5D6GA

Crystal structure of fragment of ribosomal protein p0 in complex with 74nt 23s rna from methanococcus jannaschii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
205
Chain Sequence
b'APWKIEEVKTLKGLIKSKPVVAIVDMMDVPAPQLQEIRDKIRDKVKLRMSRNTLIIRALKEAAEELNNPKLAELANYVERGAAILVTDMNPFKLYKLLEENKSPAPVRGGQIAPCDIKVEKGSTGMPPGPFLGELKSVGIPAAIEKGKIAIKEDKVVVKKGEVVSPKLAAVLDRLGIKPIKVGLNILAVYEDGIIYTPDVLKVDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L10
publication title CRYSTAL STRUCTURE OF FRAGMENT OF RIBOSOMAL PROTEIN P0 IN COMPLEX WITH 74NT 23S RNA FROM METHANOCOCCUS JANNASCHII
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Translation
total genus 31
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d6gA01
3.90.105.20 Alpha Beta Alpha-Beta Complex Molybdopterin biosynthesis moea protein, domain 2 Molybdopterin biosynthesis moea protein, domain 2 5d6gA02
4V19J 5GAHI 4NWBA 1ZAXA 3A1YG 5GADI 3J7Z5 5D8HB 3JSYA 5GAGI 3J7YI 1ZAWA 4UY85 5D6GA 5GAEI 1ZAVA 2QA4G
chains in the Genus database with same CATH superfamily
2HHTA 2AEMA 3JQJA 1RT1B 1RA6A 2V6AA 3KG1A 3P3DA 4UOFA 5HJXA 3VQSA 1WKLA 1DLOB 2V2ZA 4P2XA 4JB8B 3MR6A 1S1UB 2UUCF 2PD1A 2DGQA 1RWWB 1YJ7A 3DN9A 3KLIA 4ED0A 1JLQA 3GU0A 3FFIB 5JVHQ 5KFRA 4FF2A 1B4SA 2M8DB 3HI9A 3FNNA 1VQMS 2VG7A 1HR0F 4USWA 2CNLB 4DR2F 3Q24A 2CQ3A 2HYIB 1O51A 3DU5A 1UTAA 2LLZA 3W63A 1HBOB 4Y34A 3NNAA 1F5CA 3BDEA 4NASA 2DRDA 4LUBA 1HW8A 1IJFB 1F3VA 5HQ8A 2Y3YA 2DKOB 1MG7A 3HT3A 3GFHA 4X4VA 2F8MA 4MFBB 4KY3A 5MAOA 2FJXA 2MQOA 4J9OA 5IWAF 1OWXA 2J7KA 2V4JB 2B43A 2AKWB 4C8NA 4WE1A 1VRUB 1XNQF 2ERRA 3TUJC 2O1PA 3KUHA 4ZN3A 3OL7A 2VFSA 1YHQS 1X7VA 1RE1B 2MYFA 3BDPA 2W2QP 2YKPA 4OIXA 2D3OR 1C1CB 2ZC4A 4ED1A 2V8GA 4ZVGA 4DV5J 1EP4A 3QIDA 1RHMB 4RNNA 2HS0A 2JC0A 3S6EA 1HBMA 2IM1A 1AFJA 1YJ9S 1KONA 4N41A 4BWMA 4EI2A 3IAS9 2ZVSA 2FC9A 4UT4A 4DV6J 2BEFA 4MK8A 5MLCV 1QTNB 3KKFA 1NJYA 4E8UA 3C15B 4RNHA 2LQ9A 3IG1A 3MEDB 2XMUA 2MLYA 3DRRA 1KHVA 5A8RB 4B3RJ 1WNEA 1VIXA 4FS2A 1QE1B 2WSEC 2DPIA 4JI6J 2GNKA 3CCVS 3V81A 2FJDB 2A1BA 5FLXU 3H4BA 3MMAA 3O1LA 2KRBA 2DRAA 1TKTA 2UV8A 1XNRJ 1KQSR 3KUEA 2G13A 1WOOA 4NRTA 1V6HA 4G1PA 4YB6A 2VHGA 3JTNA 3V4IB 4IFYB 1JJCB 2DY1A 1RU1A 4ZPDA 1RT1A 3HD2A 1WC1A 3L3CA 4P72A 4OYMA 2XQCA 1DLOA 4PKDB 2DBBA 1S1UA 3W8GA 4DS4A 2Z56B 3HT0A 1S1TB 2ZWOA 2CJBA 2DXFA 2P9EA 4LVOP 4XTTA 3FFIA 3EWGA 2FHMA 3DRSB 1O0PA 5F8MA 2A6MA 4A8YA 4J9PA 2KVQE 1OJ4A 1KFSA 3PO4A 2GCFA 4H54A 3NWRA 2E66A 2J0XA 4DV5F 4B3TJ 3JSRA 4ERDA 4F26A 4BS2A 3TX8A 3MD1A 4O23A 3A3NB 4YHHJ 2CQGA 3CO9A 3OTOJ 1VQ4S 2PMHA 3TQ1A 2ROGA 2FIUA 3T3FA 3FCVA 2GZOA 2HQIA 3N5FA 4DV6F 1WDDA 1PSDA 4LFAJ 1AT1B 4DQQA 4LJMA 2ZZNA 2XM3A 2WAQD 4DV3J 2BQUA 3VVTA 4MFBA 4ZCMA 4TLQA 2RSQA 2QZ8A 1ACMB 1VC0A 2V4JA 3B4DA 2C28A 1P27B 1VRUA 4B3RF 1KNZA 4YMEA 4XPEA 3ICLA 1AB8A 4JI6F 3BSAA 4UUXA 2CIMA 1KS2A 4B9NA 2EWHA 3SZ2A 3D54A 3GV5B 3UNGC 2HBZB 1OQ6A 1LV5A 3AQOA 1XNRF 1C1CA 4UY8T 4NEZA 4WK1A 4X4PA 4J9UE 1RCOB 2DGOA 2L48A 2ATCB 4OYBA 1P9QC 5KG2A 5FD1A 3VAMA 3OVAA 4NLRA 2X3DA 3C14A 2JWNA 4DV2J 2F40A 4CH0S 2NQPA 4GVBB 4NRUA 3DLJA 5KG6A 3TA1A 3HFZB 3C15A 4IQXA 4C4WA 1WHWA 4P73A 2YNHB 4MIWA 3MEDA 4AUKA 3D0IE 2HS4A 5A8RA 1ZPWX 4LR7A 4M5DB 3N28A 2ZH6A 2W9AA 2M5YA 1XR6A 4HLBA 1QE1A 1LW2B 2B4PA 4DF4A 2ZBQA 5D4PA 4K4VA 2HNYB 4ZIWA 2ZZMA 2OTLS 1RWXB 4K2XA 4G65A 5E41A 2WW8A 3V5RA 5DDRC 4C11B 4B3TF 2MXYA 4O0NA 4M63A 2WOMA 3DI6B 4KE5A 4TYAA 3WHIA 4X64J 1RHKB 4YHHF 2E9RX 1REVB 2P5VA 3MUVP 2L9WA 1SB6A 3OPKA 3OTOF 3H25A 1SV5B 2W4CA 4JV5J 2GIQA 1TL3B 3EXCX 3CO0P 4IFYA 2ZH9A 4NL5A 4LFAF 4DV3F 2VFTA 2Z58B 4B3SJ 3GR0A 4WFNQ 3OXLA 1N48A 2HBYB 1JKHB 4DPWA 4F3MA 1S1TA 1C0UB 2PEHA 2HZAA 3C2PA 4RBTA 1R0CB 3TUIC 5BYRA 3DRSA 3CGIA 3S1TA 5ERVA 1YBTA 1HKAA 3TVYA 1WKKA 4F4XA 2OO4A 1EKRA 4J9MA 2B8PA 3TR5A 1FJEB 4DLEA 2YQ0A 4PQUB 2JOQA 5EWEA 3NKYA 2VDHA 1VBZA 1HNIB 1DQ9A 3UD4P 3QZ8A 4M5GA 3R97A 1NJIT 3H40A 3GYGA 4ED7A 4U95A 1LKZA 2B3TB 4DSIA 1FDAA 9RUBA 3HVRA 5JUMA 4DV2F 2B9XA 1U26A 3MURP 1R7IA 2LVWA 1Y7PA 3NG8A 3W60A 2HHPA 2MQ8A 2XSJB 2RQ4A 1NZ8A 4X4RA 3M6VA 2IYIA 3CJ8A 2KFNA 4PEOA 4C0HA 1Q8KA 1D9FA 2DCLA 3CW2C 5GAEU 1GXTA 2VBWA 1G2EA 1ROFA 2E44A 1OYDA 3RBDA 1WC6A 3CPWR 5DRKA 2BJEA 1SBRA 1OO0B 2W4PA 3ELHA 1R0BG 2IMOA 2BBEA 1X4DA 2J5AA 4J37A 1IR2A 2FGCA 1LNQA 2R8HA 2MHNA 4HEA9 4OZJA 3JS9A 4F50A 3GTYX 3LGNA 1OSDA 4X64F 1UP1A 3JAMU 1NDLA 2UUBJ 2L3MA 3RW7A 4JV5F 2B7CB 3I0SB 2BA9A 2UXBJ 4L72B 5ETRA 3T9ZA 1JNZB 2QSWA 4C8MA 3HJVA 5D0EA 1NHUA 4GVBA 2EFNA 1RP5A 1WD6A 2CYYA 1XI8A 4B3SF 4LSLB 3CNQP 2YNHA 4I68A 1CG2A 1VLYA 3RBEA 2IM0A 1AROP 2DHHA 2R7WA 4M5DA 4B3OB 5B0BA 3MTJA 8RUCA 1LW2A 5KFZA 2CJKA 5KG4A 2YNGB 3QATA 3JSYA 3PJ9A 2B56A 2HNYA 1TFWA 1NU4A 4C8ZA 4U90A 2AJFE 2KO1A 1CSJA 4DR4J 2CQHA 2ZH8A 2BABA 1RZMA 3TJAA 3DI6A 1ZZFA 1DY3A 3Q22A 3H5SA 1UVMA 4A8WA 1FESA 2VBYA 3QFHA 1SV5A 3NGDA 4R8UB 2GFFA 3FVYA 2ZC3A 4EBDA 2R7RA 1KC8T 2IA0A 4F2RA 2O66A 1CC7A 3D4JA 3FC9A 3R5AA 1JKHA 2OPSA 1DTTB 4IR9A 2HNDB 1S9FA 3SMZA 5I4MA 1C0UA 4TU8A 4TXSA 2KT2A 3ILOA 1FE0A 1F3FA 1FX4A 4W4MA 5ETTA 2NQSA 4PQUA 1KQKA 4XIUA 2FY1A 2OTJS 2DGVA 1HNIA 1UVIA 1GEHA 2JL9A 2UUBF 