1C1ZA

Crystal structure of human beta-2-glycoprotein-i (apolipoprotein-h)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
326
structure length
326
Chain Sequence
GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA2-GLYCOPROTEIN-I
publication title Crystal structure of human beta2-glycoprotein I: implications for phospholipid binding and the antiphospholipid syndrome.
pubmed doi rcsb
molecule tags Signaling protein
total genus 56
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA05
2ERJA 3ERBA 4F4OC 2EHFA 3OP8A 2XQWC 2KRIA 2IZ3A 1Q3XA 2WIIC 2KMSA 2YBYA 3O8EB 1GHQB 2QY0A 4ONTD 1H2PP 3IU3I 4AYEA 3T5OA 1OK3A 4CSYA 2B5ID 1MD7A 1G4GA 2RL0A 2XRBA 3L89M 3CALA 2JGXA 3R62A 1TPMA 2MCYA 4ZH1D 4KKDA 2G7IA 1H2QP 1VVCA 2UWNA 1G4FA 1H04P 2W81A 2RLQA 4LOTA 5JPMG 4AYDA 1SRZA 4J38B 5FO8C 1GKNA 1VVDA 2W80A 1H03P 5HYTB 3GOVA 3EJHA 1OJYA 2XWBF 1OJVA 2EC3A 4MUCA 2LOJA 4A5WB 2XRDA 1OK9A 2RKYA 2JRAA 3OEDC 4YNXA 1O9AA 1OJWA 3TVJA 1OK2A 2JGWA 1E8BA 1E5GA 4AYMA 1Z92B 4FXGG 4C16A 1LY2A 4AYIA 5HYPA 1MD8A 1TPGA 2CG6A 3ZRZA 4LOSA 3OXUD 5HZPB 3RJ3D 1OK1A 1QUBA 3NFPI 1TPNA 1U5MA 2IZ4A 4JHSA 2V8EA 2CKUA 2RKZA 3ZD2A 1HFHA 1GPZA 1UOTP 1ZJKA 3GXEA 2A55A 3KXVA 3SW0X 3ZD1A 1ELVA 3IX0A 2O39C 1QO6A 2YRAA 3INBC 3KZJA 1E88A 1HCCA 1QGBA 3M7PA 5HYUB 1PPQA 1SS2A 3MQLA 1CKLA 4WJG2 4DJZA 1FBRA 2XWJI 4B2RA 4K12A 1GKGA 1NWVA 2MCZA 1HFIA 2CG7A 4PZ5A 4B2SA 5I0QB 1C1ZA 2BZMA 4IGDA 2RLPA
chains in the Genus database with same CATH superfamily
2ERJA 3ERBA 4F4OC 2EHFA 3OP8A 2XQWC 5DN4A 2KRIA 2IZ3A 1Q3XA 3NJAA 2WIIC 2KMSA 2YBYA 3O8EB 1GHQB 2QY0A 4ONTD 1H2PP 4YIZA 3IU3I 3F6KA 3FGRA 4AYEA 3T5OA 1OK3A 4CSYA 2B5ID 3ZLDA 1MD7A 1G4GA 2RL0A 2XRBA 3L89M 3CALA 2JGXA 3R62A 3WSYA 1TPMA 2MCYA 4MSLA 4KKDA 4ZH1D 2G7IA 1H2QP 1VVCA 2UWNA 1G4FA 1H04P 1RLHA 2W81A 2RLQA 4LOTA 5JPMG 4AYDA 1SRZA 4J38B 5FO8C 1GKNA 1VVDA 2W80A 1H03P 5HYTB 3GOVA 3EJHA 1OJYA 2XWBF 1OJVA 2EC3A 4MUCA 2LOJA 4A5WB 2XRDA 4N7EA 1OK9A 2RKYA 2ZYCA 2JRAA 3OEDC 4YNXA 1O9AA 2Y8SA 1OJWA 3TVJA 1OK2A 