KKHA 2IYIA 5A8WA 4NCGA 1TELA 2CPXA 4KAIA 1CQMA 3BO3A 4J9NA 4OX9J 2CNKB 3TZXA 4MFBA 1G7CB 2RE1A 3CNQP 2B8QA 2VG7B 3A13A 2EK1A 4PPZA 3UWTA 3L3CA 1F2GA 1NZ8A 1TL4A 1ZETA 2CNLB 4DV2J 3PW2A 3M30B 3MCOA 2BOPA 2W8KA 2B51A 2OTLS 3GV8B 3UCGA 1BQXA 2V4RA 4HT7A 3KLGB 3PIPQ 4I67A 3IG1A 2NPIA 4WU2A 4C48A 4C98A 1R6VA 2MGZB 2FUG9 2WZ1A 4ECWA 5J2QB 4LF7F 4C11A 5HANA 2MKSA 3CDAA 1TMMA 3HMJG 1X4HA 2K8GA 3W60A 2JHEA 1RWXB 3Q8RB 1HWUA 2QIFA 2ALYB 4U95A 2BQRA 2CDQA 1VQPS 2XMMA 4V19X 1GMUA 2X7IA 5A0YA 4IH5A 2MDAA 1F9HA 1VBZA 1HNWJ 1GTHA 2MKKA 2H3EB 4USTA 4B9SA 2P9EA 4LF6J 1GMWD 1HFEL 1BQMA 1RA7A 1RHRB 4KRWA 3P4UB 2MJNA 2C22A 3H98A 2IM0A 3DM2A 4OJ1A 1YG0A 1LK7A 2A18A 4QU6A 2JLEA 3T9ZA 2LQ5A 2ERRA 3CD0A 3M6XA 5GADU 1A9NB 3FBBA 2OO4A 1NDKA 2E66A 2IVYA 2ASYA 5KOXA 2IVFB 4ED0A 3PO5A 4M94A 2B4VA 2BKOA 3HT0A 1R0AB 3EDRB 2BANA 4WTOB 4NZ6A 5KFOA 3W62A 1Y9OA 2CXEA 1JK9B 2FLLA 4KQZA 4XTTA 2GQCA 5HMWA 5KT2A 4QBUA 3W7BA 5L1IA 4K2JA 2ZFHA 1TVRB 1VGYA 1UZDA 1YITS 5D4LA 2CVIA 1RT3B 5KG2A 3I32A 1J5OA 2LVWA 3HHLC 1UFLA 4R5PA 3EX7B 4JYAJ 4FN5A 1NLKL 3CTRA 3US5A 5AJ3F 2OSQA 3OFFA 4TXSA 4ILRA 1QAJA 1RJJA 4DS5A 3OL8A 2DNLA 3QZ8A 3I4HX 5H9FK 4QIEA 2DEJA 4ICLB 4PABA 4C97A 1GQEA 4RUHA 3HKWA 4KGZB 5LMNJ 4DPXA 2XSJB 1QTMA 3CD6S 2ZEJA 4B3RJ 1NH7A 3B4DA 2ATCB 1QAIA 3D0GE 4IOBA 5KG5A 3NRBA 1NXIA 3EVOA 2IFXA 1L5UA 4DDFA 4LR7A 3R9LA 1H38A 4A8QA 5IT9Y 4ZLJA 2P8IA 3VZHA 3KNGA 3VGUA 1S10A 1ZM2A 4G1PA 5DDOC 5I3QA 2QA1A 3UN2A 3M8PB 4IH7A 2DNNA 3G8QA 1RSCA 4DU7A 4AL5A 2ZHBA 2DXFA 4C8ZA 1UFWA 3SBMA 3CCZA 3N5BA 1X9SA 4Q2LA 4F8RA 3TARA 4NRTA 4KHRA 3UDLA 2E7VA 3O3LA 3C14A 2GVZB 3EPGA 2VG6A 4DL7A 3F73A 3QZ7A 4HHJA 1TFYA 1V5VA 4WKRA 3I56S 2I8EA 3D0IE 3DRSB 2QSWA 1S57A 2L41A 2DBBA 2MQMA 2R8KA 1AT1B 2RHSB 1WOOA 3B8HA 3QRRA 2EK6A 1SBRA 3FGVA 1WELA 2MZTA 3GE9A 3EVMA 3TJ9A 4DOZA 3UCZP 4JOUA 2LXIA 1M90T 2I5JB 2GX8A 3JYTB 1JLAB 3EJMA 4QR1A 1X0FA 2LA4A 4LSNA 5CYQB 1NRKA 1B7FA 2G13A 2RRNA 4OX7A 3IWNC 5SZTA 2HNYA 4NZ0A 2XO7A 3KJQB 4JV5J 3FDSA 2H65B 3CC4S 1REVB 5E0OA 1N5QA 1RTIB 2PMHA 2HQGA 2KU7A 3IA0A 3LP1B 3GLJA 3EZUA 1PBAA 2L48A 4MKAA 4G3IA 4ES2A 4FBTA 1IKVB 2EW9A 4F3OA 2UXCF 3BSCA 1S9GB 4NA1A 1GXTA 4GO5X 2N7YA 1KFDA 1VLOA 2EKYA 1Q4RA 1KLMB 2MZJA 4QJVA 1U25A 3RRKA 2WVBA 5C25B 3UDVA 5GVQA 2B6AB 1HNVA 4J9OA 2D3OR 4LBIA 1FA0A 2O01C 1VYAA 2W7PA 5H9FJ 2AIRB 4KSEB 3LA0A 2RDDA 3W5YA 3CC2S 3T1HJ 3MM7B 5H9EK 2BKPA 1XMQF 3FMBA 2YQ1A 1IBLJ 1HQUB 4CP5A 4P2MA 2X3GA 1TP7A 4PG6A 1VC6A 3CCWA 2RAQA 1RU2A 3LP2A 2PI5A 4K5SA 3UDCA 2DISA 3MR3A 2YPYA 5KFSA 1TKZB 5HATA 1ZTWA 3W9JA 1MMNA 1NKCA 1TKTA 2IIHA 2DNYA 4DR6J 3NAIA 1HMVB 1U49A 4YHHJ 3C15B 3ZZYA 4M8LA 3J7YI 4RU2A 3I96A 3TWZA 4KGKA 3FKBA 5HK4A 1FWKA 1NJIT 3ULHA 2R42A 2JEGA 3FVYA 1TV6B 3UNYA 1H2TZ 1FDBA 2W9AA 1WSVA 4ZJQA 4B3TJ 2NR0A 3D67A 1U4BA 2V50A 1FE4A 2NQUA 4LRCA 3MTKA 3DLEB 2J9DA 4JI1J 4Y2MA 4ECUA 3P3DA 2IRUA 1WSRA 3IM8A 5F8IA 2MY7A 1EQ0A 1HBOB 3FCHA 2HLUA 1Q81T 3K58A 4CLTA 3VAGA 3QAUA 2XYHB 2PT0A 1T3NA 3H5SA 3IO1A 3ILLA 4N8NA 3OR1B 1RTJB 1HW8A 3LWMA 1Q53A 1L3KA 3B82A 2C2EA 2F1FA 3ILOA 5ETTA 3MGJA 2XG8A 4BCAA 2NQMA 3HLUA 4OX6A 2OPRA 4WFBQ 1RT7A 1ZYQA 4ID8A 4DF8A 3V5RA 3BPSP 3ETOA 5F3TA 2IA0A 1M5SA 3LAKA 2CJBA 2AZ1A 2XMTA 4WIIA 