2FPHX 1C0TB 3ENQA 2AGQA 3K17A 2UXBF 4MJKA 1M90T 1HNWF 3BGRB 4K5RA 1RDRA 5LJ3Y 2R7OA 2V68A 4KO0B 2LECA 1H38A 2XSJA 3ZTPA 3OT9A 1AA1B 2OKQA 4U67Q 2VOPA 3AD9C 3NGKA 3EUNA 4ECYA 4PR6A 3DLBA 3DRPB 3ZC4A 1NDPA 1ZZNA 2EFQA 1VJQA 3QAEA 2K8GA 4WP8A 3HPOA 3ZO7A 1R89A 2DNHA 2YH0A 2C2OB 5IS2A 4WYLA 1Q95G 1W2IA 1LWEB 1TKDA 5A0YB 3H2VE 3P6YC 5K8OA 4HI1A 1V3RA 4DR4F 2M52A 2FD2A 2U1AA 2LA4A 5GMEA 2KKHA 3IA0A 3KK1B 2DNPA 3K58A 3SDEB 1PJ7A 1RTIB 3I0SA 3Q0AA 3KG0A 3LH2S 3W61A 4OI2A 1UZDA 3PR4A 3WBZA 4N8NA 1YWXA 1MWZA 3KYLA 4J9LA 2MZQA 2W9BB 3THVA 3BJYA 1VFJA 3IRXB 4F7VA 2Z2LA 3MCOA 4LSLA 4NLYA 2KN4A 2D9OA 4C9DA 3CCLS 2BDPA 1NHVA 3LP1B 2QGFB 4NLUA 2ASLA 1PCAA 4B3OA 5J2PB 4AFFA 4GKKJ 3OTCA 5KFMA 1OIAA 1U1KA 4DPOA 6FD1A 2Z30B 3SCLE 1ZS6A 2YNGA 4HVZA 2ZITA 3HVAA 4YQWA 4OLOA 2IJFA 5BYSA 3UQSA 2BMBA 1JK9B 1UPMB 3NS6A 4KSEB 3RAMA 3HHDA 4R8UA 3BKFA 4DUZJ 4HDGA 4NLDA 5DG9A 1UVNA 2DH8A 3HP6A 1Z4UA 3SFUA 3U02A 4MTPA 1YSJA 1D8ZA 4DX7A 1H3DA 1Q8LA 1EJ7L 3AB2B 4O3QA 2HURA 1DTTA 2L41A 3F0NA 2HIYA 2C2DA 1NBEB 4RNMA 1N88A 3ZTQA 3LGHA 3GIMA 2GMJA 1AFIA 4CWBA 1T8EA 1QSLA 3DNCA 1NH7A 3BM7A 1DRZA 3R27A 5JMNA 4LRCA 1U48A 4QBUA 2CNNB 3D1QA 1C0TA 2HIQA 1TV6B 1UJ5A 2P6SA 5HO4A 1TK8A 2BKOA 3BGRA 2H65B 2OPQB 2DH7A 4KO0A 2AHOB 5IQ6A 1ZBTA 3CJRA 4QJVA 3QAUA 2QL9B 1T9VA 4O4GB 5K9FA 3TANA 2JVOA 3J7YU 2YPYA 5LSLA 1WHXA 3SIPB 3CC7S 3D6MB 4DQIA 5IV4A 1YJUA 4CO5A 1FFSB 4I2QB 4GKKF 1T3NA 3EE3A 2V8PA 1LK5A 3MM9B 2KB2A 3P4UB 3FSIA 5DETA 3SFGA 1KTVA 2XB2D 1GMVA 2V67A 4WXWA 1LWEA 3D7SB 2CQ0A 5A0YA 3LAKA 4RUCA 1B64A 2HGMA 3X3UA 3UDVA 1Q4RA 3UVJA 2POKA 1X8DA 4I6WA 3KK1A 3MPYA 2H4WB 2R3VA 1FRIA 3SDEA 4DXLA 1I3OB 1RTIA 2PE8A 3DCAA 1RABB 3ONQA 2LEBA 4RU9A 4DFKA 1G3OA 3O44A 4JI8J 4DL5A 3DLLQ 1RT6B 4YDXA 4DL6A 4JYAJ 3MMBB 4ZVRB 2W1BA 2W9BA 3WDOA 4I67A 4DPXA 3IRXA 2W01A 4DEZA 3V6DB 3FBFA 1FI4A 5B09A 3FBBA 3J7A1 1XMBA 4WPAA 5HMXA 4DSKA 4QIFA 3W65A 4KHMA 2E5HA 3IBCB 2J9EA 3RAQA 3LP1A 3IBWA 4IFVB 3A12A 1NM2A 5J2PA 5LXRA 1VRTB 4DUYJ 4KTQA 1HW9A 4U7UD 3Q8PB 4P52A 2IBKA 3HX9A 1KQGB 2Z2YB 4IO9Q 2GV1A 4TK3A 5AXNA 1BC6A 4ZLPA 5HI7A 1U1PA 3D6HB 2Z2MA 4QIWD 1N6QB 1GMWA 1OY8A 2UUTA 2MLZA 2UVVA 2QLJB 2HNZB 2PDAA 3SI8A 1LWCB 2XMJA 2DHAA 3OSPA 4DN9A 4O3PA 4KT0C 2HHXA 3FZ2A 2YKAA 2QL7B 1NSAA 4H4MB 2R8GA 3VR1A 5DG8A 4BDPA 3TEGA 2W8LA 1S6QB 1XEZA 2RS2A 4RU2A 5C24B 4NPOA 2HFZA 2H4YB 1UVLA 2PA3A 5KFCA 3GJRB 3TO8A 1NRKA 4LR8A 2GJ2A 5DLGA 1S77D 3G8QA 3OQ2A 2D1CA 4K2JA 1UWBB 4OYAA 1HD0A 1N52B 2EFOA 3PIPQ 4XDDA 1GTEA 3RZAA 3GJQB 3T6BA 3MEGB 2K2PA 1QSSA 3MFHA 1WEXA 4OZLA 2UVUA 5KG5A 1TV6A 3W7BA 3TNVA 1JJ4A 4WKRA 2N4DA 4OZNA 2OPQA 1Y11A 5K20B 4JI8F 3MD3A 1IBCB 3LTOA 1RT7B 4JYAF 3IN5A 4OYXA 3GCWP 4ILRA 3E8OA 3OL9A 1GT8A 2AMCB 1HFEL 1Q82T 3BV8A 2G9OA 1F5AA 4I2QA 4I6AA 2OEMA 3M9MB 3T5JA 2DNKA 3MM9A 4DUYF 3W2VB 2WB1D 1T95A 4K4TA 4L3NA 2Y8WA 3AOBA 3IS9B 4J9SA 1KD1T 4K4ZA 1OS5A 1GTHA 5IT9Y 4RUBA 3DOMB 3ITHB 1YBAA 3RAXA 2J9DE 5L1KA 1VK3A 3UE2A 3E01B 2CZVC 4BBYA 3VAIA 1C4CA 1WC4A 4I7FB 1TUVA 2J9CA 3M4XA 2NRPA 4WKYA 3NOGA 1LW0B 3MMBA 3NS5A 1IKWA 2JLEA 3VZIA 1S12A 3Q86A 4NLTA 3V6DA 3R5DA 3T19A 2PI5A 3R1HA 4RW8B 2RF2B 2ZFHA 3GZ7A 1APSA 3DDKA 2I8EA 5IC6B 4CO2A 4IFVA 2UVRA 1CULA 1YZ7A 1VRTA 4JV0A 3D2WA 4FXVA 1RYRA 2HK3A 1SCJB 4OI1A 4CYUB 2ZHBA 1U8WA 4R0JA 1N6QA 3W5YA 7FD1A 3IM9A 2MKYA 2L08A 1N36J 4TVAB 2G2ZA 1LWCA 3AY0A 2AU0A 2HVIA 1WHVA 1XWLA 3CSKA 3HHLB 1VQSA 1T94A 2KRRA 5ITHA 1WTFA 2V50A 2XI2A 4OFZA 2NSCA 4H4MA 2WSCC 1S6QA 2MQQA 1BE4A 1ZM9A 5C24A 2CPIA 1NK5A 2ABYA 4NLQA 2LFVA 3QIPB 2F4VJ 3GV8B 3HHNB 2CPDA 3KLEB 4CCHA 3MFIA 4ZCLA 4AL5A 1D9AA 1TMMA 2IM2A 3WZ0A 3IRWP 4F4YA 1GK8A 1UWBA 1O6XA 1S79A 2ZOMA 2DR9A 2D9PA 4CH7A 1XR7A 4PWDB 2GHVC 2K06A 2EPIA 2C2KB 3MEGA 4F0KA 4IRCA 4D3GA 2HFVA 1Q53A 4ZOSA 2X1GA 4CLUA 4XPCA 3GB0A 1NK6A 2DXDA 1U49A 5J2MB 4ZN1A 1KR4A 2GX8A 1NPRA 2M8HA 2NXNA 1AUDA 2G1DA 1IXKA 1HBUA 2YPZA 2B8QA 2QYCA 5KG7A 3NWGA 4F25A 4ER8A 3TA0A 2Z8QA 3PW5A 2G0JA 5M2UA 5L1IA 2F7VA 2HKEA 2W4DA 2GJIA 5B7WA 3W2VA 4YB5A 1U1MA 3FRZA 2LP4A 3MGJA 4PG5A 3IS9A 1YJTA 1RT2B 4NZ0A 3Q8SB 2YKMB 3DOMA 2QV6A 3MI7X 4FN5A 4ZJLA 3DXBA 1N36F 3FQLA 3QNWB 3RB0A 2C1EB 2IVMA 2ADCA 2LXIA 3VGUA 5K8MA 3IO1A 2J6SA 4CLPA 1UFWA 2G1HA 2VUGA 2NXJA 2HHWA 2CG4A 4I7FA 1I94J 4LSNA 1VLOA 4NMLA 2HHHJ 1LW0A 4AYBD 3W9HA 5K8NA 3AOAA 3BBCA 1XMOJ 5GADI 2FQQB 4RW8A 5HANA 1TL5A 3J80U 5G2RA 1FNMA 2F4FA 3K5OA 4ANDA 2CQIA 2DHSA 4RKUC 2GQCA 4PRFA 3I56S 2F4VF 3VAHA 4U7CA 4PWWA 2JFDA 3NXZA 4MMOA 5I3QA 3V6HA 2DO4A 3C46A 2EVZA 3AA8A 3NRBA 3RGIA 1K1QA 4CYUA 3K8WA 1GMWD 2GA7A 1F5BA 5ADZA 1KN6A 3QO9B 4ZJQA 2QT7A 1CLFA 4L3KA 4QYZK 3MOZA 1SQGA 1V5IB 3M30A 2YBVA 3P96A 2P8IA 4HACB 2AX1A 2X3GA 3CIMA 3HHLA 5CZVA 3MM8A 4ED5A 4U9RA 3GFXA 2PI4A 5KFBA 3KLHB 1TUWA 3R1LA 5ETKA 1A0OB 4ZVUB 3JSBA 2CPJA 2YX4A 2FLPA 5LMNJ 3JQKA 2ZKTA 5T14A 3QIPA 3TOQA 4ECSA 2QC3A 2M88A 1HA1A 1WSVA 3KLEA 2FJWA 1U0HB 4YB1P 2EK1A 4OX6A 3H5XA 1N34J 3EMTA 4C6AA 1HQUB 4M1KA 2VODA 1I51B 2BJ7A 4PWDA 1VQYA 2OELA 2P6TA 4QPTA 3WC0A 2ROPA 3G2XA 2AYBA 2HFOA 2QA4S 2ZUGA 3M8SA 3EDRB 4NLXA 3DOKA 5EN1A 1YBUA 4FF1A 1LEOA 4CI0B 3X1LB 2FVPA 2JEIA 3OJUA 5J2MA 2IMWP 1E6VB 1NDKA 1KRPA 