2JGWA 1E8BA 1E5GA 4AYMA 1Z92B 4FXGG 4C16A 1LY2A 4AYIA 2Y8RA 5HYPA 1MD8A 1TPGA 2CG6A 3ZRZA 4LOSA 3ZLEA 3CI0J 3OXUD 5HZPB 3RJ3D 1OK1A 1QUBA 3NFPI 1TPNA 1U5MA 2IZ4A 2Y8TA 2V8EA 4JHSA 4BWCA 2CKUA 2RKZA 5DN5A 3ZD2A 1HFHA 3WSXA 1GPZA 4PO7A 1UOTP 1ZJKA 3GXEA 2A55A 3KXVA 3SW0X 3ZD1A 1ELVA 3IX0A 2O39C 1QO6A 2YRAA 3INBC 3KZJA 1E88A 1HCCA 1QGBA 3M7PA 5HYUB 1PPQA 1SS2A 3MQLA 3VWOA 1CKLA 4WJG2 4DJZA 1FBRA 2XWJI 4B2RA 4K12A 2X2ZA 1GKGA 1NWVA 2MCZA 1HFIA 2CG7A 4PZ5A 2I2LA 4APLA 3FGTA 4B2SA 3K3TA 5I0QB 1C1ZA 2BZMA 4IGDA 2RLPA
chains in the Genus database with same CATH topology
2ERJA 3ERBA 4F4OC 2EHFA 3OP8A 2XQWC 2KRIA 2IZ3A 1Q3XA 2WIIC 2KMSA 2YBYA 3O8EB 1GHQB 2QY0A 4ONTD 1H2PP 3IU3I 4AYEA 3T5OA 1OK3A 4CSYA 2B5ID 1MD7A 1G4GA 2RL0A 2XRBA 3L89M 3CALA 2JGXA 3R62A 1TPMA 2MCYA 4ZH1D 4KKDA 2G7IA 1H2QP 1VVCA 2UWNA 1G4FA 1H04P 2W81A 2RLQA 4LOTA 5JPMG 4AYDA 1SRZA 4J38B 5FO8C 1GKNA 1VVDA 2W80A 1H03P 5HYTB 3GOVA 3EJHA 1OJYA 2XWBF 1OJVA 2EC3A 4MUCA 2LOJA 4A5WB 2XRDA 1OK9A 2RKYA 2JRAA 3OEDC 4YNXA 1O9AA 1OJWA 3TVJA 1OK2A 2JGWA 1E8BA 1E5GA 4AYMA 1Z92B 4FXGG 4C16A 1LY2A 4AYIA 5HYPA 1MD8A 1TPGA 2CG6A 3ZRZA 4LOSA 3OXUD 5HZPB 3RJ3D 1OK1A 1QUBA 3NFPI 1TPNA 1U5MA 2IZ4A 4JHSA 2V8EA 2CKUA 2RKZA 3ZD2A 1HFHA 1GPZA 1UOTP 1ZJKA 3GXEA 2A55A 3KXVA 3SW0X 3ZD1A 1ELVA 3IX0A 2O39C 1QO6A 2YRAA 3INBC 3KZJA 1E88A 1HCCA 1QGBA 3M7PA 5HYUB 1PPQA 1SS2A 3MQLA 1CKLA 4WJG2 4DJZA 1FBRA 2XWJI 4B2RA 4K12A 1GKGA 1NWVA 2MCZA 1HFIA 2CG7A 4PZ5A 4B2SA 5I0QB 1C1ZA 2BZMA 4IGDA 2RLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERJ A;  3ERB A;  4F4O C;  2EHF A;  3OP8 A;  2XQW C;  2KRI A;  2IZ3 A;  1Q3X A;  2WII C;  2KMS A;  2YBY A;  3O8E B;  1GHQ B;  2QY0 A;  4ONT D;  1H2P P;  3IU3 I;  4AYE A;  3T5O A;  1OK3 A;  4CSY A;  2B5I D;  1MD7 A;  1G4G A;  2RL0 A;  2XRB A;  3L89 M;  3CAL A;  2JGX A;  3R62 A;  1TPM A;  2MCY A;  4ZH1 D;  4KKD A;  2G7I A;  1H2Q P;  1VVC A;  2UWN A;  1G4F A;  1H04 P;  2W81 A;  2RLQ A;  4LOT A;  5JPM G;  4AYD A;  1SRZ A;  4J38 B;  5FO8 C;  