4LFBF 1M0SA 3C16A 1Z4UA 4TK1A 3MM9A 3AD9C 2I6WA 2H1YA 2DR9A 2BYCA 2UUWA 3OQ2A 4LJMA 4CH0S 1YGYA 4NLYA 2E9RX 2IY5B 2WVDA 1LWCB 2FVQA 1U1OA 1IUJA 1LW2A 2IDEA 3SCLE 1U8SA 4WBFA 2V34A 3KG1A 4X65F 2FY1A 3K59A 3W61A 4KH1B 1XN9A 1RCXB 4DV3J 2FZKB 1S1UA 2YNHA 6FDRA 4O3SA 3OLBA 1PKUA 4H4KC 1YK9A 5GAHU 1FDDA 4NRUA 2CPHA 1RLDA 2Y1LB 2ROPA 3MWBA 4FXVA 1JLQB 2RRAA 2ACMA 1M5HA 3DHXA 3PJ9A 3DOMB 2DYAA 4YEAA 5HAOA 1OPIA 4YY3J 1GFWB 4JI0F 2CQDA 1U47A 5FJ4A 2WBRA 3IBFB 5KFDA 2HMIA 1KP6A 2Q3PA 3Q22A 4OHXA 3R5JB 3SV4A 1NCLA 3C8YA 1S0OA 2IVMA 2OPSA 4J5OA 1WTFA 3MEGA 3CJ2A 2LLZA 3OSNA 2HYIB 4B3OB 4K4SA 1CC8A 2ZZNA 1YRUA 2MLXA 3BGUA 5M2RA 3ENAA 4LF5J 3KK2A 3BN7A 2R2RA 2G4BA 3R8YA 3MEKA 1RE1B 3D3BJ 3K8WA 2C2RA 4C8OA 1S97A 1VK8A 1ZM3A 3SCKE 3W64A 1JNRB 1FWLA 3GQCA 2DHXA 4C0BA 4CLWA 3H90A 3KLEB 5HMYA 5CAAA 3MF5A 4L6V3 4DR7F 4DPOA 2O66A 1C1CA 1T02A 3JSRA 1KD1T 1R0CB 5ETNA 2GC8A 1TL1A 2HNDA 2J7WA 3QYYA 4DV4J 3MMBA 1MROB 2CZVC 2V9KA 5KFJA 3MM6A 3TQEA 1YJTA 5T7LB 1BQNB 3ICLA 4KHMA 2KXFA 5KAKA 2HHTA 2E7WA 4YQWA 3NNHA 2R7UA 5C7PA 3OTCA 6AT1B 3LPEA 5E5NA 4I4BA 4J9PA 1RHUB 4DR5J 1WUUA 2KZMA 1FCAA 3HX9A 4C0OC 3EXYA 1JLEB 4ETXA 3K17A 2H4YB 3M9NB 2K06A 1Y5NB 3MAQA 4YOEA 1YSJA 3PFEA 2HVIA 3POTA 3A3PB 2K7JA 4RW6B 1C0TA 5F8MA 3BQ1A 4LSLB 1NHUA 1NJYA 3BF4A 3HULA 2EWHA 4J9MA 2I38A 1UVIA 3MECB 2GV1A 2BJ3A 1K0VA 3KJFB 5HJXA 1XNQF 4HL9A 1CJKA 1K1SA 4ECSA 2DRBA 2NQKA 3OV7A 4B9NA 4K4UA 2OI2A 4IYQA 2IPOB 3TW0A 1RT2B 1U2CA 4HT5A 2ASDA 1U0HB 1VIXA 3KUGA 2K3KA 5DO2A 4R0JA 2MKIA 2XZDB 5I4MA 3Q8PB 3QQCD 4RUAA 2ZNZA 4MKBA 2FPHX 4ZPBA 2BV3A 1WG5A 3BQ0A 1Y4ZB 2NQSA 3TJAA 3I9V9 2R8HA 3ZZZA 3GV5B 3IGNA 1IKWA 5IWAJ 2RKIA 2XMKA 1L3TA 4WJBA 3H8YA 4NLXA 4C3KA 1S77D 5DZ6A 1W7WA 5IZHA 1OSCA 5LMUF 3CJ0A 1S79A 5I42B 3HVWA 3ET6A 1HWLA 3NG8A 2HG4A 1NK0A 5K9FA 4JI7J 2EFQA 1SC1B 3Q83A 2V2KA 1SL0A 1VRTB 4LRBA 1LWFA 1QAYA 4CDIA 4Y2CA 3ISZA 3TNVA 4YR2A 5E3RA 4ID5B 5HVGA 2NSCA 1TUGB 2QFIA 3I0SB 3MMAA 2AW0A 5IQQA 2MZQA 5J2NB 3V2UC 2BACA 2UU9J 1NJZA 4MIAA 3ZNJ1 2IJNA 3D68A 3HVTA 3JTOA 3ZO7A 4I2QB 1V3RA 4EZ9A 2RSQA 2ZWPA 3MPDA 5F0WA 2LP4A 1WHXA 1AXQA 4ZITA 2DGUA 3SXLA 4ELVA 1WHVA 5KFMA 1UCNA 1RT6B 1FESA 3FBFA 4DZDA 3AODA 3GJRB 2ZDPA 3EXCX 3OUYB 1ZM4A 1ZOTA 4TY8A 3O8WA 1S0VA 3BGOP 1RKIA 3CJTA 4CLZA 2GJFA 3D66A 1E6YB 2CQPA 3GU0A 4H4OB 4YR3A 1RHJB 3TVZA 1S6PB 2CQGA 4N47A 4JI5J 4F4YA 4NA3A 4X4UA 3UD5A 1FD2A 2M7SA 4OLOA 4OI2A 5K8OA 1HNIB 4TU7A 5C42A 1X5PA 4F7VA 2IJFA 4FYXB 1XBWA 1RT4B 4CWBA 3JSMA 3TZWA 4ECXA 3MD3A 5J2PB 3TUPA 2VQEF 4IG3B 4MJKA 1R0BG 1UZHA 4K4XA 2IDLA 2IM1A 4ZMMA 3OTEA 1P9YA 1EARA 1SC4B 2ZD1A 3OR2A 1V5IB 1HBUA 3I82A 4IR9A 3BBCA 2CQBA 4MAKA 4Y28C 3K2YA 2XHCA 1C0UA 3SQGB 3EVWA 4P74A 1ZPVA 3BKTA 3S01A 3SQOP 5MLCV 4DJBA 4QPXA 2OEKA 2DNHA 8RUCA 4XDCA 3RRHA 5BYSA 1YZ7A 2IHR1 3FEXB 4MYTA 4IRCA 3M2UB 1U1MA 3W2WA 4FS1A 3LAMA 1YRTA 2MQQA 5L1LA 1YLXA 1SC3B 3BREA 5A8KA 2KZZA 3MEEB 4HH1A 2DD8S 3CD5A 3VR1A 2BM1A 4FBUA 3FSIA 3RAMA 4AXJA 1FXLA 2WK4A 4EEYA 2KB2A 1WNEA 3OHBA 3CCQS 2UUBJ 5IC4B 2BBEA 2HHSA 2H54B 4EBDA 2XULA 2RJZA 4OJGA 2B9YA 2JLFA 2EBEA 5KFGA 1ZTTA 3D28A 2JC1A 3MR5A 3HCXA 1KTVA 1RA6A 5A2QY 4ZVTB 2OEMA 4A8WA 3DDIA 4ZLNA 3RUBL 3CDWA 4L72B 5IFMA 1MWQA 5ERVA 3QSIA 