1BQXA 1I94F 1Y0HA 2HHHF 4NZ7A 4DR1J 1NSKL 3DGVA 5KFEA 3M7VA 1XMOF 4DQRA 1U6ZA 2E29A 4URGA 4N56A 2F9DA 4ED6A 1KVJA 3WQPA 4OZ0A 4JUZA 1TTHB 2HK2A 4MKYA 2OMLA 1SJFA 1B99A 3I9V9 3WIVA 2KT5A 4FYXB 4P75A 5DGBA 4BCAA 5CD4A 5EWFA 1AZSB 2L9NA 1S5ZA 2ROEA 3C3LA 1FXDA 2QTWA 1RT2A 2CXEA 2HQDA 2YWHA 2B51A 5JJBA 4HR2A 1X4AA 2YKMA 3MWBA 3H59A 1JIHA 2U2FA 1SJ4P 4WFZA 3UN2A 3QSIA 4RW7B 2W8KA 2XHCA 3A8IA 4TLRA 1VQPS 3HCXA 3N5BA 3D28A 1RAAB 4M8LA 5D6GA 4EO8A 3GR1A 1R27B 4RBVA 1X4HA 4ZLJA 3OL8A 4NXNJ 4FNHA 5LMNF 1XQIA 2XCPA 3EDQB 3UDCA 4F4AA 3GPAA 1FD8A 1GMUA 3ILLA 1G1XA 3O6QA 3PW4A 1N34F 1NAQA 1QSYA 4PQAA 3CJ3A 4ANEA 1FJ7A 3UFCX 2VC0A 3A8KA 3UPFA 4O3OA 1HQ2A 2RE1A 1WC3A 3GJTB 2I1RA 2XMKA 3QO9A 2P9GA 3IXQA 1K1SA 3P5BP 2Z4PA 2W24A 4HACA 3QWUA 1QVFR 3D0HE 4FXWA 4DR5J 3H20A 2HRYA 2K7JA 4DR3J 5KFPA 4DR1F 2X51A 1VK8A 2IC3B 1WG1A 3KLHA 1S10A 3CMAS 3RRKA 2IJNA 3D9BA 3HHLC 4NA3A 5E2QA 5J1NA 2ZWPA 5ERQA 1S9EB 5H9FJ 2MQNA 1ZAWA 1S57A 3QRQA 1IUJA 4PD1A 4ZP6A 5J1PA 2PA8D 1U0HA 4C8OA 2C3MA 2BV3A 1HI1A 1R0AA 4CZCA 3H90A 5DDOC 3OW2R 1HQUA 2ZEJA 3FRYA 2Q3PA 4C0BA 4P2SA 3MDFA 4P9SA 3FBEA 5D15A 3SBMA 1PJ5A 3RJMB 5C2GA 3LP2B 1IKVB 3KK2B 2KZMA 3LPEA 1E6VA 1RLCL 4X84A 3ZZUA 4ALZA 3H2LA 2NPIA 2BW2A 3MM5B 1UWAA 3M05A 2G0CA 4DZDA 3VALA 3C16B 2CQBA 4C3KA 3UO0A 4NXNF 3C8YA 4OV1A 5G4DA 1RLDA 5GAGU 2AJ4A 4OYWA 2BJ8A 4CM2A 1X5PA 1YI2S 5IT9U 2FY8A 1CJTB 2R2TA 3NGRA 1AZSA 2VDIA 3HF5A 2YWEA 3M8ZA 4NYZA 4F3OA 3G87A 5I42B 1T02A 4PG4A 1FRMA 1S72S 4I6YA 4RW7A 4KGZB 2XYPB 4DR5F 3OSNA 3D3BJ 4DR3F 5IV3A 2VF3A 4ECWA 2KVIA 1JLCB 3G8TA 4PXDA 5KFJA 4ECTA 4ZMMA 2F5GA 5KFKA 4ED8A 2DITA 2ZDOA 2AW0A 1J5OB 4DN0A 2COLA 5ETVA 2CJQA 1KBRA 1SJ3P 1B7YB 1QDUB 5D4OA 1XK8A 4M5HA 2NR0A 3D6TB 3TQEA 2GAHC 1ZOTA 3FJ2A 2V2QA 2DGTA 4P6QA 1R31A 3KMQA 1SH2A 3KDOA 1SXLA 2YX7A 3GFZA 3OFGA 1QJHA 2DR5A 2DH9A 5LSOA 4ICLB 5IQQA 1R6YA 3OTDA 2RQKA 3HHLD 1M5KC 3NNHA 3HD1A 4WU3A 4ZCKA 2APOA 4KGKA 2AJ1A 2X1AA 4DR7J 2MZTA 2BM1A 1JJ2R 2OIHA 2IC3A 1H7WA 4LBIA 4AT1B 2CKWA 2PMWA 5D0RA 4KGMA 5B0CA 1SC1B 4GC7A 4C97A 2XMTA 4WFXA 3L4BC 3LALA 1G4CA 4LBHA 3KK3B 4C8KA 2PEBA 1KEKA 2C3YA 1RAJA 1X5TA 3OUYB 3KLFB 2ZNZA 2QEXS 2IRUA 4Y2CA 3HXMA 2E9ZA 4EGLA 1RXOB 1MNEA 1HBNA 2CA9A 1HI8A 2B4VA 1YRXA 2V5HG 4ELTA 3LP2A 4YS2A 1IKVA 3KK2A 1N33J 5FDLB 2F3JA 1B0VA 2XMMA 4FPRA 3JTOA 3PTWA 3VWSA 2A2DA 2IAJB 3BB5A 2QSFA 3ISNC 3DDIA 2VPYB 3MM5A 1NSPA 2E7XA 4JI3J 2R7QA 1IJEB 3CJ4A 4UUWA 1T0TV 2JJ4D 4DR6J 3CJTA 4EBCA 1RAIB 5IFMA 1K44A 3VV2B 1WI8A 5KOXA 4U8VA 3H8YA 4K4YA 3TWZA 1OY6A 1CJTA 5EX0A 1ZYQA 1H2TZ 1SQFA 2CQDA 4DPYA 3MR2A 5EDWA 1H72C 1AXQA 3B78A 3FEXB 4WP3A 2IFXA 1FFGB 3DOLB 1IWAA 2QLXA 4USTA 1FC5A 4WYWA 5I42A 3AXKA 3PG9A 3TUPA 3IWXA 2H9ZA 3BGLA 4NLWA 2W2MP 5C42B 2V2VA 3DC2A 4RW9B 2G2OA 5D78A 2WZ1A 3POTB 4UTGA 4DR7F 3RB4A 5DZ6A 2A6OA 2BKNA 1QUVA 6FDRA 3MPWA 3OHAA 1JLCA 5HMWA 3IAM9 3BREA 4KR0B 4EZ9A 3MPUB 4XDCA 3B6BA 3U27A 3QPIA 2CJAA 1UW9A 4U6PA 3HHEA 3PYGA 1VQLS 4FF4A 2MY7A 1WELA 1UMJA 4O4RA 1RBOB 2RAQA 2RD5C 1WACA 3I5BA 5C25B 1HWUA 2E5LJ 2H48B 4ICLA 4CNZA 2Q6BA 2ZE2B 1N33F 4Y2KA 3PO5A 3CDBA 3FUYA 2J8SA 3MOJB 3DRYA 3M8WA 1PBAA 4Q43A 2V94A 4KHPJ 2Y1RI 3T5LA 1QAYA 1FTRA 3BKTA 1UA1A 3BGOP 2VBZA 2DTJA 1L3UA 1FF2A 2J6UA 5CQGA 2NXUA 2HSEB 3G71S 4JI3F 2OD6A 3F73A 2FDNA 2Q79A 3T9NA 2HGLA 1RHQB 2FVSA 4V19X 2V9KA 4DR6F 3DLGB 3P45B 2C22A 4W90B 1BWVA 5HVFA 1PJ6A 1NPPA 1P1LA 1XBWA 4IG3B 2RKIB 3KK3A 3MAAA 3NCQA 1WF2A 1KQFB 1RAEB 3BBFA 3K0JA 2IDEA 2M7SA 5KFGA 3SQGB 4DCPB 3A1YG 1S6PB 3KLFA 3PV8A 2JDJA 2QJ3A 3V4MA 2MZSA 4CT9A 3C66A 3LWLA 3M2RB 2IDLA 2WB4A 2DIVA 2FC8A 2GHPA 1M5OC 3NOCA 3ISND 4Q44A 1F2GA 4ZVPB 5FDLA 4J9QA 3UCUP 1D09B 1R6VA 3QQCD 3CIZA 3TZYA 4IDKB 3G9CA 2IAJA 1P9YA 1BUXA 4WFAQ 1RWNB 4M94A 2GMLA 3M8PB 3MAQA 3G82A 5D0HA 1U2CA 2I5JB 1U2RA 4XAKA 3VAKA 2XS5A 2ZBCA 1RWVB 4UW2A 4DL2A 1OPZA 1UEVA 1D3WA 1W26A 1KOOA 2I38A 4HHJA 2NZCA 1A9NB 3J81U 4MKBA 3L9ZA 3UR0A 5KFIA 2DK2A 5F41A 1U6FA 5C5JA 4MKAA 4L75A 1BMQB 4DPUA 2DISA 3I82A 3W9JA 4KHRA 5E7OB 4DZ6A 3TRGA 4TY9A 3DOLA 5KT2A 4I2PB 1TL7B 2VFRA 2E5LF 2W7AA 3BO4A 5D4LA 1U6BA 3CD7A 1UW4A 2AJQA 4RW9A 4KHPF 1YGYA 4LRDA 3POTA 2OEKA 2VL1A 1XN9A 3CD6S 3F41A 1DZ5A 1TK5A 4Y2IA 2DHXA 2Y9HA 2IPOB 2VIHA 2FVRA 2UU9J 4OHVA 3R2DJ 4NOHA 2KYZA 4DWIA 2VH7A 3HO1A 4L74A 4QCLA 1QD1A 4ZVSB 3I9ZA 2EK6A 4DL0C 1U1OA 1LXNA 3MR3A 3CJ2A 5KFSA 5D77A 3NEKA 3H5YA 3VGSA 2XWXA 2OGUA 3PYDA 4LRBA 4IUFA 4Y00A 2HVZA 4R5PB 1NK7A 1RWMB 5LXYA 1UJ6A 1N32J 2DR6A 2NSBA 2Y1LB 1HQEB 5C25A 1RYSA 2A0FB 4C2MA 1UVKA 2XZWA 1MMNA 2R2SA 1UAWA 1JQGA 1KHWA 1S1VB 5GAHI 1Y00A 3HZEA 1X5SA 3D0GE 3KLVA 1KLNA 5DDPC 4WWSA 5BJRA 2C3PA 2G4BA 3T41A 1VDHA 2CPZA 2YY3A 1IKXB 1FK9B 4HI2A 1SC3B 3KDNA 2RRBA 2EXUA 2O5DA 3DLGA 3R6GB 4IG3A 2RKIA 5G0RB 5CXTA 2XYHB 4HDHA 3SQGA 1S6PA 3H7HB 2N82B 5J2QA 2ZBPA 1RAGB 1Z2ZA 4RJVA 3HSJA 3M2RA 2VFUA 3RG6A 2RRAA 2N7YA 1T9XA 5EX3A 3I31A 1HYSA 5BYQA 4PYDA 3R7BB 3CULA 3OFHA 1VRQC 1FRJA 3K5NA 1YRUA 3Q8YA 3UR3C 1ZPVA 1B3TA 1EQ0A 2MJNA 4QWAA 1O5JA 4Y28C 1BHNA 4IDKA 2NQQA 3PFOA 3CMQA 5KFUA 3M8PA 1SKRA 3GFYA 2UU9F 2I5JA 5HN0A 2DNNA 2GHWA 1YIJS 2E7WA 4X4TA 1TKZB 3QMQA 1VR6A 1SKSA 2KFYA 1CS4B 1KTQA 