1GKN A;  1VVD A;  2W80 A;  1H03 P;  5HYT B;  3GOV A;  3EJH A;  1OJY A;  2XWB F;  1OJV A;  2EC3 A;  4MUC A;  2LOJ A;  4A5W B;  2XRD A;  1OK9 A;  2RKY A;  2JRA A;  3OED C;  4YNX A;  1O9A A;  1OJW A;  3TVJ A;  1OK2 A;  2JGW A;  1E8B A;  1E5G A;  4AYM A;  1Z92 B;  4FXG G;  4C16 A;  1LY2 A;  4AYI A;  5HYP A;  1MD8 A;  1TPG A;  2CG6 A;  3ZRZ A;  4LOS A;  3OXU D;  5HZP B;  3RJ3 D;  1OK1 A;  1QUB A;  3NFP I;  1TPN A;  1U5M A;  2IZ4 A;  4JHS A;  2V8E A;  2CKU A;  2RKZ A;  3ZD2 A;  1HFH A;  1GPZ A;  1UOT P;  1ZJK A;  3GXE A;  2A55 A;  3KXV A;  3SW0 X;  3ZD1 A;  1ELV A;  3IX0 A;  2O39 C;  1QO6 A;  2YRA A;  3INB C;  3KZJ A;  1E88 A;  1HCC A;  1QGB A;  3M7P A;  5HYU B;  1PPQ A;  1SS2 A;  3MQL A;  1CKL A;  4WJG 2;  4DJZ A;  1FBR A;  2XWJ I;  4B2R A;  4K12 A;  1GKG A;  1NWV A;  2MCZ A;  1HFI A;  2CG7 A;  4PZ5 A;  4B2S A;  5I0Q B;  1C1Z A;  2BZM A;  4IGD A;  2RLP A; 
#chains in the Genus database with same CATH topology
 2ERJ A;  3ERB A;  4F4O C;  2EHF A;  3OP8 A;  2XQW C;  5DN4 A;  2KRI A;  2IZ3 A;  1Q3X A;  3NJA A;  2WII C;  2KMS A;  2YBY A;  3O8E B;  1GHQ B;  2QY0 A;  4ONT D;  1H2P P;  4YIZ A;  3IU3 I;  3F6K A;  3FGR A;  4AYE A;  3T5O A;  1OK3 A;  4CSY A;  2B5I D;  3ZLD A;  1MD7 A;  1G4G A;  2RL0 A;  2XRB A;  3L89 M;  3CAL A;  2JGX A;  3R62 A;  3WSY A;  1TPM A;  2MCY A;  4MSL A;  4KKD A;  4ZH1 D;  2G7I A;  1H2Q P;  1VVC A;  2UWN A;  1G4F A;  1H04 P;  1RLH A;  2W81 A;  2RLQ A;  4LOT A;  5JPM G;  4AYD A;  1SRZ A;  4J38 B;  5FO8 C;  1GKN A;  1VVD A;  2W80 A;  1H03 P;  5HYT B;  3GOV A;  3EJH A;  1OJY A;  2XWB F;  1OJV A;  2EC3 A;  4MUC A;  2LOJ A;  4A5W B;  2XRD A;  4N7E A;  1OK9 A;  2RKY A;  2ZYC A;  2JRA A;  3OED C;  4YNX A;  1O9A A;  2Y8S A;  1OJW A;  3TVJ A;  1OK2 A;  2JGW A;  1E8B A;  1E5G A;  4AYM A;  1Z92 B;  4FXG G;  4C16 A;  1LY2 A;  4AYI A;  2Y8R A;  5HYP A;  1MD8 A;  1TPG A;  2CG6 A;  3ZRZ A;  4LOS A;  3ZLE A;  3CI0 J;  3OXU D;  5HZP B;  3RJ3 D;  1OK1 A;  1QUB A;  3NFP I;  1TPN A;  1U5M A;  2IZ4 A;  2Y8T A;  