1FJGJ 2Y0BB 1Q5VA 4NX9A 2MXYA 1FRIA 2JL9A 2DNOA 2G1HA 1Q1KA 1JLCA 1FKAF 1FK9B 1OPZA 2O67A 2OPQA 4OZJA 1F60B 4DUYJ 1SV5B 3HP6A 1QE1A 3VAKA 1SUQA 2QRRA 3R5CA 4QYZK 3J80U 1UWBA 3TEGA 1GX5A 1R8HA 2ZM6J 4X2BA 3PRBA 2LCWA 5KFVA 1AZSA 3BDEA 4EK2A 1KVIA 2KJWA 2KO1A 2DNGA 2BW7A 3PG9A 1T9UA 2D9PA 5GAGI 4NA2A 4RR5A 4ZCMA 3CB4A 4ED1A 3V81A 4BS2A 1T11A 2M52A 2HAFA 1CULA 4UY85 1UTAA 2FY8A 3U27A 2W7OA 1OYDA 3LGMA 1JIHA 4WP9A 1UVKA 2Z56B 1OY8A 2R7WA 4OI6A 3SIPB 3Q23A 4D3HA 3N6LA 1FNXH 2GAGC 4ZKAA 3IP0A 3GFZA 2OMLA 3RBEA 3SMZA 3Q86A 2V8PA 1FERA 2WB4A 1RWOB 1XEZA 4KH0B 5T41A 2MQLA 2YX4A 5JUMA 2B4UA 1R8PA 2DCUB 2HQDA 2RF2B 5HROB 1DLOA 2HFNA 3O5TB 4RW7B 4QWDA 1C4CA 1I51B 1UEUA 1QSYA 3KKFA 3JAMU 1T7PA 4IKAA 5BR8J 2YWWA 4CNYA 3DRXA 1X5OA 5D78A 2ZVIA 3CJ5A 3M4XA 4LVNP 2G0JA 2FDNA 2EBGA 2OMOA 3HK2A 1SIWB 2KYZA 1X4AA 1UZ5A 1JLGB 3NGRA 3A4TA 4UW2A 1B0TA 2D74B 2VG5A 5DZ7A 4L76A 5J2MA 1EJ7L 3DGPB 2AEFA 4DN9A 4ES3A 4XPEA 4KFBB 3K8VA 2CADA 4YUDA 3DRYA 4WE1A 4DV1F 4DMZA 2ADBA 1TKDA 3VHQA 2LU1A 2UVVA 1SJ3P 3K89A 3OPKA 1HNZF 2CPZA 2PA8D 4FKXA 1D9AA 4ED2A 1MN7A 1RBOB 2XMJA 4K0KF 3C3LA 2CPYA 3MD1A 3ZTSA 3W1YC 1XWLA 2AX0A 4FP9A 3M1VA 3DC2A 1CJUA 2UUCF 4QYZJ 4R8UA 2HWTA 4B9UA 3DNCA 1S1WB 3WX8A 1WEXA 2YNGB 5B0CA 1EP4A 4FPIA 5CHCB 4LBPA 2UP1A 2H51B 4DEZA 4ZP6A 5IQ6A 1FKPA 4AL7A 2VA3A 2L9NA 3MPWA 4OI4A 4X4VA 2CPJA 1Q8IA 4J37A 3ZTOA 4YS2A 4DR3F 2KFZA 2HQFA 1FF2A 3CT9A 2B4PA 5LL6d 5K8MA 4F4ZA 3UVJA 4ZK7M 1HYSB 2XC9A 3TX0A 3QBCA 3T5KA 2HSEB 3FZBA 4X66F 3M2RA 4RNNA 1N5VA 1NSPA 1U26A 3QLHA 3ETMA 4AQYF 1DQAA 3H2LA 3PVXA 2BJ1A 1H98A 2ZJRQ 3I0RB 3OTOF 2ZDOA 2N3LA 4Y65A 2G9OA 2FVRA 1IWGA 5KFCA 2R7QA 3K7RA 2Z57B 1LW0B 3CDBA 2ZBPA 4DFKA 5GAEI 3FFIA 1CS4B 2G1DA 4F3MA 3FEZA 4CM0A 4Z7CA 2BX6A 2NXUA 3SSRA 1U48A 3EGWB 1S6QA 5HN0A 3S8SA 1HHTP 3Q8YA 2NXJA 3ZTQA 4LFAF 1T9TA 4IFYB 3M8QB 1BMQB 5IS2A 1VHIA 3J7YU 1RWUA 4FF4A 5L9XA 5KTQA 2B9WA 3W65A 3RJMB 2DO4A 2ZOMA 4USUA 3TVYA 4DPTA 1XNRF 1IBKF 4TQRA 4B3MJ 1EX8A 3BGRA 3WBZA 1UKUA 2C2NA 2LQBA 3RB0A 1HQ2A 2QL7B 2DEIA 1JLBA 4QIVA 3FRYA 3PIOQ 4HACA 3I6PA 4A8YA 3H40A 2OIHA 3VF0B 1R8BA 4ANDA 5C2CA 1X9WA 1X4GA 4RNMA 3ENWA 2F40A 1EKRA 1PBUA 1HD0A 1XR7A 3TUZC 2PSZA 3GJSB 3FJ2A 1FXRA 1J27A 2R2SA 2OHDA 8ATCB 3H20A 2ZH1A 2MZSA 1JXVA 2BMBA 1C1BA 3NP5A 3NGSA 1FT8A 2ZBQA 1BLUA 2V63A 4K5RA 1ITPA 5GMDA 2F5GA 1DURA 1AA1B 3N79A 4PPDA 5HSPA 4M5KA 3RZAA 2F4VJ 1TKXB 3NKYA 3M2VB 3DLKB 5ERQA 1RAFB 4QR2A 3IRXA 4PXBA 4DV6F 1JKHB 4ZVEA 5KFXA 4I68A 3G82A 4DL4A 4HTJA 3I55S 5DRKA 2U2FA 5B08A 5E3QA 3BGLA 2HRYA 4QW8A 2AHOB 2V69A 3R1LA 5KFBA 4BBYA 2R4FA 3W9IA 4RBTA 3RGIA 1GK8A 1RAEB 1TUVA 2FVSA 3DDKA 1MSWD 4MYUA 4K2XA 2O3DA 4DN0A 3FC9A 3TP2A 3D0HE 3HJVA 4NLGA 3NS5A 2V8HA 2HHVA 2VC1A 4UUWA 2LEPA 4M1KA 4NCAA 4CO1A 4ED5A 2YKNB 3NMAA 3R5DA 3IR7B 2CPFA 4JV2A 3KLHA 1XERA 2FVCA 1DTTB 4YN3B 1Q5YA 4K4YA 2GZOA 3GFXA 1FC5A 1DRZA 3OXLA 1TL3B 1Y11A 1OQ3A 2XWYA 2AKWB 3M7VA 5A8WB 2OH2A 2IM2A 1WC1A 3TAMB 1Y5IB 4BDPA 2GGPA 5J1EB 3KG0A 4MFBB 2VOPA 2DGXA 4DR2F 4F2SA 3E01B 4P52A 2X1FA 5D8HB 2CKWA 3RR7A 3VV2B 2AJFE 4IFVB 2NS1B 3QRPA 3FQLA 2J0XA 1N36F 3JQMA 2KVIA 1LWEB 3CO0P 4WIQA 4DFJA 2YKAA 3DXSX 2L08A 2H5EA 3RBXA 4JV1A 4NLUA 2HRUA 3D1QA 2R3VA 2C3MA 