1C1ZA

Crystal structure of human beta-2-glycoprotein-i (apolipoprotein-h)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
326
structure length
326
Chain Sequence
b'GRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKLPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA2-GLYCOPROTEIN-I
publication title Crystal structure of human beta2-glycoprotein I: implications for phospholipid binding and the antiphospholipid syndrome.
pubmed doi rcsb
molecule tags Signaling protein
total genus 56
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 1999-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF09014 Sushi_2 Beta-2-glycoprotein-1 fifth domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1c1zA05
1SRZA 1TPNA 2JRAA 1SS2A 4WJG2 3OXUD 3ZD1A 1VVDA 4F4OC 1O9AA 2XQWC 1UOTP 1PPQA 3TVJA 4ZH1D 1GHQB 4B2RA 3EJHA 3SW0X 1OK9A 1E5GA 5HYUB 1ELVA 1OK3A 2A55A 4IGDA 1H03P 2KRIA 2IZ3A 2XWBF 2RKZA 1G4GA 2YBYA 4AYMA 1QUBA 2MCYA 3OP8A 4MUCA 2MCZA 2UWNA 2XRDA 3IU3I 2KMSA 2CKUA 1LY2A 2V8EA 3O8EB 4CSYA 1OJYA 3ZD2A 1ZJKA 2W81A 1H2PP 1G4FA 2LOJA 2B5ID 4FXGG 2WIIC 1Z92B 3L89M 1TPMA 2IZ4A 2XRBA 3KZJA 2BZMA 2QY0A 3CALA 4JHSA 1QGBA 2EHFA 3R62A 4LOSA 1H04P 2XWJI 3KXVA 1GKGA 1OK2A 1FBRA 2JGWA 3OEDC 4J38B 5HYTB 2RKYA 4AYIA 1CKLA 2JGXA 4DJZA 1Q3XA 2CG6A 3M7PA 1HFIA 2RL0A 3ZRZA 4YNXA 4B2SA 5JPMG 1GPZA 5I0QB 1GKNA 1E8BA 1U5MA 4AYEA 1MD7A 3T5OA 1HCCA 4PZ5A 3MQLA 1OJWA 1TPGA 1MD8A 2YRAA 2RLQA 1OK1A 4C16A 5HZPB 1C1ZA 3INBC 2G7IA 4K12A 3IX0A 1E88A 2EC3A 5FO8C 3GXEA 1NWVA 2ERJA 1OJVA 3NFPI 5HYPA 4A5WB 3ERBA 2CG7A 2W80A 1H2QP 2O39C 4LOTA 4AYDA 1VVCA 3GOVA 4ONTD 3RJ3D 2RLPA 1QO6A 1HFHA 4KKDA
chains in the Genus database with same CATH superfamily
1SRZA 1TPNA 2JRAA 1RLHA 2X2ZA 1SS2A 4WJG2 3OXUD 4MSLA 3ZD1A 1VVDA 4F4OC 1O9AA 2XQWC 1UOTP 3VWOA 1PPQA 3TVJA 4ZH1D 1GHQB 4B2RA 3EJHA 3SW0X 2Y8TA 1OK9A 1E5GA 5HYUB 1ELVA 1OK3A 5DN4A 2A55A 4IGDA 1H03P 2KRIA 2IZ3A 2XWBF 2RKZA 1G4GA 3NJAA 2YBYA 3FGTA 4AYMA 1QUBA 2MCYA 3OP8A 4MUCA 5DN5A 2MCZA 2UWNA 2XRDA 3IU3I 2KMSA 2CKUA 1LY2A 2V8EA 3O8EB 4CSYA 