1ZAXA 4O3NA 1NEEA 1WEYA 3SCIE 4QIVA 3NMRA 1N32F 3D6FB 2BR0A 4KKOB 2YH1A 5LM7E 4LRFA 3R8YA 4I2PA 3R7NB 2F8EX 3KNGA 4GO7X 5M2RA 3TAMA 2BJ1A 1VMBA 2MKCA 1G6BA 4ZVEA 2QG9B 2AIRB 2KI2A 3EX7B 3W1YC 2FJVA 5LSRA 2RRNA 2DNMA 3IGNA 4FYYB 2KM8B 4P7TA 4D3HA 1GXUA 1SJRA 2ZKUA 2IVFB 2WSFC 2CVEA 3VGTA 2HW3A 2RDIA 4TKTA 3MCNA 2HQFA 3U1LA 2HRTA 3R3TA 2F9JA 1BY9A 1VS3A 3KHLA 4X4UA 1MWYA 1I1GA 4DX6A 5HROB 1GAOA 4LRAA 1RTZA 3K5MA 3OV7A 2AEJA 4UQGA 1K0VA 1UA0A 2ILYA 2IM3A 2CAJA 1OYEA 2CRLA 3O5TB 4R5PA 2KZZA 4HTIA 5E3PA 3GP9A 4DMZA 2JEGA 2KTQA 2BACA 1HQEA 4ATNA 2ASYA 4U96A 3RU0A 3PY8A 2AYEA 5KT6A 1VI7A 1WKJA 3PKMA 2R9LA 2E5GA 1WTBA 1HBOA 2EKYA 3HFVA 1FRKA 4O0IA 1V3SA 1MLAA 2DCUB 2MQPA 2CNKB 2F8HA 1IKXA 2VB6A 1T03B 1FK9A 4ZP7A 3MPDA 2XSFA 2HHQA 4PCQA 4Z7YA 2ZJRQ 1MMLA 2DY9A 4QW8A 1XJWB 3OVBA 5IXUA 5G0RA 2R4FA 5LMUJ 1MN7A 3ENWA 1EB0A 1Q86T 2BJDA 4H4KA 5KFYA 3WC2A 3NCPA 2OMOA 1N5YB 4MK9A 2ZHAA 4OI4A 4WCEQ 3VAFA 1IBMF 5HSPA 2MZ1A 2ZJPQ 4RW6B 1AYEA 1R8BA 2R8KA 2CJXB 3KNAA 4OZ1A 3K89A 4F4KA 2D3UA 4LIRA 2ZM6J 3TJ8A 2W2PP 3MM7B 1ELOA 3EVWA 4Z2XA 1QAIA 4J91A 3QRPA 4B02A 2DGWA 3HVWA 4CP5A 5DM7Q 3E2EA 1IBKJ 5AE2A 4ZVTB 2FZCB 3PYEA 2WVFA 1GNKA 1S99A 2ALZA 3LA0A 3IM8A 2BQRA 1TKZA 2AT1B 2LDYA 2LYVA 4OZ3A 3CE8A 3DXSX 3DMJB 4V1Ak 4CM0A 1N5SA 3M1VB 3AODA 2NS1B 3VTIA 4ZCIA 3H42A 2XCAA 2K1RB 1S4FA 1VHFA 4KKOA 5GMDA 1FA0A 4JP8A 1FT8A 2H51B 4CLTA 4WJBA 2VPWB 2BJ3A 4WXOA 3CUNA 4DG1B 1KWMA 4ZVFA 1BQMB 2UUWA 3M8RA 3C6UB 3SV4A 1FNOA 2FHJA 3UDEA 3KLGB 2B9EA 4ZPTR 4DI6A 4GVLA 3D68A 4CT8A 5DM6Q 2KT3A 2XEXA 2HHVA 4DV4J 4USUA 1CPZA 3V4IA 4Q8EA 3CJKB 1NJXA 5HROA 1T7PA 5LMUF 2QMWA 2NQUA 1RWUA 7FDRA 4ZITA 2CVIA 4V19J 1FKAF 3TZZA 1BLUA 2DGUA 1FHTA 3BS9A 4IQMA 3TVZA 3QBCA 2WW4A 3MPVA 2GVDB 2R7UA 1PG5B 2C2MB 4UQTA 4MYUA 1FVSA 4G1IA 2ZM6F 2MGZB 1HWLA 2EW9A 5IC4B 4OL8A 2VONA 4TK4A 1NZAA 3TUZC 1QUPA 2XWYA 1RBAA 4YOEA 4NZ6A 1Q8BA 2AYGA 2YKNB 3AT1B 2MPUA 1T03A 3CJQA 3TX0A 2PN6A 1IBKF 4YP3A 3HFKA 1L3KA 4OV6A 5KFTA 1Z1ZA 4O44B 3UDLA 2GIRA 4FBUA 5L1LA 1NKCA 4KFBB 1TUGB 5H9EK 2E7VA 3LO3A 1AW0A 2AZ1A 4A8QA 2JEJA 1T9UA 2AF6A 4FYWB 1N5YA 1PO6A 3I0RB 4PXEA 5B0DA 2OLWA 4LF6J 4A8KA 4Y6IA 4RW6A 2ATLA 3MMJA 4Q2LA 2DNQA 4K8RA 4Q8FA 1T9YA 2QE5A 3AD7C 2RHSB 4OJHA 1JMTA 4DL3A 1CJKB 5L38A 3IWNC 4M5NA 1WOSA 2UXDJ 1XTZA 4LF7J 1UJ4A 1JXLA 1KKHA 3TP2A 3P49B 1R8PA 5LJ5Y 4H4OB 4ILMA 1XERA 1WI6A 3VZHA 4C3LA 4DV4F 1R8CA 4JI2F 4OMFG 3W9IA 4LF4J 1HNWJ 4CLWA 4F8RA 5RUBA 5CCMA 3OXGA 3DMJA 4J9VA 1VCTA 3RR8A 4PXBA 1T9TA 2K1RA 2H5JB 1YK9A 2PGCA 3GSDA 4KGXB 2WHOA 1NCLA 2EEYA 1WU2A 3M32B 3T6JA 2D7SA 4Q2MA 2DNLA 1PGZA 2FZKB 1RHUB 2ZJQQ 3EJMA 9ATCB 4DG1A 4OI0A 2K3IA 1BQMA 4KPCA 5A6WA 2CDQA 3QT5A 4YDDB 4C11A 2IIHA 2HBQB 2EKNA 2Y0BB 1FWKA 1NK9A 5F8JA 3ZNJ1 4X4NA 4QU6A 2FJBB 2WVEA 2JSXA 4R25A 2AZ3A 1REVA 1MN9A 1P1TA 3Q83A 1TL3A 3NL0A 2FLOA 2XI3A 3CJKA 3R6LB 5I3UB 3C19A 1NMEB 3A13A 4J90A 4QWBA 5ETLA 1HWKA 2N4CA 1FFWB 1VQKS 4B9UA 1X4CA 2XLKA 3TZWA 5J2NB 2NZ4A 4LF6F 3SV3A 2GVDA 3OJSA 2UV8G 2WBRA 1Y5NB 1UETA 3DRXA 2D74B 3PIOQ 3KTQA 1SC6A 4WP9A 4YR3A 1FKPB 3NAHA 2MGZA 1PYSB 2EC2A 3CCMS 3PR5B 3EZOA 3BQ0A 2UXDF 5DZ7A 4LF7F 2QMXA 3AJ1A 2YKNA 3JYTB 1S7HA 2VJUA 2LEAA 3M8YA 1Q0NA 4ED4A 3I4HX 2YX1A 1NB7A 1EAYC 4LF4F 4O44A 3THTA 4FXDA 1LQ9A 3H2UB 4QR0A 3W64A 3TEHB 1X5OA 4NYOA 2AJ2A 3GE9A 4YR0A 1JX4A 1E6YB 5T7LB 2PIIA 5KT5A 3VAGA 3A3PB 1L5UA 3OXFA 5KG3A 2R7VA 1IM6A 3I0RA 2BANB 2BOAA 1TR0A 2VQFJ 1I6JA 2ZH2A 3HJFA 4USKA 3RRHA 1B0TA 1U7LA 2VOOA 2C3UA 1WG4A 2QMUB 5CH7B 1CJKA 2KXHA 3MEKA 2BM0A 2ZZTA 3DU6A 3F56A 4K4UA 5THWA 2XG8A 2OP5A 4H4OA 3OD2A 4HT5A 2QFJA 1DBDA 3PM9A 2HBRB 1W7WA 2ZBRA 2GC8A 4DCJB 2D3ZA 1JNRB 1JLAB 1WF1A 3RBXA 2NRSA 1WC5A 5AXLA 4ECQA 3BBBA 1NK8A 2FJEB 4WE1B 3PVXA 4RO0A 3CT9A 3KJVB 1HWJA 2J9DA 3AJDA 2W9CB 3N9UC 3H98A 1S6UA 1XMQJ 2NQVA 4DBQA 2X1BA 2CPHA 4NCBA 2VPXB 1N8RT 3G8SA 3CCES 3PYFA 3KMSA 3M32A 1RAHB 2J0SD 4PABA 5IZHA 3J80Y 1EHWA 1HL6A 4CO1A 4HHUA 2YNFB 4WIIA 4K5SA 3D67A 4EUVA 4NXMJ 2E1CA 1N4LA 2FHJD 2ZH7A 4CO4A 1JB0C 1ZTWA 5F8GA 2EC0A 1U1RA 1VHIA 2C2ZB 4N7TA 2BE9B 4N76A 2K3KA 5T41A 3VAJA 3A3OB 2Q1LA 4QR2A 3EICA 5ERRA 1RQ0A 2V2KA 1S0VA 2B4UA 4LREA 1NNDA 5JXSA 2MHEA 2XNQA 5I3UA 4ELVA 4NLSA 4YFUA 5G2SA 4OLPA 4OZ2A 1WC0A 2RU9A 3M9OB 4NLGA 3PJWA 3V81B 4ENOA 5J2NA 1FWPA 3M6UA 2HNDA 2M2BA 2R2UA 2AGOA 1U1NA 2YTCA 4OJ3A 4NYPA 2VQFF 3MECB 1N56A 4USIA 3BPSP 5KFNA 3A8JA 2WK4A 2DNOA 2D41A 1TP7A 1HNZJ 2RNEA 3ZZPA 1TL4A 3FDSA 1MWQA 2FVQA 3JYTA 1RI7A 2BJ9A 1YITS 1WORA 4BHQA 4DFJA 4ES1A 2LQBA 1FEHA 1B7FA 1SIZA 4OX9J 2MKJA 2EFGA 5A8KB 4CLSA 5KT3A 2X3LA 1YJNS 4AXIA 5HVHA 4NCAA 1E6YA 5T7LA 2I2YA 1XMQF 3QJPA 4DV0J 5EUHA 3DRPA 1W25A 3Q89A 5KFVA 1VQ7S 4IKAA 2BANA 1IM4A 2BOPA 2YXLA 4DFPA 4KPYA 1VBYA 3M6XA 3IP0A 4S0MA 2V8HA 4NXMF 1ZAVA 3I5AA 4FP9A 2KU7A 2YQ3A 5EWGA 3GG0A 1RGVA 4GO5X 1FRLA 2XLJA 3GIIA 1U8SA 2RIJA 2XS2A 2ADBA 4LF8J 4HH0A 3TAPA 3MCSA 1JLAA 4YN3B 3JSMB 3BR9A 3EVMA 5HK4A 4LVNP 2JZ5A 3W2WB 4LF9F 2W2NP 2NREA 3DHWC 3MXHP 3KJVA 4JBCA 4JI0F 3GLJA 2FJAB 2W9CA 3JXOA 2DO0A 1JLEB 2GS8A 2MB0B 2DRBA 2UVWA 1T05B 5IM0B 4LT6A 4QR1A 3OBIA 3AOCA 2I6WA 1X31C 2YNFA 2QX0A 1HNZF 3Q8QB 1N5QA 1DJ0A 3C14B 