4JI6J 2R7TA 4OZ1A 2GMHA 2QMUB 4OHVA 3AA9A 4C11B 3TZYA 4FNIA 2E1CA 1DQ9A 2H5IB 4FKYA 2CIMA 3OXFA 3GTYX 2R7XA 2VG7A 3MUMP 4QZVB 1B99A 2W4CA 9ATCB 4NXNJ 4O0NA 3E3XA 3CJKA 3L9ZA 1UP1A 2IC3B 4OZ0A 4CYUA 4WFAQ 4Y2IA 1QTNB 2DCLA 4M5NA 4UUXA 2KXHA 3GPAA 3OTBA 4L74A 3SSQA 3GFYA 2NREA 3I5CA 3UN5A 5T14A 2XMWA 2V4JB 1W25A 1WKLA 3LO3A 1BQMB 3SDEB 4RO0A 3KLGA 3QSYB 3W63A 4A8XA 4ATNA 1JNZB 2LFVA 3RAXA 3KLFA 4IO9Q 3ZNUA 1FTCA 1C4AA 1WWHA 1YZ6A 5ADZA 2RIJA 3DI6B 2NXCA 1XMOJ 1N32J 4NI2B 2DITA 2B0GA 2BANB 4A8KA 1Y5LB 2AT1B 4HKQA 5E3AA 1TUWA 1JB0C 3D6MB 3VAFA 5IT9U 2DGQA 2GMJA 3OLAA 4DL3A 2EFGA 4DG1B 4CO5A 1F0XA 1X4EA 4OIXA 2HHHJ 1CPZA 5CYMB 2NXNA 4DPWA 2GS8A 2NROA 3Q0AA 2H9ZA 2RNEA 2C3UA 4CRJA 3QT6A 2AF6A 4EI2A 1OIAA 3QO9B 1IM4A 2UXBF 3G8SA 4R0EA 3KUHA 1RGVA 2EG1A 3KNAA 1S49A 4C2MA 5HVHA 3A8EA 2YNFB 1HW9A 4OHYA 3OSPA 3H5XA 1UMJA 2JEIA 4KPCA 2EFVA 4DUZF 3TRGA 3LW5C 2RB7A 1R0AA 2MEWA 3NMRA 2BE9B 2F7VA 1S72S 4KHPJ 5DDRC 3HSDA 1RU1A 1IKXA 4XK8C 1TVRA 2VQFJ 5KT6A 2QSFA 5DQGA 1ICEB 1RT3A 5ERSA 1RYSA 5E3PA 4IR1A 3MI7X 4NLWA 1YJUA 4X64F 4DR4J 5AE3A 2DB1A 4ZPCA 3CCVS 4KO0B 2N4DA 1KOOA 3N5FA 1SKWA 2EC0A 2OD4A 2E5IA 4ZVQB 1HNXJ 1RT5B 4ICLA 2D7SA 4O44B 3SEOA 3THTA 1R6YA 5DQHA 4PCQA 2QX0A 3OXGA 1R3NA 2J76E 3HD2A 5J1PA 1NDCA 3M8RA 2DY9A 2RUGA 5DG8A 1MMLA 1YQHA 5CH7B 2DJWA 3C14B 4DWIA 4RUBA 1U1LA 2CNNB 2HFOA 3G86A 2UXDF 2HQ3A 4DF4A 4ES1A 1U6FA 2R7RA 2FHKA 1HD1A 2BJ8A 4M63A 4U7CA 5LOQA 2UVUA 4M95A 4NLQA 4JI2J 2MLZA 3W8GA 1IBCB 3PYEA 4M5HA 4LSNB 1M5PC 1X4BA 2AV5A 1G1XA 2J8AA 2RUSA 2AGOA 3D6HB 3RW6A 2HWIA 4HVZA 1H72C 4DCOB 4U6PA 4EYIB 3CMAS 3WC0A 4LRDA 4LF1A 1FNMA 2HRTA 2WSEC 2LEAA 3PV8A 4YR0A 2NLWA 2C2OB 4PD0A 7AT1B 2GVZA 2PFDA 1F2HA 3DDNA 1PYOB 4NYZA 4FS2A 2R7SA 5ITHA 3DRSA 2XLIA 4YDXA 4X4SA 4CCHA 5AXMA 3VAMA 3GSIA 1T0TV 1U8WA 3HT3A 3ZTPA 5JMNA 1N4LA 3THPA 4TK4A 3NAHA 4BHQA 4N41A 1V3SA 1IXKA 2I5JA 2ZH8A 4P75A 1JLAA 1FD8A 4GRSA 4ZLLA 2B4OA 4DSKA 5CYQA 4L75A 3HPOA 1KN6A 2X1GA 1P1TA 4A46A 4ZDNA 4PRFA 2V8DA 3OVBA 1IQTA 2IBOA 1YX2A 1REVA 2DY1A 1O0PA 1NBEB 5ETQA 4NZ7A 3F44A 2DGWA 4OLPA 3NBPA 3G96A 4U9RA 1VQ5S 4FVMA 4AXIA 1IKVA 3LUYA 1SJ4P 1RHQB 1KLNA 5KFAA 1JJHA 4J91A 2J9DE 2MQ8A 3AB4B 5G2RA 4N76A 2POKA 4ETZA 3NLCA 1WC4A 1KLMA 3BKFA 5K5MA 4EO6A 4ANEA 1IKYA 3TX8A 2HQIA 2W7AA 2B6AA 5L38A 4O3NA 1FHTA 1AB8A 2EFPA 3BO4A 2MYFA 1IN0A 1RWWB 1NM2A 3MM7A 5KG6A 5EWEA 4LMZA 1X60A 3ILJA 3J7ZT 2HGMA 4QYRA 5GMEA 5KG0A 3L4BC 4K8RA 1RWMB 5D3GB 1TKZA 1FRHA 4IRDA 2QO3A 3NXZA 1EETB 1LWXA 2LMIA 1KVJA 2HIYA 3QATA 4DV0F 1RTZA 4OYXA 1HMVA 4LF7J 5GAGU 2DHHA 5E41A 3DN9A 5C2GA 1VQ4S 1S1VB 4KV8B 3IRWP 3BJYA 2XWXA 1TV6A 2X51A 4P2FA 1IR1A 1FFSB 2OPRB 3BN4A 2ILZA 1N6QA 2B9XA 1FX4A 3DLEA 4RW8B 3QGPA 1QDUB 5AE2A 2IJRA 2LXFA 1U2RA 3AJDA 2NZCA 3PX4A 4PG5A 1HBOA 1NHVA 3MM9B 4AE5A 4IOAQ 2CWXA 3QRQA 2B5JA 4P10A 1FEEA 1RABB 4CO4A 4QOTA 4U7UK 5B0BA 4AFFA 2W2MP 3ZZOA 2K3IA 2A6OA 1RTJA 2Z2YB 1FFWB 1OY9A 3R7SB 1Q0NA 4F0HA 1LW2B 4HR2A 4B3SF 2YKMA 5LJ5Y 1WG1A 2KT3A 3Q89A 4PYDA 1S1UB 2YNHB 2E1MC 2VD3A 2VPZB 4B08A 4WCEQ 4P71A 3CPWR 2IMOA 2Z58B 5AJ3J 3EZ5A 3THVA 3K5MA 2HK3A 2JH3A 2HMIB 2Z30B 2XZTB 1RTDB 2Z2LA 2ZH7A 3I31A 2NYHA 4UTGA 2E1RA 1RB0A 2XCPA 4J7CA 2VFVA 4I0WA 5KG3A 5KFKA 