1OJYA 3ZD2A 1ZJKA 3ZLDA 2W81A 1H2PP 1G4FA 2LOJA 2B5ID 4FXGG 2WIIC 1Z92B 3L89M 1TPMA 2IZ4A 2XRBA 3KZJA 2BZMA 2QY0A 3CALA 4JHSA 1QGBA 2EHFA 3R62A 3CI0J 2Y8RA 4LOSA 1H04P 2XWJI 3KXVA 1GKGA 1OK2A 1FBRA 3FGRA 2JGWA 3OEDC 4J38B 5HYTB 2RKYA 4AYIA 1CKLA 2JGXA 4DJZA 1Q3XA 2CG6A 3M7PA 1HFIA 2RL0A 3ZRZA 4YNXA 4B2SA 5JPMG 4APLA 1GPZA 4YIZA 5I0QB 3WSYA 1GKNA 1E8BA 4PO7A 3WSXA 1U5MA 3F6KA 4AYEA 1MD7A 3T5OA 1HCCA 4PZ5A 3MQLA 2I2LA 4N7EA 1OJWA 1TPGA 1MD8A 2YRAA 3K3TA 2RLQA 1OK1A 4C16A 5HZPB 1C1ZA 3INBC 2G7IA 4K12A 2Y8SA 2ZYCA 3IX0A 1E88A 2EC3A 5FO8C 4BWCA 3GXEA 1NWVA 2ERJA 1OJVA 3NFPI 5HYPA 4A5WB 3ERBA 2CG7A 2W80A 1H2QP 3ZLEA 2O39C 4LOTA 4AYDA 1VVCA 3GOVA 4ONTD 3RJ3D 2RLPA 1QO6A 1HFHA 4KKDA
chains in the Genus database with same CATH topology
1SRZA 1TPNA 2JRAA 1SS2A 4WJG2 3OXUD 3ZD1A 1VVDA 4F4OC 1O9AA 2XQWC 1UOTP 1PPQA 3TVJA 4ZH1D 1GHQB 4B2RA 3EJHA 3SW0X 1OK9A 1E5GA 5HYUB 1ELVA 1OK3A 2A55A 4IGDA 1H03P 2KRIA 2IZ3A 2XWBF 2RKZA 1G4GA 2YBYA 4AYMA 1QUBA 2MCYA 3OP8A 4MUCA 2MCZA 2UWNA 2XRDA 3IU3I 2KMSA 2CKUA 1LY2A 2V8EA 3O8EB 4CSYA 1OJYA 3ZD2A 1ZJKA 2W81A 1H2PP 1G4FA 2LOJA 2B5ID 4FXGG 2WIIC 1Z92B 3L89M 1TPMA 2IZ4A 2XRBA 3KZJA 2BZMA 2QY0A 3CALA 4JHSA 1QGBA 2EHFA 3R62A 4LOSA 1H04P 2XWJI 3KXVA 1GKGA 1OK2A 1FBRA 2JGWA 3OEDC 4J38B 5HYTB 2RKYA 4AYIA 1CKLA 2JGXA 4DJZA 1Q3XA 2CG6A 3M7PA 1HFIA 2RL0A 3ZRZA 4YNXA 4B2SA 5JPMG 1GPZA 5I0QB 1GKNA 1E8BA 1U5MA 4AYEA 1MD7A 3T5OA 1HCCA 4PZ5A 3MQLA 1OJWA 1TPGA 1MD8A 2YRAA 2RLQA 1OK1A 4C16A 5HZPB 1C1ZA 3INBC 2G7IA 4K12A 3IX0A 1E88A 2EC3A 5FO8C 3GXEA 1NWVA 2ERJA 1OJVA 3NFPI 5HYPA 4A5WB 3ERBA 2CG7A 2W80A 1H2QP 2O39C 4LOTA 4AYDA 1VVCA 3GOVA 4ONTD 3RJ3D 2RLPA 1QO6A 1HFHA 4KKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRZ A;  1TPN A;  2JRA A;  1SS2 A;  4WJG 2;  3OXU D;  3ZD1 A;  1VVD A;  4F4O C;  1O9A A;  2XQW C;  1UOT P;  1PPQ A;  3TVJ A;  4ZH1 D;  1GHQ B;  4B2R A;  3EJH A;  3SW0 X;  1OK9 A;  1E5G A;  5HYU B;  1ELV A;  1OK3 A;  2A55 A;  4IGD A;  1H03 P;  2KRI A;  2IZ3 A;  2XWB F;  2RKZ A;  1G4G A;  2YBY A;  4AYM A;  1QUB A;  2MCY A;  3OP8 A;  