4A46A 3QWPA 5HATA 4X4OA 1G8LA 3RTVA 4DL4A 2B6AB 1WF0A 3NCRA 1HIYA 4KBIA 2VPZB 3MM6B 4MH8A 1L3SA 1HLWA 8ATCB 1C2PA 3HKZD 5K5MA 2MZRA 1SKWA 4OX9F 3GJSB 2O01C 2QO3A 5J1EB 3MF5A 3PX4A 3C6TB 4DS5A 5KOWA 1S97A 3K5PA 5DJBA 4U8YA 4DX8H 3NBPB 3CCJS 4DV0F 1PBUA 3KG4A 2IA6A 3BEGB 3CDWA 4Q5VA 1K47A 4ZJOA 3MECA 4PZVA 1CEZA 4WF9Q 4FKYA 1MU2B 2WOMB 1AUSL 3TI0A 3UI3A 1CJVB 2HPUA 2ZVIA 4QIGA 2Y8YA 3ZXWA 3GQCA 4KV8B 3N6NA 3PX0A 3FZBA 1F9EB 4LF8F 2XY6A 2KYXA 2GAGC 1KOHA 2BUNA 4IR1A 1VISA 4KH0B 2QLBB 4ETXA 3Q8RB 3IR7B 5A8KA 2BX6A 4J7CA 4BC7A 3BO2A 1QM9A 2VG5B 2F63A 4O4GA 4ED2A 1WJ9A 2I0XA 1IR1A 2KDOA 2Z0GA 1L3TA 1Q16B 4B9VA 1FTCA 3G6YA 5ETNA 2SXLA 4UF4A 2KG0A 3BYPA 1Q7YT 4QU7A 1S1XB 2Q6CA 2WONB 2JEFA 1CVJA 2GMHA 1OMSA 4CLKA 5DS7A 2B0GA 4IH5A 2KHDA 2YWFA 2MSSA 2HWTA 2DVIA 2DYAA 2MY8A 1D8YA 4Y2AA 3FK4A 1LK7A 4TY8B 2B4OA 2MQMA 3GYNA 2BE2B 3K57A 3THPA 3J7ZT 5DQHA 3JSMA 4M5KA 3VF0B 3UCZP 3F44A 3W2WA 5ERTA 3O2IA 1RT6A 3IR5B 3PRDA 3P5TL 4UZCA 5SZTA 2WVCA 5GAEI 1JLEA 1HARA 1T05A 5IM0A 2A3JA 3MCMA 2F65A 3AD8C 4ILLA 1U2FA 1JLBB 3V6KA 4NE9C 1M1GA 4G3IA 2NLWA 4CLLA 1Q5VA 2F1FA 3LANA 4PAAA 1RWKB 3NMAA 3PRVA 2RH3A 2B6AA 1SIWB 3AAWB 3PW0A 2XY7A 3MM6A 3OR2B 4N77A 2HNZA 3AA9A 2YNIB 1K73T 3N4WA 3ILIA 3EZ5A 5C2CA 1YRTA 1NUEA 1Q78A 2OPPB 1PC5A 1RK8A 4ECUA 1NKBA 4QIEA 5J1EA 3C6TA 4J9NA 4F0HA 1EIYB 3HSGA 1PC4A 3EGNA 3NBPA 1U25A 3CXCR 3LP0B 4WZQA 4PG6A 5D8HB 2O67A 3K2YA 4AXJA 5K8PA 2ZH5A 3FKBA 2GO9A 4PXCA 1MU2A 5F8IA 1NK0A 3ETOA 3GV7B 1CJVA 1JXEA 2MTLA 3Q8VA 3KJNB 4KV8A 2BKPA 4QYZJ 2RQMA 4EO6A 4DFMA 2FZGB 4ZPVR 3LOUA 4RUAA 2DT9A 4OHWA 1U1LA 2AD9A 1RT4B 5CYJA 1X4BA 4A48A 2VICA 1OSCA 4QQBA 4HT7A 2FGOA 4Q7AA 5KFQA 3PDNA 2OPSB 2IHR1 1RT7A 1GFWB 4OZ5A 4J9KA 1UEUA 4TU9A 1GH8A 2VG5A 2AJ0A 4LFBJ 4RWWA 2WCXA 3HSDA 4Z7CA 5IOLA 5AXKA 4W92B 4ZIVA 1S0NA 3B8HA 1NPKA 1S1XA 3K8VA 4DCOB 2WONA 3PFEA 2Y1IA 5DLFA 4QOTA 2P2CB 2NXCA 3MEEB 1RWOB 3EXYA 4NI2B 2VC1A 2M3DA 2FUG9 2C42A 3ITHA 1JJHA 4TY8A 4ZPBA 2EFPA 1K9MT 2LXFA 2BE2A 3E01A 2R8IA 2DR7A 1XIQA 4L6V3 1H0HB 4C8LA 3DHXA 3DLKB 5E3QA 1VYAA 4XO0A 4GRSA 1N0UA 5F9LA 3QFWA 1SL2A 1JWWA 1TKXB 4C0OC 1YX2A 2H5IB 2WVBA 3DLHA 4JI5J 4AL6A 2ZHOA 2LU1A 4Q45A 1Y9OA 1S7IA 2D3O1 2CUYA 1RTHB 2RF2A 1TELA 3BGUA 3ET6B 1NJZA 2MMYA 1GQEA 3J7AN 2AEFA 3M2VB 4OQJA 2QN6B 1JLBA 1FEEA 4YB7A 1D0EA 1NJWA 3CWJA 3CCQS 3CD5A 1H73A 1Y10A 4QZVB 1LOUA 3HZGA 4RW4B 4FDFA 2QYGA 1GX5A 1UZ5A 3ISZA 4K4SA 1XR5A 4WTOB 3OR2A 4U7UK 2KXFA 4M95A 2R8JA 2YNIA 1L3VA 4WFYA 2OPPA 1SL1A 1IR0A 1TVRB 3U1NA 5KG0A 3B82A 5HLFB 1F9FA 2DB1A 3MUMP 4OJ1A 4LFBF 2E1MC 5AT1B 2H1YA 4EYHB 2YWKA 3LP0A 2MSTA 2OHDA 5BR8J 3RR7A 4R0EA 1T9WA 3VCDA 4J9RA 3VGVA 1U24A 2AWZA 3S8SA 2B5JB 4K50A 2OSRA 3DLEB 4AE5A 5D4NA 4QYRA 2N3LA 3O3LA 1NK4A 1FJCA 5KFFA 2NXEA 1RKIA 4LFCJ 2CZ4A 3I32A 2ZOGA 1WUUA 1H2VZ 2CG8A 2A18A 1J27A 4WBFA 4I56A 3CCWA 3RB6A 3ZZOA 1RT4A 2JC1A 2EBEA 2XY5A 2BW7A 4G6VB 3TAQA 2E5JA 3CVKA 2BQ3A 1BD6A 2EG2A 3TW0A 4JI5F 2RVJA 2KXNB 2HHSA 3S7RA 1FO1A 4NCGB 5L39A 4GC6A 2VD3A 4MKVA 4WTYA 3PXGa 2C2RA 2CDRB 3L95X 4JI7J 4MAKA 3ETMA 1XC9A 4NLOA 2DNYA 2XHWA 3MEEA 5CCLA 3AB4B 1T11A 1X4FA 3GILA 3KJFB 4ZDNA 3E3XA 4DQPA 3J81Y 4NI2A 2ASJA 4RNFA 5E33A 3HVTB 2AGPA 4FZVA 4ZPAA 5KFXA 3NS7B 2MDAA 5A2QY 2KJVA 1UEKA 3DLKA 3W66A 3J7YI 3L7PA 1QAXA 2DEIA 2VG6B 3I96A 1HMVB 1X0PA 2BYCA 2DD8S 1ULRA 3HULA 1TKXA 2MKSA 5GADU 2QFIA 5HQLA 1UVJA 1Z2LA 2HEKA 5I3PA 5BR8F 4DV1J 1WHYA 1RTHA 3L7OA 3SQOP 3J81j 2CQ1A 2MEWA 3ET6A 2BZ2A 3G86A 3M2VA 3OLBA 3NP5A 3UVJB 3MR7A 3EM1A 4P74A 4P2FA 3V6JA 2ZOFA 4LFCF 4RW4A 2PC6A 1X4GA 1WG5A 4DSJA 1R43A 4RX6A 4K59A 1TAUA 1NLKL 4ID8A 1UCNA 3G6VA 3MAHA 2BXJA 5E5NA 4ECZA 1Y5LB 4MT1A 1TVRA 5U47A 2DJWA 5HLFA 1F9HA 4RBUA 3GWCA 1YKWA 4M5IA 1S59A 2RB7A 4IG0B 1LXJA 2HWIA 1IKYB 3RUBL 2HLUA 2VZ9A 4AQYJ 1WSRA 3T1YJ 2R7XA 2B5JA 4JI7F 4NA1A 4EMDA 3DLEA 5HMYA 2PO4A 3ZFVA 5ETPA 2WVDA 3ENAA 1X9SA 1UL3A 4IOAQ 1Y4ZB 2GQQA 3N79A 5CA5A 3H0PA 2NCKL 1HPZB 2VV5A 3TARA 1YJRA 1ZM4A 1X9WA 4NLVA 4A4JA 2NQKA 5CYMB 2M9KA 2KG1A 1YQHA 3FCHA 2JNJA 3CC4S 4KQZA 2HHUA 2LA6A 4DQSA 4KC5A 4QPXA 3BF4A 3VHQA 2OFHX 4U91A 5ERSA 4UZBA 4CRJA 1D1UA 3FSXA 4DV1F 1U47A 1EZZB 3KUGA 4A8OA 3CTRA 4F3QA 2KH9A 2V4RA 3GSIA 1HNVB 1VQ9S 3TA2A 4NCGA 5HQMA 2Z2ZA 4ECVA 1RT5B 3QGGA 4C8YA 4F4WA 5L8RC 2CQPA 2VBXA 4I0WA 5F0UA 4HYKA 1U0SA 2LQ5A 1ZH5A 3CDUA 1NHKL 1F2HA 2HQGA 2LXUA 5L46A 1X4EA 3HVTA 5L9NA 2QA2A 5HAOA 3TVKA 3BYRA 4Q0BB 1DAXA 3T5HA 4CNYA 3HDSA 1KDNA 4DHVA 2PSZA 2IBOA 2VG6A 1HMVA 4B9SA 4A47A 4C7QA 4K0KJ 3M9NB 4FYVB 4X65J 3G6XA 2XBPA 3EGVA 1RAOA 4F4ZA 1RWPB 4ED3A 3DDNA 4AQYF 3AH6A 5DG7A 3T1YF 1UZHA 5M2PA 3S01A 2JX2A 1ITPA 5CYQB 5ETOA 5CABA 1HHQA 4JI4J 3IBFB 3SCKE 4EFAC 1BXNA 4OI6A 1SUQB 4DUZF 3QSYB 2J0QD 5B0AA 2IY5B 3BPDA 4F02A 2ZH3A 1RCXB 1IKWB 2CWKA 2C2EA 5DO2A 4IOCQ 3BO3A 3ZTOA 1DTQB 3N6MA 2VU5A 1WDTA 1RTDB 2EBGA 1CULB 4DL7A 3L7UA 4IG0A 3SSRA 1IKYA 1HQMD 2AYMA 4F04B 1H6KX 1YVFA 2RU3A 4CTAB 2BE7D 4JOUA 1S9EA 2NQRA 1V9OA 2GVZB 5KFHA 4O3SA 4ZP9A 4OJGA 4KRWA 2OEJA 1QVGR 2Y0SD 1FKOB 1BGXT 3A4TA 2CPFA 2OAUA 4GKJJ 2HGNA 1FX2A 1H98A 1Q8IA 2UXCJ 1EKSA 4CIOA 4E98A 2VFVA 1HPZA 3M8QB 4RNOA 3IFEA 2NQMA 3GCXP 4DPTA 5CYMA 