2OPSB 1LOUA 1TL7A 1IR2A 2HWHA 2BVZA 1LWCA 3HFKA 4DQIA 3N6NA 3M8ZA 2LU2A 4JP8A 2RQMA 5JXSA 1HR0F 1KRPA 4LIRA 2E44A 3MMJA 4EUVA 2BQUA 1HQEB 3ZC4A 3CULA 2BR0A 2YY3A 2P6TA 1KEKA 5F0UA 4ANCA 1SJFA 1JLQA 4LSZB 3DOMA 1Q7YT 4C8KA 3PXGa 2H4WB 1S9FA 1RAAB 3L7OA 5CZXA 1NMEB 2ZE2B 4DV7F 2MLYA 4G1QB 4GVBA 4WYLA 3OL9A 1A0OB 2PI4A 3MM6B 2HFSA 2LQ9A 3OD2A 4B3OA 1Q82T 1G8LA 5FIIA 2FC8A 4DL5A 1J5EF 4EYHB 3MPYA 3WC2A 2CZ9A 1EKSA 2QLJB 3Q24A 2FLNA 4M5MA 4X62F 2J7UA 1WDTA 5F8GA 2IA6A 2JNJA 1WC0A 2WONB 1U1QA 5KFRA 4L73A 5BJRA 4OJ3A 4KKOA 4ILMA 1OQ6A 2W9BB 1QUPA 4B17A 3SI8A 2FZCB 2CQHA 3VZIA 2RS8A 2GCFA 2CDRB 3ADAC 2J7KA 3JSBA 3GV7B 1SKRA 4USKA 5L46A 1KR4A 3DGVA 4GKJF 3AY0A 1MW7A 2PIIA 1H74A 1W2IA 2GAHC 1BQNA 2YKQA 3GMGA 3WZ0A 2EEYA 2PMZD 2JJ4D 3PYGA 5GAEU 2HW3A 2YQ3A 4A47A 3VGVA 4E0DA 4YB6A 4FXWA 4DCJB 1LV5A 2UXCJ 4ED3A 1NSAA 1C2PA 4OZ3A 2MQPA 4PWUA 3BR8A 3OFEA 1WKKA 3EMTA 4DV5F 3TO8A 2XZWA 3J81j 2GQQA 1SJ1A 2DH9A 2KHDA 1SB6A 3H4DA 2HNZA 1XMQJ 3MECA 1GXLA 3PHEA 1NK5A 1DAXA 3AXKA 3PYFA 2AYGA 5I3UB 4DLEA 3ITHA 1RBLA 4MK9A 4DX6A 5B7WA 4ZVHA 1YJNS 3R2CJ 5KFEA 5EWFA 3N0VA 4B9VA 2ZH6A 5THWA 3TYTA 1IW7D 4I7FB 3OBIA 4E2FB 3W8PA 3D2WA 1RT2A 3GG0A 1YTYA 1UVMA 3TANA 2Q6CA 2LECA 2EFOA 4KTQA 5D77A 5CCMA 5CYJA 4S0MA 1KKHA 3MM5A 3TAPA 2VOOA 2M3DA 3AQOA 1NH8A 2J8SA 1PC4A 1LFWA 1GMVA 1I5OB 3DLBA 4KJIA 2F8MA 4EBEA 2DIVA 3HO1A 2ZH4A 4LF8F 2OTJS 1FRLA 2HS0A 2DNQA 3GCWP 1NKEA 5B0FA 3IN5A 2FC9A 3T19A 4IG0B 3MZIA 4O3PA 2W4DA 3HD1A 3LP0B 4TY8B 3R5GA 4OFZA 1U6BA 3D5MA 3DKDA 3CDEA 1U1KA 1X5SA 2MKHA 2MY8A 2VBYA 4C4WA 4OYWA 1UL3A 4W90B 3MDFA 1S0NA 2XCAA 1S4EA 3PR5B 4RJVA 4YFUA 4ZS6A 4JI3F 1OSDA 1CLFA 2WRMA 4DZ6A 3R3TA 4LF9F 3VVUA 2NQNA 4ZJOA 3W2VA 4G6VB 3KDNA 1X8DA 2CJQA 4I2QA 2WBMA 2KVQE 3H2UB 1O51A 4LFBJ 2LQ8A 3KG4A 2BJDA 3GCXP 3GYXB 4ECYA 4PXDA 5DQIA 1TMJA 4LF4F 1RT6A 4EU0A 2FJAB 5A2QU 1UAWA 3OUYA 1UJ6A 1QUVA 5D0EA 4ZP9A 4CI0B 1E6YA 3W9HA 5F9LA 4H4OA 2ZJQQ 2ZKUA 1B0VA 1S6PA 3RB6A 3CJSA 4X65J 3SYZA 1RWNB 1VHFA 2LXUA 5KFFA 4B9MA 3O2IA 4Y34A 3KJVB 3GIMA 3BSAA 4QIFA 4LRAA 5SUHA 1VC5A 1FJEB 1RT4A 4ED7A 2OLWA 5BXIA 2KXNB 4RBUA 2J5AA 1S1TB 3O1LA 2X1BA 5J2PA 5A8KB 2F9DA 1TAUA 4JI0J 3FZ2A 4IG3A 4URGA 2LDYA 1N88A 4FYWB 3T5LA 2RQ4A 4OI3A 5DLGA 2E29A 4DX7A 1BWVA 2OEJA 4CLUA 4FZVA 3SQGA 4HDGA 4XDDA 4Z37A 3DRRB 1WC5A 3AOCA 1RLCL 1RKJA 3QIPA 4JI8F 1VDHA 4OZ5A 5K14A 2W2QP 1RTHA 4K4ZA 4ED6A 5FDLA 2V8VA 4QWAA 2FGOA 4N7TA 2KFNA 3W5ZA 3A8IA 3MEEA 2VKZG 4DR7J 2HHWA 1EB0A 3DRPA 2HGNA 1K44A 1UWBB 3KOAA 3HHLA 5D0RA 2XO6A 3CCJS 1D3WA 3PO4A 2W24A 5ETVA 3A8KA 2YWKA 1FKOB 1XK8A 2XMVA 3CIZA 3EGNA 2IM3A 1ELOA 2J6UA 3PFOA 3C66A 4OZLA 2CQ2A 3KK3A 3R6GB 2KYXA 3PEHA 2A0FB 3VCDA 1LQ9A 5E3CA 3DMJA 3AXMA 3ZZTA 5DLFA 1VRUA 2FHJA 3B78A 1EHWA 3GIJA 2SXLA 3UW1A 1CG2A 4WFZA 3HF5A 1YJ9S 1S4FA 1T9WA 2GW8A 1WHYA 1VQ6S 1JXEA 2NYIA 5D15A 3B54A 2EXUA 3IBCB 4Q5VA 2VJUA 1QLNA 5EUHA 2C28A 3S6EA 3WIUA 1Q78A 4WFNQ 2AU0A 4FF1A 4ZVSB 1XNQJ 3T3FA 4PUOB 5FLXY 1SQGA 4MK7A 1S7HA 3CVKA 3D6TB 2NUUG 3MFHA 2DGTA 3WIVA 1UW4A 1VISA 3PHTA 4MH8A 3IGVA 3NNCA 3M8YA 3CJ8A 3HHNB 1KDNA 3RG6A 1RAOA 2ZOFA 2M8DB 1ZZNA 4NE9C 3ENVA 5KFWA 4IDKB 1WJ9A 2CQIA 5JJBA 1SH2A 1WOPA 4ELUA 2JFKA 5LXRA 3IAS9 1UA0A 2WOMB 4MKYA 