4MUC A;  2MCZ A;  2UWN A;  2XRD A;  3IU3 I;  2KMS A;  2CKU A;  1LY2 A;  2V8E A;  3O8E B;  4CSY A;  1OJY A;  3ZD2 A;  1ZJK A;  2W81 A;  1H2P P;  1G4F A;  2LOJ A;  2B5I D;  4FXG G;  2WII C;  1Z92 B;  3L89 M;  1TPM A;  2IZ4 A;  2XRB A;  3KZJ A;  2BZM A;  2QY0 A;  3CAL A;  4JHS A;  1QGB A;  2EHF A;  3R62 A;  4LOS A;  1H04 P;  2XWJ I;  3KXV A;  1GKG A;  1OK2 A;  1FBR A;  2JGW A;  3OED C;  4J38 B;  5HYT B;  2RKY A;  4AYI A;  1CKL A;  2JGX A;  4DJZ A;  1Q3X A;  2CG6 A;  3M7P A;  1HFI A;  2RL0 A;  3ZRZ A;  4YNX A;  4B2S A;  5JPM G;  1GPZ A;  5I0Q B;  1GKN A;  1E8B A;  1U5M A;  4AYE A;  1MD7 A;  3T5O A;  1HCC A;  4PZ5 A;  3MQL A;  1OJW A;  1TPG A;  1MD8 A;  2YRA A;  2RLQ A;  1OK1 A;  4C16 A;  5HZP B;  1C1Z A;  3INB C;  2G7I A;  4K12 A;  3IX0 A;  1E88 A;  2EC3 A;  5FO8 C;  3GXE A;  1NWV A;  2ERJ A;  1OJV A;  3NFP I;  5HYP A;  4A5W B;  3ERB A;  2CG7 A;  2W80 A;  1H2Q P;  2O39 C;  4LOT A;  4AYD A;  1VVC A;  3GOV A;  4ONT D;  3RJ3 D;  2RLP A;  1QO6 A;  1HFH A;  4KKD A; 
#chains in the Genus database with same CATH topology
 1SRZ A;  1TPN A;  2JRA A;  1RLH A;  2X2Z A;  1SS2 A;  4WJG 2;  3OXU D;  4MSL A;  3ZD1 A;  1VVD A;  4F4O C;  1O9A A;  2XQW C;  1UOT P;  3VWO A;  1PPQ A;  3TVJ A;  4ZH1 D;  1GHQ B;  4B2R A;  3EJH A;  3SW0 X;  2Y8T A;  1OK9 A;  1E5G A;  5HYU B;  1ELV A;  1OK3 A;  5DN4 A;  2A55 A;  4IGD A;  1H03 P;  2KRI A;  2IZ3 A;  2XWB F;  2RKZ A;  1G4G A;  3NJA A;  2YBY A;  3FGT A;  4AYM A;  1QUB A;  2MCY A;  3OP8 A;  4MUC A;  5DN5 A;  2MCZ A;  2UWN A;  2XRD A;  3IU3 I;  2KMS A;  2CKU A;  1LY2 A;  2V8E A;  3O8E B;  4CSY A;  1OJY A;  3ZD2 A;  1ZJK A;  3ZLD A;  2W81 A;  1H2P P;  1G4F A;  2LOJ A;  2B5I D;  4FXG G;  2WII C;  1Z92 B;  3L89 M;  1TPM A;  2IZ4 A;  2XRB A;  3KZJ A;  2BZM A;  2QY0 A;  3CAL A;  4JHS A;  1QGB A;  2EHF A;  3R62 A;  3CI0 J;  2Y8R A;  4LOS A;  1H04 P;  2XWJ I;  3KXV A;  1GKG A;  1OK2 A;  1FBR A;  3FGR A;  2JGW A;  3OED C;  4J38 B;  5HYT B;  2RKY A;  4AYI A;  1CKL A;  2JGX A;  4DJZ A;  1Q3X A;  2CG6 A;  3M7P A;  1HFI A;  2RL0 A;  3ZRZ A;  4YNX