3FSYA 2HG4A 1CQNA 1VOMA 1RACB 1M0SA 2YQ1A 4F2SA 3RB3A 3Q2TC 1GXLA 4K0KF 3LW5C 2OSQA 5KFOA 1Q1KA 4X65F 4IYQA 2CWXA 2GIFA 2GQ2A 4DU7A 3C16A 4CLZA 4RPFA 1KFDA 2ZUAA 1HNVA 5AXMA 5DQGA 1FRHA 4WU2A 1RA7A 2HAIA 4QWCA 3KFWX 1RT5A 2KL8A 3I5CA 4NMXA 2EFVA 4JI4F 1TAQA 3SEOA 1S1WB 2Q43A 2HRUA 2K7KA 3BSOA 5LT5A 1A7GE 5CZXA 3GIJA 1MMDA 2PFDA 3W3SA 5KFAA 1VGYA 5F0WA 1ZM3A 4Q0BA 5HL7Q 2E1AA 3GG1A 4OHYA 1HBUB 1T3OA 5KT4A 1JLGB 1REGX 3EGZA 3BH6B 4FNIA 1BQNB 3KJQB 4A8XA 4JI1J 2W25A 4I64A 3JB9k 2CADA 4EEYA 1LWXA 2XYGB 4B3MJ 2RDDA 4WZMA 3DFEA 4YUDA 4OYOA 4KJIA 5E0OA 1J5OA 5GMKa 3G4SS 4LSZB 2HQCA 4DSLA 2XGQA 3ZZZA 4EZ6A 1G7CB 1Q7LB 4N47A 5CYQA 1VIOA 4BC9A 2R7TA 2CQ4A 1IBLJ 4GKJF 1EARA 2UXCF 2WRMA 2HVEA 1SUQA 3PX6A 1ICEB 4TQSA 4EK2A 4LF2A 3BQ2A 1QTMA 2X1FA 4PUOB 4LSNB 2V8VA 3MZIA 4LIWA 3DYAB 5HJYA 2MKKA 1PIEA 1F1BB 3BZQA 3NAIA 2RUSA 2IYGA 4ANCA 4CH1A 1DTQA 1OQ3A 2OUGA 4YY3J 3SSSA 1RTDA 4CLFA 2AX0A 4ITSA 4LF5J 4X62J 2J8AA 4O3RA 4EBEA 1PILA 4M5MA 2VQEJ 2LU2A 1HNXJ 1IQZA 3BSCA 1NH8A 2NYHA 4CTAA 1ZETA 1S6OA 4E2FB 3SYZA 5IT0A 2GVZA 4ECRA 4PD0A 2FYXA 4F67A 2J6TA 5IT4A 3OUYA 2JVRA 3PW7A 3KHRA 3PHEA 1U1QA 1R3NA 2LQ8A 1FKOA 1OY9A 4JV2A 1RJJA 2DIUA 1CC8A 4ZPWR 1RADB 5B0GA 1RTJB 3D3CJ 1VBKA 3M30B 2XMAA 1U09A 1HD1A 1Q5YA 1S9GB 5E3RA 3M8QA 3MM8B 1X9MA 4I69A 5HMZA 4WFBQ 3CDEA 3GIKA 1DHMA 4PG7A 2HVDA 3PRBA 3OVSA 2GGPB 4OX8A 4C98A 1U02A 1HWIA 4OYZA 3R9LA 3CJ0A 2C2NA 4ZP8A 1PYOB 2QL5B 4YEAA 1SQEA 2CJYB 4JI1F 1QLNA 1S0MA 4ZS6A 4OI3A 4B3MF 4IRDA 3SXLA 2RS8A 5HBMB 2AQ4A 3LPYA 4Y3CA 4F0MA 4UOHA 2UZAA 5ETSA 3UCGA 2CPYA 3TZXA 2XC9A 3DGPB 4CO0A 4PYAA 3PW2A 1S1WA 3AXMA 1IBLF 3DOKB 4BLGA 3AHPA 2NQNA 5A2QU 3L09A 3PACA 4HL9A 4N5SA 3TJ9A 4F36A 4N8OA 3P8BB 5C42A 3KOAA 2ZH1A 3CMES 3KHHA 2AP6A 3OTBA 1JLGA 4USMA 5K14B 1TZ0A 2JLGA 3NGTA 4YY3F 1BQNA 4B08A 5A8WB 3QLHB 2NUUG 2ZD1B 1VBXA 3ENVA 2HFNA 5AJ3J 2B7BB 2NUHA 4LF5F 4X62F 1IW7D 2DNZA 2VQEF 2DHGA 1HNXF 2KJWA 3SCJE 3PZPA 1WEZA 2RJZA 1CBKA 3IR6B 3K7RA 3GYXB 1Y3KA 3FCWA 4ZK7M 5KTQA 2O3DA 4DSFA 1TQLA 4OX7A 5ERUA 2ZNYA 3AJ2A 1SJQA 3QJLA 3HMJG 1WWHA 5HP1B 3ULHA 4K7QA 2IRYA 4PUOA 4TK1A 3DYAA 2ZE2A 4LMZA 2YWGA 1VC6A 1SPBP 2JH3A 3MUTP 4ZPCA 1S0OA 2XNRA 5CAAA 4URQU 1TFYA 5E3AA 1UFLA 3CD0A 1FDBA 5FJ4A 4FPIA 4AL7A 3MTKA 5KG1A 3I55S 2XMWA 4P7VA 3QZ7A 2PMZD 1MSWD 3PKYA 4TYBA 4ZHRB 3QT8A 1IVZA 1TK0A 3CC2S 4A8MP 2ZH4A 4XK8C 5L1JA 4NA2A 4DOZA 2HLTA 1LFPA 1Y3JA 2ACMA 4X4SA 2KHCA 4OYIA 2DXEA 1VJWA 1K0TA 3JQMA 3LWMA 4RR5A 1RTJA 3WIUA 2YKOA 3FGVA 4M5LA 2CQ2A 1M5PC 2L9DA 2CNOB 3FQKA 3RBZA 1CQMA 1S9GA 2N7CA 2LDIA 1V3ZA 4DLGA 4UOCA 3PHTA 3QJJA 5F9NA 4B9LA 2EG1A 4CLYA 2E5IA 4ES3A 3KHGA 2GGPA 1URRA 2V69A 1G8RA 1Y5IB 2A10A 2MZJA 1ZM2A 2MKHA 2XGPA 5AJ3F 4KGVB 3Q8UA 2RDJA 3LGMA 2RHQB 5HBMA 3V2UC 2QA4G 5H1SV 2VASA 1F0XA 4EU0A 1R0AB 3D1OA 2WBMA 1FXRA 4C3MA 1N5VA 2MLXA 2LQJA 1VQ8S 1ZA2B 2Z57B 3M2UB 2XTJP 4LF1A 3DGPA 3MMCB 4K4XA 1FDNA 2DR8A 2V9WA 4LR9A 3FEZA 2PT0A 2NPFA 4K4WA 6AT1B 1NKEA 2R7SA 2UP1A 1KLMB 1M1KT 4KIAA 4ZVOB 1TL7A 7AT1B 5AE1A 5AE3A 2UUAJ 1IBMJ 4NX9A 4ZVQB 5KFDA 2MKIA 2OFGX 3NY0A 1WOPA 1ZTTA 1UPPA 3U1MA 5K14A 2J76E 2YWWA 2H3EB 1FERA 2Q66A 1SH3A 2OI2A 5A8WA 3BH7B 3QLHA 5A76A 2ZD1A 5GAGI 4DX5A 1C4AA 3T1AA 4KB7A 1A6LA 1B70B 2XO7A 3M6WA 1RSCA 2J7UA 1NDCA 3G6ES 3ZTSA 5B08A 4PPZA 4RZRA 1RT3B 2CJ9A 2FHKA 2Y1JA 2IRXA 4I4BA 3D1HA 1I6VD 3UW1A 1Q81T 2FLNA 2GJFA 4OYPA 3MHYA 3R5CA 2V8DA 2BRLA 4CO3A 2A2CA 3NLCA 2XZTB 1PYTA 3PNIA 4LBPA 4EYIB 2NYIA 5HP1A 4TNOA 1K8AT 5F3ZA 3BR8A 3O8WA 3N01A 5GAHU 3K5LA 1QY7A 3DM2B 1S1VA 1NXIA 1YJVA 3K59A 4E0DA 5DQIA 3D66A 1YLXA 1B0PA 1OPIA 2CQCA 3H4DA 1DQAA 4USHA 4LQ3A 3U7JA 2M0GB 4HTJA 1X60A 5D3GB 1FCAA 2FTSA 2DNRA 1FJGJ 3PCOB 2ACYA 1HHSA 3US5A 3OFFA 4B17A 1SC4B 4ZHRA 5B0EA 4TN2A 4GMKA 4MIBA 2MQLA 4QWEA 4DUTA 1JLFB 3CCSS 3DKDA 3T1HJ 1C1BB 4MIAA 3LQVA 1T3EA 2E1PA 3J7Z5 3NGUA 4NWBA 1CJUB 2UUAF 5EHHA 3R2CJ 4RL1A 3CCZA 2RILA 1NSQA 1KP6A 2XZDB 4YR2A 5CHCB 2QIFA 2B9WA 1O8BA 5DGAA 1MROB 2RMLA 3GMGA 3FBCA 4RWXA 1TMJA 2RT3A 4ID5B 4L73A 3ILJA 3OR1B 1N5TA 2P9CA 4UY85 1S76D 2M70A 3I4PA 3W5ZA 1FD2A 5H9EJ 5ETQA 2HFSA 4IH6A 2E1RA 4UOGA 4P10A 1SL0A 1FXLA 5F3TA 4FKXA 2H5EA 3M2UA 4MYTA 1SVDA 3MMCA 1HBNB 1CS4A 2I9SA 3BGFA 2XULA 3E51A 3UNYA 3KWMA 1PKUA 3PJXA 4NEYA 3OHBA 3TYTA 3B4MA 4DU8A 1LWFB 2JFKA 4J5OA 4WK3A 2HMIB 1KLMA 3HK2A 3UD3P 1DQ8A 3WX8A 1M1HA 3CJSA 3HLUA 5LOQA 5DDQC 2HVHA 5D0GA 2OJ3A 3CCUS 2VKRA 2GO8A 1JXVA 1FNXH 5L9XA 2KFZA 2FB0A 4ZLNA 4EWTA 1TL1B 5GVQA 3Q23A 1NB2A 3UN3A 3N6LA 4X66J 1P8GA 1FJGF 4HH1A 4JI2J 1SKUB 3QGHA 2W7PA 1RT3A 3EYZA 4DDFA 3RRGA 1H74A 1U4BA 2WTFA 2HWHA 3QT6A 2V4QA 1RAFB 1KSPA 4B9TA 2FVCA 3CJ5A 3BQ1A 3T1HF 2QA1A 3WX4A 1M5SA 1HI0P 4DF8A 3N0VA 2VJVA 3G96A 5KAKA 3Q2SC 1N54B 4RLEA 3ZZ0A 3CCTA 5ETMA 3DM2A 2FHOB 3ZTRA 5FLXY 3VVUA 4ES2A 2GW8A 1Q79A 3ZZYA 3QT7A 3KXDA 2FTRA 4CDIA 5SUHA 5D3GA 2V0NA 3EPIA 2C3OA 2XO6A 4HKQA 3ADAC 5H9FK 1KVKA 2R2RA 1J5EJ 2ASDA 1JLFA 1RU2A 4X2BA 4FVMA 2YVSA 1C1BA 4FVCA 2BVZA 2DPJA 1F60B 3W8PA 1S48A 1UKUA 1CJUA 4FS1A 3EVOA 5HVGA 4IH7A 2EI5A 2FU3A 4H4KC 1YJWS 5FIIA 4QWDA 4KYZA 4JV1A 1MROA 3MM7A 1UFKA 3ZZRA 4BWJA 3NNCA 4RUHA 3R5GA 4ID5A 4QW9A 2NROA 3QYYA 