3NOGA 1RAIB 1TR0A 2M5YA 4ZVFA 1FWPA 3D6FB 2FJEB 1U24A 5F8JA 3AFGA 2CQCA 5CCLA 2RQKA 5LMUJ 4ZPDA 3NWGA 1WACA 2CAJA 2ZBIA 4KGXB 2GO9A 3NWRA 4A8FA 4RW7A 3MAAA 4K50A 3GR1A 1MWYA 3MUVP 1SXLA 3IAM9 2FHMA 4U8VA 2VFSA 1QVFR 2RD5C 4J9QA 2QJ3A 2BE2B 3J7AN 3PRDA 2P6SA 2B9EA 2R7OA 2FLPA 5K8NA 2FIUA 1JLGA 3HHDA 4AD6A 3H2VE 4WU3A 2AYEA 4A8SA 4PQUB 1VIOA 1WF1A 2BOAA 1WC3A 3HSGA 2PEHA 2YNIB 3RBZA 1UEKA 3DGPA 4MT1A 4RW9B 4KFBA 2CNOB 1E6VB 4PXEA 5B0GA 3E51A 2GHPA 2AEJA 5EGYA 2G2YA 2QA4S 4C9DA 3RTVA 2ACYA 1NPKA 2LKZA 3QJLA 2D41A 1U1RA 4OMFG 5G0RB 1AUSL 1YBAA 1Y3JA 1AFJA 1R89A 3UNGC 4N77A 4YB7A 1NJWA 5H9EJ 2HS3A 1GTEA 3N28A 3GZ7A 4LRFA 1WTBA 4RWWA 2KI2A 4LFCF 2NQQA 2CPEA 2HHXA 4OYZA 2EFNA 2N3OA 2DR8A 2G2ZA 1WORA 4GKKF 1IM6A 2F3JA 2AJ4A 3VAJA 1FTRA 1RDRA 3QPIA 4JUZA 4KGVB 2HKEA 1XTZA 4P2XA 4I2PA 5HP1B 2Y9HA 2VQEJ 4CH7A 4DPYA 4ALZA 3QNWB 1YKWA 3VGSA 4WFXA 3QT7A 3UPFA 2R8GA 4F4KA 1Q8LA 2BRKA 4WPAA 2BZ2A 4ELTA 2HFVA 3P5TL 3KHRA 2C2KB 4RW4B 4ZA1A 4FYVB 1S6QB 2VDIA 1RAGB 3DOLB 4LR9A 1N5YA 1H0HB 3H5UA 3A8JA 2O5DA 2VASA 2BKNA 1XR5A 1TK8A 1W2BR 4NXMF 2W8LA 1PJ5A 1WEZA 4KB7A 1CBKA 3HDSA 3HVAA 3U1NA 2LEBA 2VV5A 1PAUB 4EBCA 3BV8A 1WU2A 1ROFA 4WK3A 1R8AA 2XLKA 3HFVA 1G6BA 3MR6A 2NQVA 2R2TA
chains in the Genus database with same CATH topology
1JXLA 4DFJA 2YKAA 1H38A 3D1HA 3Q8QB 3ISND 1UETA 5D6GA 1PO6A 3DXSX 4A8QA 5IT9Y 1U7LA 2L08A 1RT7B 2H5EA 1T05A 3VZHA 3KNGA 1S10A 1WEYA 3I4PA 1ZM2A 4G1PA 2BQ3A 1SKSA 5DDOC 1PILA 1VQKS 5I3QA 5IT4A 2QA1A 3E2EA 5B0EA 2N82B 1M5OC 4NLUA 4JV1A 3M8PB 2HRUA 4IH7A 4TLRA 2FLOA 3D1QA 2DNNA 2ZNYA 4IDKA 3G8QA 2C3MA 4NYOA 2R7TA 1IBMF 4OZ1A 1NK7A 4F02A 2GMHA 1ULRA 4OHVA 2RU3A 2N7CA 4KT0C 4AL5A 2ZHBA 4OHWA 3AA9A 4ZOSA 1U1NA 4V19J 4TN2A 1B64A 4C8ZA 1UFWA 2WOMA 2YH0A 1BD6A 4IFYA 5A6WA 3M8QA 3CCZA 4C11B 1A7GE 3DOKA 1HBMB 4FNIA 3N5BA 4A4JA 1X9SA 2E1CA 1DQ9A 4Q2LA 2XB2D 4KGMA 4F8RA 2CIMA 3TARA 3OXFA 3G6YA 2R7XA 2VG7A 3MUMP 3MXHP 4DR1F 3DXBA 4QZVB 2W4CA 2DGSA 3U1MA 1T3OA 4NRTA 4KHRA 3DU5A 3UDLA 4DL2A 2CYYA 3O3LA 3PJXA 3E3XA 2QFJA 3CJKA 3EPGA 1UP1A 2VG6A 2IC3B 3S1TA 4DL7A 2J6TA 3D1OA 4OZ0A 3F73A 3C6TA 4RNFA 4WFAQ 3OR1A 3H25A 3QZ7A 4HHJA 2NQPA 2AJQA 4Y2IA 1TFYA 4F67A 2R2UA 4WF9Q 2DCLA 4UUXA 4WKRA 3I56S 2I8EA 2KXHA 2M88A 3D0IE 3DRSB 2QSWA 2M70A 1RP5A 3OTBA 3SSQA 3GFYA 3CCLS 2L41A 2DBBA 2MQMA 1P8GA 2R8KA 1DARA 2NREA 4H4KA 2M0GB 3I5CA 5T14A 4C8NA 2XMWA 3B8HA 4ZHRB 1WD6A 2V4JB 1W25A 3M8SA 2EK6A 4JI5F 3LO3A 5EX3A 1BQMB 2F9JA 2ZC4A 3SDEB 1SBRA 3FGVA 3NCRA 1JJ4A 1WELA 2PE8A 2BE2A 2MZTA 3GE9A 1U2FA 4WK1A 2DNPA 3KLGA 4TYAA 4DOZA 3UCZP 4JOUA 2LXIA 1M90T 2I5JB 2GX8A 4A8XA 3JSYA 3JYTB 4ERDA 1JLAB 2VC0A 4QR1A 4ATNA 3K5OA 3RB4A 1X0FA 4J9KA 1JNZB 2WCXA 2LA4A 4LSNA 5CYQB 1NRKA 3RAXA 1B7FA 2G13A 2RRNA 4WZMA 3HZGA 4OX7A 2ZZMA 3IWNC 1K9MT 6FD1A 5SZTA 2I2YA 2FJWA 3KLFA 1RT1B 4PQUA 1ZAWA 3PW4A 2HNYA 4IO9Q 2RDJA 2A1BA 4NZ0A 2XO7A 1HL6A 4DL0C 4BC9A 3T5HA 3DYAA 4HDHA 1FTCA 3FDSA 1C4AA 1WWHA 3MMCB 4X84A 5HLFB 3CC4S 1REVB 2YNIA 5ADZA 3BZQA 2RIJA 3DI6B 2VBZA 1AROP 5E0OA 1N5QA 1RTIB 4RW9A 5E7OB 2JOQA 1SQEA 1VBXA 3T5JA 2PMHA 2KU7A 2DITA 3IA0A 3LP1B 2B0GA 2BANB 2CPIA 3EZUA 5K8PA 4A8KA 1Y5LB 2L48A 1E6VA 3PNIA 3ZZRA 4MKAA 4DL6A 1TKXA 3M2VA 