2V8E A;  4JHS A;  4BWC A;  2CKU A;  2RKZ A;  5DN5 A;  3ZD2 A;  1HFH A;  3WSX A;  1GPZ A;  4PO7 A;  1UOT P;  1ZJK A;  3GXE A;  2A55 A;  3KXV A;  3SW0 X;  3ZD1 A;  1ELV A;  3IX0 A;  2O39 C;  1QO6 A;  2YRA A;  3INB C;  3KZJ A;  1E88 A;  1HCC A;  1QGB A;  3M7P A;  5HYU B;  1PPQ A;  1SS2 A;  3MQL A;  3VWO A;  1CKL A;  4WJG 2;  4DJZ A;  1FBR A;  2XWJ I;  4B2R A;  4K12 A;  2X2Z A;  1GKG A;  1NWV A;  2MCZ A;  1HFI A;  2CG7 A;  4PZ5 A;  2I2L A;  4APL A;  3FGT A;  4B2S A;  3K3T A;  5I0Q B;  1C1Z A;  2BZM A;  4IGD A;  2RLP A; 
#chains in the Genus database with same CATH homology
 2ERJ A;  3ERB A;  4F4O C;  2EHF A;  3OP8 A;  2XQW C;  2KRI A;  2IZ3 A;  1Q3X A;  2WII C;  2KMS A;  2YBY A;  3O8E B;  1GHQ B;  2QY0 A;  4ONT D;  1H2P P;  3IU3 I;  4AYE A;  3T5O A;  1OK3 A;  4CSY A;  2B5I D;  1MD7 A;  1G4G A;  2RL0 A;  2XRB A;  3L89 M;  3CAL A;  2JGX A;  3R62 A;  1TPM A;  2MCY A;  4ZH1 D;  4KKD A;  2G7I A;  1H2Q P;  1VVC A;  2UWN A;  1G4F A;  1H04 P;  2W81 A;  2RLQ A;  4LOT A;  5JPM G;  4AYD A;  1SRZ A;  4J38 B;  5FO8 C;  1GKN A;  1VVD A;  2W80 A;  1H03 P;  5HYT B;  3GOV A;  3EJH A;  1OJY A;  2XWB F;  1OJV A;  2EC3 A;  4MUC A;  2LOJ A;  4A5W B;  2XRD A;  1OK9 A;  2RKY A;  2JRA A;  3OED C;  4YNX A;  1O9A A;  1OJW A;  3TVJ A;  1OK2 A;  2JGW A;  1E8B A;  1E5G A;  4AYM A;  1Z92 B;  4FXG G;  4C16 A;  1LY2 A;  4AYI A;  5HYP A;  1MD8 A;  1TPG A;  2CG6 A;  3ZRZ A;  4LOS A;  3OXU D;  5HZP B;  3RJ3 D;  1OK1 A;  1QUB A;  3NFP I;  1TPN A;  1U5M A;  2IZ4 A;  4JHS A;  2V8E A;  2CKU A;  2RKZ A;  3ZD2 A;  1HFH A;  1GPZ A;  1UOT P;  1ZJK A;  3GXE A;  2A55 A;  3KXV A;  3SW0 X;  3ZD1 A;  1ELV A;  3IX0 A;  2O39 C;  1QO6 A;  2YRA A;  3INB C;  3KZJ A;  1E88 A;  1HCC A;  1QGB A;  3M7P A;  5HYU B;  1PPQ A;  1SS2 A;  3MQL A;  1CKL A;  4WJG 2;  4DJZ A;  1FBR A;  2XWJ I;  4B2R A;  4K12 A;  1GKG A;  1NWV A;  2MCZ A;  1HFI A;  2CG7 A;  4PZ5 A;  4B2S A;  5I0Q B;  1C1Z A;  2BZM A;  4IGD A;  2RLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...