A;  4B2S A;  5JPM G;  4APL A;  1GPZ A;  4YIZ A;  5I0Q B;  3WSY A;  1GKN A;  1E8B A;  4PO7 A;  3WSX A;  1U5M A;  3F6K A;  4AYE A;  1MD7 A;  3T5O A;  1HCC A;  4PZ5 A;  3MQL A;  2I2L A;  4N7E A;  1OJW A;  1TPG A;  1MD8 A;  2YRA A;  3K3T A;  2RLQ A;  1OK1 A;  4C16 A;  5HZP B;  1C1Z A;  3INB C;  2G7I A;  4K12 A;  2Y8S A;  2ZYC A;  3IX0 A;  1E88 A;  2EC3 A;  5FO8 C;  4BWC A;  3GXE A;  1NWV A;  2ERJ A;  1OJV A;  3NFP I;  5HYP A;  4A5W B;  3ERB A;  2CG7 A;  2W80 A;  1H2Q P;  3ZLE A;  2O39 C;  4LOT A;  4AYD A;  1VVC A;  3GOV A;  4ONT D;  3RJ3 D;  2RLP A;  1QO6 A;  1HFH A;  4KKD A; 
#chains in the Genus database with same CATH homology
 1SRZ A;  1TPN A;  2JRA A;  1SS2 A;  4WJG 2;  3OXU D;  3ZD1 A;  1VVD A;  4F4O C;  1O9A A;  2XQW C;  1UOT P;  1PPQ A;  3TVJ A;  4ZH1 D;  1GHQ B;  4B2R A;  3EJH A;  3SW0 X;  1OK9 A;  1E5G A;  5HYU B;  1ELV A;  1OK3 A;  2A55 A;  4IGD A;  1H03 P;  2KRI A;  2IZ3 A;  2XWB F;  2RKZ A;  1G4G A;  2YBY A;  4AYM A;  1QUB A;  2MCY A;  3OP8 A;  4MUC A;  2MCZ A;  2UWN A;  2XRD A;  3IU3 I;  2KMS A;  2CKU A;  1LY2 A;  2V8E A;  3O8E B;  4CSY A;  1OJY A;  3ZD2 A;  1ZJK A;  2W81 A;  1H2P P;  1G4F A;  2LOJ A;  2B5I D;  4FXG G;  2WII C;  1Z92 B;  3L89 M;  1TPM A;  2IZ4 A;  2XRB A;  3KZJ A;  2BZM A;  2QY0 A;  3CAL A;  4JHS A;  1QGB A;  2EHF A;  3R62 A;  4LOS A;  1H04 P;  2XWJ I;  3KXV A;  1GKG A;  1OK2 A;  1FBR A;  2JGW A;  3OED C;  4J38 B;  5HYT B;  2RKY A;  4AYI A;  1CKL A;  2JGX A;  4DJZ A;  1Q3X A;  2CG6 A;  3M7P A;  1HFI A;  2RL0 A;  3ZRZ A;  4YNX A;  4B2S A;  5JPM G;  1GPZ A;  5I0Q B;  1GKN A;  1E8B A;  1U5M A;  4AYE A;  1MD7 A;  3T5O A;  1HCC A;  4PZ5 A;  3MQL A;  1OJW A;  1TPG A;  1MD8 A;  2YRA A;  2RLQ A;  1OK1 A;  4C16 A;  5HZP B;  1C1Z A;  3INB C;  2G7I A;  4K12 A;  3IX0 A;  1E88 A;  2EC3 A;  5FO8 C;  3GXE A;  1NWV A;  2ERJ A;  1OJV A;  3NFP I;  5HYP A;  4A5W B;  3ERB A;  2CG7 A;  2W80 A;  1H2Q P;  2O39 C;  4LOT A;  4AYD A;  1VVC A;  3GOV A;  4ONT D;  3RJ3 D;  2RLP A;  1QO6 A;  1HFH A;  4KKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...