4HKQA 4G3IA 4NYPA 4DQSA 5E3AA 4F50A 3BQ2A 1JB0C 4ES2A 4QWEA 4FBTA 1IKVB 2EW9A 3MEGB 4F3OA 1KQKA 2W9CB 3VAFA 2DGQA 2GMJA 3OLAA 4DL3A 2EFGA 2UXCF 1JKHA 4I2PB 3BSCA 4CO5A 1S9GB 4DG1B 4NA1A 1F0XA 1X4EA 3GSDA 4OIXA 1R27B 3KK2B 1GXTA 4GO5X 4DFMA 2I9SA 1CPZA 5G0RA 5CYMB 2N7YA 4BWJA 1KFDA 1XC9A 3I9ZA 2EKYA 2GMLA 1Q4RA 1KLMB 4Q43A 2NROA 2DH8A 2H9ZA 3Q0AA 2MZJA 1S6OA 2C3UA 2RNEA 4QJVA 3CMES 1U25A 3RRKA 1NKBA 5C25B 1I1GA 2AF6A 2B6AB 1HNVA 5GVQA 4J9OA 2D3OR 1FXDA 1FA0A 2O01C 2W7PA 4LQ9A 2HVZA 1FEHA 5H9FJ 2UV8G 3SFGA 1DBDA 5C24A 4KSEB 1L3SA 2VBXA 1OIAA 4W92B 3QO9B 1B0PA 5HMXA 1IM4A 3OFGA 2UXBF 3G8SA 1JLFB 4R0EA 3CC2S 2PDAA 1RGVA 3AHPA 2EG1A 1NJXA 3KNAA 3HM9A 3MM7B 1S49A 4C2MA 1XMQF 3FMBA 1HQUB 2X3GA 1TP7A 3A8EA 2YNFB 1HW9A 4PG6A 4E98A 3OSPA 1VC6A 3H5XA 4OHYA 3CCWA 3L09A 1UMJA 3LP2A 2JEIA 2ZH2A 1C1CB 2EFVA 1N5YB 4DUZF 2PI5A 3TRGA 3LW5C 2RB7A 4K5SA 1R0AA 5HI7A 3V6DA 3NMRA 1TL1B 2F7VA 3UDCA 2DISA 4WFYA 1S72S 2HNDB 2D3UA 3MR3A 3CE8A 3TAQA 1S48A 2J0SD 4WXWA 3MMBB 5KFSA 5DDRC 1TKZB 2OKQA 1IKXA 1ZTWA 1MMNA 4I6YA 2UUBF 3JB9k 1NKCA 1TKTA 4RX6A 2FGCA 2MHNA 4XK8C 3J7Z5 1TVRA 4UY8T 2DNYA 3V4IB 3NAIA 1HMVB 2EG2A 4E8UA 5KT6A 5HP1A 1U49A 2QSFA 5DQGA 3ZZYA 4M5DB 4M8LA 3J7YI 3KLIB 4RU2A 4B02A 1RT3A 4CT9A 3I96A 2Q79A 5ERSA 4KGKA 3OVSA 1RYSA 1P27B 1N5TA 3M9OB 5E3PA 4IR1A 3UCUP 1GX6A 3MI7X 4IUFA 4NLWA 2Y0SD 1G2EA 1YJUA 1NJIT 3ULHA 4X64F 2JEGA 3FVYA 5AE3A 2DB1A 3FSYA 1TV6B 4ZPCA 3CCVS 1M5VC 1S9EB 4KO0B 2BXJA 3GG1A 3MUTP 1H2TZ 4OX8A 4ECVA 2HHQA 2N4DA 1FDBA 2W9AA 1FJGF 1KOOA 5AXNA 3UFCX 5HO4A 3N5FA 2JLGA 1SKWA 2NR0A 2EC0A 3AA8A 2OD4A 1T05B 4HYKA 1U4BA 1FE4A 2NQUA 3GFHA 1K0TA 3GIIA 3MTKA 4LVOP 3UQSA 2E5IA 3KLEA 2DR7A 1RT5B 3DLEB 4ICLA 2ZH9A 4RW4A 3TOQA 2D7SA 1YJWS 2J9DA 3JTNA 4O44B 1T3EA 4Y2MA 2VFUA 4ZPAA 4ECUA 3SEOA 3O44A 3THTA 3DOLA 1R6YA 5D4PA 4DUYF 3P3DA 5DQHA 3POTB 3TAMA 2IRUA 5KFPA 4PCQA 5F8IA 2MY7A 3OXGA 1R3NA 2JWNA 2A10A 4JI4F 2J76E 1HBOB 3FCHA 5J1EA 2HLUA 3MR2A 1NZAA 3DOKB 1C0TB 1Q81T 5J1PA 3M8RA 3K58A 2BDPA 2YWHA 1H7XA 3LOUA 3VAGA 2ZM6F 1MROA 2RUGA 3QAUA 5DG8A 1RAJA 2DPJA 1MMLA 1YQHA 5CH7B 3GILA 2PT0A 1T3NA 2DJWA 3H5SA 3OL6A 3E01A 3IO1A 4TK3A 3SFUA 2JZ5A 2NRPA 2KN4A 3CIMA 2AGPA 4N8NA 3CJKB 2MB0B 4A48A 5LXYA 4DWIA 1U1LA 1P9QC 1M5KC 3C6TB 5T7LA 3OR1B 3J7A1 3KK1B 1RTJB 1LFPA 1U6ZA 4IFVA 2HFOA 3G86A 4DBQA 3OL7A 4Q8FA 1K1QA 2GNKA 2HQ3A 2UXDF 5B0AA 1HW8A 3P6YC 1ZH5A 1S0MA 3LWMA 4DF4A 1XI8A 1Q53A 1L3KA 3B82A 3U7JA 4ES1A 2C2EA 4NLTA 2F1FA 3QWPA 4K59A 2VPYB 2D1CA 4C0HA 1LWEA 2HGLA 2DPIA 3MGJA 2XG8A 1U6FA 4BCAA 2R7RA 4OL8A 1X7VA 2NQMA 3HLUA 4OX6A 5KOWA 5KT3A 1V6HA 1ZZFA 2OPRA 5J1NA 1SJQA 2CJ9A 4NL5A 2FHKA 4WFBQ 1HD1A 1LKZA 2OAUA 4I6AA 1JLEA 1NK8A 4M63A 4U7CA 4F25A 1RT7A 1ZYQA 3VQTA 2UVUA 4ID8A 4DF8A 3V5RA 4M95A 4NLQA 5KFUA 1WI6A 3ETOA 5F3TA 2IA0A 2QYCA 2RQCA 4DQQA 1LXJA 4PKDB 4QPTA 1M5SA 4LSNB 3LAKA 2X1AA 2CJBA 1M5PC 3B4MA 3HJFA 1X4BA 2AV5A 2XMTA 2J8AA 4QR0A 3ZZUA 2R8JA 1G1XA 3KLFB 2PN6A 4WIIA 4LFBF 1M0SA 2AYBA 3T6JA 2AGOA 2PA3A 2WW8A 1Z2ZA 3RW6A 2HWIA 3DYAB 1Z4UA 2LA6A 3IWLA 4HVZA 1I94F 1KNZA 4TK1A 4RW6A 2KHCA 4DQRA 3MM9A 4U6PA 1IKWB 5MAOA 4EYIB 3CMAS 1HBMA 3WC0A 1JJ2R 2RKIB 4LSLA 1L3UA 2EI5A 2APOA 1FNMA 2WSEC 3RB3A 3QMQA 2LEAA 