4MK7A 3MAAB 5JVGQ 3OR1A 4X66F 1FRXA 5F8NA 3I87A 2ZDPA 3OFEA 1H7XA 1VQ6S 4TQRA 2XS7A 4X4QA 4PWUA 4FBTA 1EQMA 3B54A 3EPGA 1RKJA 2QLFB 3M1VA 2QRRA 3JTPA 1LWFA 2ALYB 2QLWA 1D9DA 2CZ9A 4CQ1A 2HMIA 3GIRA 1EETB 2OPRB 3UN5A 2JRSA 4A8SA 2CFXA 2JLFA 4IO1A 4C48A 2LEPA 3G82B 4TU7A 2J0WA 3OTEA 4USJC 2B9YA 3BSNA 3C6UA 1TL1A 2LMIA 2M4MA 1RHRB 3FMWA 3PEJA 3KLGA 5KFWA 3FMBA 4DJBA 1P6TA 2KM8C 3FEYB 5CD4H 2ZBIA 2RQCA 4NLPA 1RHJB 4OHXA 1YZ6A 1KVIA 1J5EF 1ZA1B 4Z37A 3R7SB 4FYDA 1URNA 1M5VC 1DFDA 4I1TA 2W2OP 4AD6A 2DNGA 1TU0B 4ZLLA 3AFGA 2LKZA 4IOBA 1YG0A 1LFWA 3QRRA 2LCWA 4P2MA 1S4EA 2D69A 2XMVA 2OD4A 5BXIA 5KT7A 3IGVA 4ZA1A 5KFLA 4IRKA 2R42A 4USVA 3EZUA 1RB0A 3CEDA 2ILZA 1FDDA 4ETZA 3RYLA 2HAFA 3HM9A 4G1QB 2G2YA 3A8EA 3HKWA 1IQTA 1V5VA 2JHEA 3CDAA 1NO8A 3HSZA 4DSEA 4ELUA 1IN0A 2MJUA 5E3CA 3LF0A 1X0FA 1N0VC 4KAIA 4KFBA 3OLAA 2AV5A 3KLIB 3I6PA 1JLQB 2CPEA 1DARA 1PAUB 1RBLA 3EGWB 2N3OA 5LL6d 2E9TA 2HZVA 2VG7B 5F8HA 1IWGA 1YTYA 2RUGA 5F8LA 1MW7A 4B9MA 1W2BR 1PAEX 3AQPA 4HHHA 4L76A 1J2VA 3QGPA 4KH1B 2OH2A 4URSA 3IMQJ 1VC5A 2X7IA 1RISA 4DV7J 1BWEA 2FLLA 1VQNS 1R8AA 3HHKA 3IWLA 2XLIA 1GX6A 3UWTA 3RW6A 1HHTP 5C7PA 3D5MA 2HZCA 5J2QB 1FE4A 3OL6A 4ZKAA 2H54B 2UUCJ 1S49A 1SJ1A 1U45A 1HYSB 2IJRA 3SSQA 2IVYA 4PPDA 3ZNUA 2G0IA 3BKUA 1VQ5S 8AT1B 3BN7A 2YKQA 1EETA 2DEJA 3PEHA 5EGYA 1HR0J 2OPRA 4DR2J 3NGSA 5B0FA 3R5JB 1H2UX 2VA3A 1M5HA 1FWLA 1EP4B 4M5JA 2J7WA 1QAJA 2BRKA 2DGXA 1HBMB 4Y2MA 3UD5A 1SH0A 1I5OB 2VKZG 3MR5A 4A8FA 4FF3A 2PFFB 4Y65A 1FVQA 3JAMY 4PG8A 3QGIA 3H5UA 3CF5Q 1RUSA 3IC1A 4LQ9A 3IG1B 3CB4A 3ZZTA 5IWAJ 3W62A 2V34A 1F6TA 1DURA 3DRRB 3GONA 4LF9J 1XNQJ 1YDLA 4WIQA 3T5KA 3TAMB 4JI0J 3W5XA 4ECXA 4P71A 1R8HA 3CCRS 2HQ3A 2W7OA 4Y0FA 3VQTA 2CPXA 3MMAB 2HS3A 2V63A 3LUYA 1TKTB 2DGSA 4W98A 1SI9A 1FKPA 2VA2A 3LAMA 4DV7F 4ZVHA 5A6PA 3BN4A 4OHZA 4G1QA 3R5BA 1EX8A 2HFUA 1VQOS
chains in the Genus database with same CATH topology
2DGUA 2HHTA 3PW5A 1FHTA 3CDUA 3BS9A 4IQMA 3TVZA 1RT1B 1RA6A 5M2UA 5L1IA 2F7VA 3MPVA 2W4DA 2LXUA 2GJIA 3KG1A 1X4EA 5B7WA 3HVTA 2R7UA 5L9NA 2QA2A 3P3DA 3W2VA 4YB5A 3TVKA 1U1MA 4Q0BB 3FRZA 1DAXA 3VQSA 3T5HA 4UQTA 3MGJA 4PG5A 4CNYA 1DLOB 3HDSA 4MYUA 1FVSA 4G1IA 3IS9A 2MGZB 4DHVA 1S1UB 3MR6A 2ZM6F 1HWLA 2UUCF 2PSZA 1YJTA 2EW9A 2IBOA 1RT2B 2DGQA 2PD1A 2VONA 4OL8A 4TK4A 1NZAA 3TUZC 1QUPA 2VG6A 1HMVA 4B9SA 3DN9A 4NZ0A 4A47A 3Q8SB 2YKMB 2XWYA 3DOMA 2QV6A 4C7QA 3KLIA 3M9NB 4YOEA 4ED0A 1JLQA 4NZ6A 1Q8BA 3FFIB 2YKNB 5JVHQ 2AYGA 3MI7X 5KFRA 4FN5A 4FF2A 2MPUA 3DXBA 1T03A 1N36F 3G6XA 3FQLA 3RB0A 2XBPA 2IVMA 2PN6A 1IBKF 4YP3A 3HFKA 1L3KA 2ADCA 5KFTA 2M8DB 2LXIA 3HI9A 2J6SA 5K8MA 3IO1A 4F4ZA 3FNNA 1UFWA 1Z1ZA 1VQMS 2VG7A 2VUGA 4ED3A 1HR0F 3DDNA 2HHWA 2CG4A 4I7FA 4O44B 3UDLA 3Q24A 4DR2F 2CQ3A 4AQYF 2GIRA 3AH6A 4FBUA 5DG7A 3T1YF 5L1LA 2HYIB 1NKCA 4LSNA 1O51A 3DU5A 2LLZA 4KFBB 4NMLA 5M2PA 3S01A 1LW0A 2JX2A 1HBOB 4Y34A 4AYBD 5K8NA 5CYQB 3LO3A 3NNAA 1AW0A 1F5CA 5GADI 4A8QA 3BDEA 3SCKE 2JEJA 4EFAC 4RW8A 1TL5A 2AF6A 1N5YA 5G2RA 1PO6A 1FNMA 3I0RB 3K5OA 4PXEA 4OI6A 5B0DA 1SUQB 2CQIA 2DHSA 2OLWA 4RKUC 4DUZF 2GQCA 4LUBA 4PRFA 3I56S 4A8KA 2J0QD 5B0AA 3VAHA 2F4VF 4U7CA 4F02A 4Y6IA 2ZH3A 4RW6A 1HW8A 1IJFB 2JFDA 2ATLA 5HQ8A 3MMJA 1IKWB 3HT3A 3GFHA 4MMOA 5I3QA 2C2EA 3V6HA 4Q2LA 2DNQA 2DO4A 2F8MA 4MFBB 5DO2A 5MAOA 2FJXA 3C46A 4X4VA 4Q8FA 4IOCQ 2MQOA 2EVZA 3AA8A 3NRBA 4J9OA 2QE5A 5IWAF 3BO3A 1K1QA 1OWXA 2J7KA 1JMTA 4OJHA 4DL3A 2V4JB 2B43A 5L38A 3IWNC 3K8WA 1DTQB 4C8NA 3N6MA 2GA7A 4WE1A 1VRUB 1XTZA 1XNQF 1F5BA 1UJ4A 1RTDB 1JXLA 3TP2A 3P49B 1R8PA 5LJ5Y 4H4OB 2EBGA 4ILMA 1XERA 4DL7A 4IG0A 3SSRA 5ADZA 1KN6A 2ERRA 3TUJC 1WI6A 3QO9B 1IKYA 3VZHA 2QT7A 1CLFA 4C3LA 4DV4F 2O1PA 3MOZA 1R8CA 1HQMD 4JI2F 2AYMA 1H6KX 3M30A 1YVFA 4OMFG 2RU3A 3OL7A 4CTAB 3P96A 2VFSA 4JOUA 1YHQS 1X7VA 1S9EA 2NQRA 2MYFA 1V9OA 2AX1A 2X3GA 3CIMA 3HHLA 5CZVA 3MM8A 3BDPA 4ED5A 5KFHA 4O3SA 2YKPA 4OIXA 2D3OR 4ZP9A 4F8RA 4U9RA 1C1CB 2ZC4A 4ED1A 3GFXA 4OJGA 2V8GA 4ZVGA 4KRWA 2PI4A 1EP4A 1QVGR 5CCMA 3OXGA 5KFBA 3KLHB 3QIDA 3DMJA 2Y0SD 4RNNA 1FKOB 3RR8A 1BGXT 2HS0A 3R1LA 2CPFA 2JC0A 3S6EA 1HBMA 2IM1A 2OAUA 3JSBA 2CPJA 1AFJA 2HGNA 1YJ9S 1H98A 1KONA 4PXBA 4N41A 1Q8IA 4BWMA 2K1RA 2YX4A 2FLPA 2PGCA 3IAS9 3GSDA 2ZKTA 5T14A 2ZVSA 2FC9A 4CIOA 4E98A 2VFVA 2WHOA 3QIPA 1HPZA 3M8QB 1WU2A 3TOQA 3M32B 4RNOA 4ECSA 3IFEA 3T6JA 2NQMA 2D7SA 4Q2MA 2M88A 4MK8A 1HA1A 5MLCV 2DNLA 1PGZA 3KKFA 3KLEA 1NJYA 4E8UA 5CYMA 3FSYA 2FJWA 2HG4A 4YB1P 2ZJQQ 4DG1A 4OI0A 4RNHA 1CQNA 1VOMA 2K3IA 2LQ9A 1M0SA 2EK1A 3IG1A 4OX6A 3MEDB 2XMUA 1BQMA 3H5XA 4F2SA 5A6WA 2CDQA 3RB3A 1HQUB 4M1KA 2VODA 3Q2TC 3DRRA 4YDDB 1GXLA 4PWDA 1KHVA 1VQYA 4C11A 4K0KF 3LW5C 2OSQA 5A8RB 2P6TA 4QPTA 3WC0A 1WNEA 2ROPA 2AYBA 1NK9A 1VIXA 5KFOA 1Q1KA 2HFOA 4X65F 5F8JA 2QA4S 4IYQA 2ZUGA 3M8SA 4X4NA 4FS2A 2GQ2A 4QU6A 2FJBB 2JSXA 1QE1B 2WSEC 4R25A 4NLXA 2DPIA 1REVA 3DOKA 5EN1A 4FF1A 2GNKA 3CCVS 3V81A 2FJDB 1P1TA 1KFDA 4CI0B 1TL3A 1HNVA 5AXMA 5DQGA 3OJUA 2FVPA 3NL0A 5J2MA 2A1BA 2IMWP 2JEIA 1E6VB 1FRHA 2FLOA 2XI3A 4WU2A 1RA7A 2HAIA 3MMAA 3CJKA 4QWCA 3H4BA 3KFWX 3O1LA 1KRPA 2KRBA 1BQXA 1I94F 2DRAA 2NQSA 1RT5A 1Y0HA 5I3UB 2HHHF 3I5CA 2EFVA 