1LWEB 5KT4A 5E33A 3PV8A 5GADI 4NLDA 1PSDA 3CWJA 4YR0A 3TQ1A 1U1PA 2DR9A 2NLWA 2ZITA 2BYCA 4PD0A 2UUWA 4ZVGA 1YJRA 1Z1ZA 3OQ2A 1CQNA 4LJMA 4CH0S 1YGYA 2IC3A 2M9KA 5F9NA 1VFJA 3DDNA 3IFEA 4Z2XA 2WAQD 1H6KX 4NYZA 4FS2A 2R7SA 5ITHA 4NLYA 2E9RX 2VFRA 3DRSA 2XLIA 1KC8T 4CO0A 1UVLA 1LWCB 3DLGA 4YDXA 2FVQA 3RU0A 2ABYA 3HHKA 1U1OA 4KPYA 4X4SA 2A2CA 3HKZD 5BR8F 4CCHA 1IUJA 5AXMA 5KFYA 4CNZA 3VAMA 4ZHRA 1LW2A 1VJWA 2V4JA 1LWFB 3FNNA 1Q16B 3SCLE 1U8SA 1NU4A 2UZAA 3HT3A 3KG1A 1HBNA 3SDEA 4X65F 2FY1A 3LGNA 3K59A 1N4LA 2YWEA 3THPA 4TK4A 1XN9A 3NAHA 4BHQA 2AWZA 3M6WA 2UVRA 1UVJA 1KOHA 2XGQA 4N41A 5AXKA 1V3SA 3U1LA 1IXKA 2I5JA 2ZH8A 5C24B 1KHWA 1S1UA 2YNHA 3IWXA 5ERRA 3MMAB 1JLAA 1O8BA 1FD8A 6FDRA 4RU9A 4O3SA 1X4DA 3OLBA 2B4OA 2MQPA 5IM0B 4H4KC 5CYQA 5GAHU 4DSKA 1FDDA 4GO7X 3HPOA 1KN6A 4NRUA 1WG4A 1I6JA 2X1GA 1P1TA 3GR0A 2CPHA 3BR9A 4ZDNA 2COLA 2JDJA 4G1IA 4A46A 1KSPA 2ROPA 3MWBA 3T1YF 4PRFA 1RT1A 2DT9A 2V8DA 1JLQB 4FXVA 3PW5A 3OVBA 1IQTA 2RRAA 3BGFA 2IBOA 1M5HA 2JVRA 4F4XA 3DHXA 1TZ0A 3MMCA 4XAKA 5DGAA 5HLFA 1REVA 3CGIA 4XIUA 4YEAA 4EO8A 1OPIA 1O0PA 3DI6A 4JI0F 2CQDA 1U47A 5FJ4A 2WBRA 4NZ7A 1N56A 5KFDA 5HQ8A 3F44A 4NLSA 2DGWA 3HVTB 2Q3PA 2HMIA 4OLPA 3Q22A 4OHXA 3V6DB 4J9RA 3NBPA 3G96A 3SV4A 2XNRA 3DU6A 3WDOA 4ITSA 3HVRA 4DHVA 2HLTA 4U9RA 1G8RA 2PGCA 3C8YA 1P6TA 2ILYA 2VKRA 1TK5A 3FRZA 2JVOA 2IVMA 2KFYA 3MFIA 1S0OA 3AAWB 4FVMA 1IKXB 5DG9A 4AXIA 2OPSA 4I69A 4J5OA 1IKVA 3LUYA 3H5YA 1WTFA 3MEGA 1SJ4P 3CJ2A 2QEXS 2LLZA 1KLNA 5I42A 3OSNA 5KFAA 1JJHA 2W9CA 2HYIB 2J9DE 1CC8A 4B3OB 1FRXA 3AB4B 4U67Q 3ENQA 4Q45A 2ZZNA 4K4SA 5G2RA 1YRUA 4N76A 4DG1A 3DLLQ 3BGUA 4GMKA 2POKA 5M2RA 4ETZA 3J81Y 2XGPA 3NLCA 3KK2A 3BN7A 2R2RA 5CYMA 1UEVA 2G4BA 1KLMA 4OHZA 1VRTA 2XMUA 2RDIA 5JVHQ 3QGHA 5K5MA 1YIJS 3MEKA 4EO6A 4ZCIA 5EX0A 3RRGA 4ZPTR 4RZRA 3SZ2A 2JRSA 1IKYA 3K8WA 2D9OA 2C2RA 1H2UX 3TX8A 4C8OA 2HQIA 1H7WA 2B6AA 2W7AA 4ID5A 1S97A 1VK8A 4WYWA 4ZCLA 1ZM3A 3SCKE 1QSSA 5L38A 3CJ4A 4KC5A 3RBDA 3MOJB 1JNRB 3I0SA 4O3NA 5E2QA 3GQCA 2DHXA 3QO9A 3AJ2A 4C0BA 3F41A 3UE2A 2EFPA 1RQ0A 3BO4A 1FHTA 1N34F 2MYFA 5J2NA 1JLFA 1IN0A 2MQNA 4USIA 1FJCA 3KLEB 4NOHA 3MM7A 5HMYA 3MHYA 1HA1A 5KG6A 4NPOA 5EWEA 3MF5A 4LMZA 2NQRA 2YNFA 4L6V3 2ALZA 1R43A 1LXNA 1UA1A 4DR7F 2XY7A 4DPOA 2O66A 4WKYA 2RVJA 4DLGA 1C1CA 2RH3A 1N33F 1T02A 3J7ZT 3JSRA 1KD1T 3LQVA 1T95A 5M2PA 2HGMA 4QYRA 2K2PA 3KWMA 1VI7A 1VQYA 1TL1A 2GC8A 5KG0A 5C42B 3NNAA 3K0JA 3MM8B 2HNDA 2J7WA 3QIDA 4WXOA 5D3GB 1QAXA 3QYYA 2J0WA 3CCTA 1MROB 3MMBA 5D4NA 1TKZA 4Y00A 1FRHA 4IRDA 2QO3A 2CZVC 3PDNA 1QM9A 3JSMB 2V4QA 1OO0B 2V9KA 2XS7A 1EETB 1F5BA 3N01A 3MM6A 5KFJA 2LMIA 1KVJA 1X4FA 2YWFA 1WF2A 2MPUA 1YJTA 4DV0F 1P1LA 4AYBD 3V4IA 2QMXA 1HMVA 2ASLA 1VQ7S 5T7LB 1BQNB 2QE5A 4M5DA 3ICLA 4KHMA 2KXFA 5GAGU 5E41A 2HHPA 3KLIA 5KAKA 3DN9A 2HHTA 4P7VA 2E7WA 4YQWA 3NNHA 2UUAF 1VQ4S 1S1VB 4KV8B 5F8HA 4ECRA 3IRWP 3BJYA 2R7UA 1OS5A 1KS2A 2XWXA 3OTCA 3EPIA 5E5NA 5F3ZA 4NLPA 1TV6A 2X51A 2A3JA 4I4BA 3TA1A 4ED8A 4J9PA 1UJ4A 1S9EA 2GIQA 2ZD1B 4KO0A 2FJBB 2OPRB 2KZMA 4ZPVR 4AUKA 1FCAA 3H59A 3HX9A 2E5LF 2J0QD 4C0OC 2ZBCA 2Q6BA 1MWZA 3EXYA 1JLEB 3OR2B 4ETXA 2DR5A 5DDQC 3L95X 3M9NB 1HBUB 3BN4A 2AJ0A 2V9WA 1Y5NB 2ILZA 2VH7A 3MAQA