1TKTA 2UV8A 4NZ7A 1KQSR 2G13A 5KFEA 4NRTA 4QWBA 4JI4F 1TAQA 1XMOF 1V6HA 3SEOA 1S1WB 4DQRA 1U6ZA 1HWKA 2N4CA 2E29A 4G1PA 1VQKS 2Q43A 4URGA 4N56A 4B9UA 2F9DA 1X4CA 4ED6A 2XLKA 4YB6A 5J2NB 1KVJA 2HRUA 2NZ4A 3JTNA 4OZ0A 4JUZA 3V4IB 4IFYB 2K7KA 4LF6F 4MKYA 3SV3A 4ZPDA 1RT1A 3BSOA 2OMLA 1SJFA 3I9V9 1A7GE 5LT5A 3OJSA 2UV8G 5CZXA 2KT5A 2WBRA 1Y5NB 3L3CA 3GIJA 1MMDA 3W3SA 1UETA 3DRXA 5KFAA 2D74B 5DGBA 3PIOQ 3KTQA 1VGYA 5F0WA 1ZM3A 1SC6A 4Q0BA 4BCAA 4YR3A 5EWFA 5HL7Q 2E1AA 3GG1A 4OHYA 1DLOA 1FKPB 2L9NA 1HBUB 3NAHA 1T3OA 2ROEA 4PKDB 3C3LA 1FXDA 5KT4A 1JLGB 2DBBA 2MGZA 1S1UA 3EGZA 3CCMS 1RT2A 3PR5B 4DS4A 2YWHA 4FNIA 3BQ0A 1BQNB 2B51A 2UXDF 5JJBA 1X4AA 1S1TB 4LF7F 2YKMA 2CJBA 3MWBA 4A8XA 2P9EA 2QMXA 3AJ1A 4LVOP 2W25A 3FFIA 3H59A 2YKNA 1JIHA 4I64A 3JYTB 3JB9k 1S7HA 2FHMA 2U2FA 2LEAA 3DRSB 1SJ4P 4WFZA 4EEYA 1O0PA 5F8MA 4WZMA 4A8YA 3DFEA 4YUDA 4KJIA 3I4HX 5E0OA 1J5OA 5GMKa 2YX1A 4RW7B 4J9PA 1NB7A 4LF4F 3G4SS 4O44A 1KFSA 2W8KA 3PO4A 3THTA 4FXDA 2GCFA 4H54A 4TLRA 1LQ9A 3H2UB 2E66A 4QR0A 4DSLA 2J0XA 2XGQA 4DV5F 3ZZZA 3JSRA 4EZ6A 1X5OA 1G7CB 1Q7LB 4ERDA 4NYOA 1VQPS 4F26A 4N47A 3GE9A 3N5BA 3D28A 5CYQA 4BS2A 3TX8A 3MD1A 4YR0A 1JX4A 4O23A 1E6YB 1VIOA 5T7LB 4M8LA 5D6GA 2PIIA 4BC9A 2CQ4A 5KT5A 4EO8A 2R7TA 3GR1A 1R27B 3VAGA 1L5UA 4GKJF 3OXFA 2CQGA 3CO9A 4RBVA 1X4HA 3OL8A 1VQ4S 4FNHA 2UXCF 5KG3A 2PMHA 5LMNF 2WRMA 3I0RA 2R7VA 3TQ1A 1SUQA 2ROGA 2BANB 2FIUA 3PX6A 3T3FA 4TQSA 2XCPA 1QTMA 3BQ2A 2X1FA 1TR0A 4PUOB 2HQIA 3N5FA 4LSNB 4DV6F 2V8VA 2ZH2A 3MZIA 1I6JA 1PSDA 3HJFA 4LIWA 3DYAB 3UDCA 4DQQA 4LJMA 1FD8A 2ZZNA 3RRHA 1B0TA 2WAQD 1U7LA 2BQUA 2VOOA 2C3UA 1G1XA 3O6QA 4MFBA 2MKKA 3PW4A 1N34F 1NAQA 4ZCMA 1QSYA 1WG4A 4TLQA 4PQAA 2RSQA 5CH7B 3BZQA 2QZ8A 3NAIA 2IYGA 3CJ3A 4CH1A 2KXHA 1VC0A 2V4JA 1FJ7A 3UFCX 2VC0A 1DTQA 1OQ3A 3MEKA 3B4DA 2BM0A 3SSSA 2C28A 3DU6A 1P27B 1VRUA 3F56A 3UPFA 5THWA 1RTDA 4B3RF 4K4UA 4O3OA 1KNZA 2RE1A 2AX0A 4YMEA 4XPEA 2XG8A 2OP5A 4H4OA 4ITSA 4HT5A 3ICLA 2QFJA 2I1RA 1DBDA 3PM9A 2XMKA 2J8AA 4O3RA 4JI6F 4EBEA 3QO9A 3BSAA 1PILA 4UUXA 2LU2A 2CIMA 2GC8A 1KS2A 2D3ZA 1IQZA 1JNRB 3BSCA 2P9GA 1JLAB 1WF1A 2EWHA 1K1SA 3IXQA 1NH8A 3SZ2A 4B9NA 3D54A 2NRSA 2Z4PA 3GV5B 4CTAA 1ZETA 2W24A 5AXLA 1S6OA 4ECQA 3SYZA 3UNGC 3QWUA 1NK8A 5IT0A 1QVFR 3D0HE 1OQ6A 4FXWA 4ECRA 1LV5A 4PD0A 3AQOA 4F67A 2FJEB 3H20A 1C1CA 2HRYA 2K7JA 4WE1B 4UY8T 2J6TA 5KFPA 1XNRF 3PVXA 4DR1F 2X51A 1VK8A 5IT4A 3OUYA 2JVRA 3KHRA 3PW7A 3CT9A 3PHEA 4WK1A 2IC3B 4X4PA 1WG1A 3KLHA 1U1QA 1S10A 3KJVB 1R3NA 2DGOA 1FKOA 1HWJA 2J9DA 3CMAS 3RRKA 2L48A 4JV2A 1RJJA 2W9CB 1P9QC 3N9UC 2DIUA 3H98A 5KG2A 1CC8A 1S6UA 2IJNA 4ZPWR 4DBQA 2NQVA 2X1BA 5B0GA 5FD1A 3HHLC 1RTJB 2CPHA 3VAMA 3OVAA 4NLRA 3M30B 4NA3A 5E2QA 1U09A 2JWNA 5J1NA 4NCBA 1HD1A 2VPXB 1N8RT 5ERQA 1S9EB 2F40A 5H9FJ 1S9GB 2MQNA 5E3RA 3G8SA 1ZAWA 4CH0S 3M8QA 3MM8B 1IUJA 3CCES 1X9MA 2NQPA 3KMSA 3M32A 4I69A 5HMZA 4WFBQ 3CDEA 4PD1A 4NRUA 3GIKA 3DLJA 5KG6A 4ZP6A 1DHMA 2J0SD 5J1PA 4PG7A 3TA1A 5IZHA 2PA8D 4IQXA 3J80Y 1WHWA 1HL6A 4C8OA 2C3MA 2BV3A 4CO1A 3PRBA 4C4WA 3OVSA 2GGPB 1HI1A 2YNFB 4OX8A 1R0AA 4CZCA 2YNHB 4WIIA 4K5SA 5DDOC 4EUVA 4MIWA 3MEDA 4C98A 1HWIA 1N4LA 2E1CA 2FHJD 3OW2R 2ZH7A 1HQUA 3FRYA 4CO4A 4AUKA 1JB0C 3CJ0A 2Q3PA 3D0IE 5F8GA 1ZTWA 4C0BA 4ZP8A 2HS4A 4P2SA 1U1RA 2EC0A 4YEAA 1SQEA 5A8RA 4JI1F 1ZPWX 3MDFA 4M5DB 4N76A 3N28A 2ZH6A 2K3KA 5T41A 2W9AA 3VAJA 2M5YA 1QLNA 1S0MA 4ZS6A 2Q1LA 4QR2A 4OI3A 1XR6A 3LP2B 1IKVB 4HLBA 1QE1A 3KK2B 4B3MF 1LW2B 4IRDA 3SXLA 2RS8A 2KZMA 2B4PA 5HBMB 4DF4A 2AQ4A 5ERRA 1RQ0A 2V2KA 3LPYA 4Y3CA 5D4PA 4K4VA 1S0VA 2HNYB 1E6VA 2ZZMA 2OTLS 2UZAA 2B4UA 4K2XA 5E41A 2WW8A 3UCGA 2CPYA 1NNDA 3V5RA 5DDRC 5JXSA 2MHEA 2XNQA 4X84A 4C11B 5I3UA 4B3TF 3ZZUA 4NLSA 2MXYA 4YFUA 2XC9A 4ELVA 4ALZA 3H2LA 2NPIA 4M63A 2BW2A 2WOMA 4CO0A 3DI6B 5G2SA 3MM5B 4KE5A 4OLPA 4TYAA 3PW2A 3M05A 1S1WA 2G0CA 2RU9A 4YHHF 2E9RX 1IBLF 3M9OB 4NLGA 1REVB 2P5VA 3DOKB 2L9WA 3MUVP 3VALA 3AHPA 2NQNA 1SB6A 3OPKA 2CQBA 4C3KA 3OTOF 3H25A 4NXNF 1SV5B 2W4CA 3C8YA 4OV1A 3PJWA 5G4DA 3V81B 2GIQA 1TL3B 3EXCX 5J2NA 3L09A 3M6UA 2HNDA 2M2BA 4IFYA 5GAGU 2R2UA 3PACA 2AGOA 2AJ4A 1U1NA 4HL9A 4N5SA 2ZH9A 2YTCA 4NL5A 4OJ3A 1X5PA 4NYPA 2VQFF 1YI2S 4LFAF 4N8OA 3MECB 1N56A 5C42A 4DV3F 2R2TA 2VFTA 4USIA 3KOAA 2ZH1A 3CMES 5KFNA 3GR0A 2WK4A 2AP6A 3KHHA 3OTBA 4WFNQ 1JLGA 2DNOA 2D41A 3HF5A 1TP7A 3OXLA 1N48A 2YWEA 5K14B 1TZ0A 1JKHB 2JLGA 4NYZA 4YY3F 1BQNA 2RNEA 4F3OA 3ZZPA 4F3MA 1S1TA 4B08A 5A8WB 1TL4A 3X1LB 5I42B 3FDSA 3QLHB 1C0UB 2NUUG 1T02A 2PEHA 3C2PA 4RBTA 2ZD1B 1VBXA 3ENVA 2HFNA 2FVQA 2B7BB 3TUIC 3JYTA 5BYRA 4PG4A 2NUHA 1RI7A 4LF5F 4X62F 3DRSA 3CGIA 3S1TA 1IW7D 5ERVA 1YITS 3TVYA 1FRMA 2DNZA 1S72S 2VQEF 2DHGA 4BHQA 4I6YA 4DFJA 4F4XA 1HNXF 2OO4A 2KJWA 3SCJE 4J9MA 4ES1A 3PZPA 3TR5A 1FJEB 2LQBA 1WEZA 2RJZA 1FEHA 4RW7A 4DLEA 1B7FA 3IR6B 1SIZA 2MKJA 2EFGA 3K7RA 4DR5F 4PQUB 5A8KB 2JOQA 3GYXB 5EWEA 3NKYA 3OSNA 4DR3F 1HNIB 1VBZA 1Y3KA 5KT3A 2X3LA 1YJNS 1DQ9A 4ECWA 4ZK7M 5KTQA 3UD4P 2KVIA 2O3DA 1JLCB 3G8TA 4AXIA 3QZ8A 4PXDA 5KFJA 4ECTA 4ZMMA 5KFKA 4DSFA 1NJIT 3H40A 4NCAA 1E6YA 5T7LA 4ED8A 1TQLA 2I2YA 4OX7A 4ED7A 1XMQF 3QJPA 5ERUA 1LKZA 5EUHA 2DITA