2RLPA

Nmr structure of ccp modules 1-2 of complement factor h
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
123
Chain Sequence
DCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structure of the N-terminal region of complement factor H and conformational implications of disease-linked sequence variations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlpA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlpA01
1O9AA 2YBYA 1GHQB 2BZMA 2EHFA 2RKZA 1ZJKA 1TPMA 4AYEA 2QY0A 2YRAA 3ZRZA 4B2RA 2XRBA 1OK1A 4PZ5A 2CG7A 3TVJA 1UOTP 1OK9A 3OXUD 1NWVA 2XWBF 4CSYA 3IU3I 2CG6A 1OK3A 2IZ3A 1H2PP 5JPMG 2O39C 2JGXA 1C1ZA 1TPGA 4KKDA 2IZ4A 4JHSA 5HYTB 1E88A 4AYDA 3GOVA 4AYIA 4ZH1D 1HCCA 2MCYA 1OJVA 2A55A 4WJG2 3SW0X 2RLPA 1MD8A 3CALA 2UWNA 1H04P 4IGDA 1Q3XA 3KZJA 4J38B 5HZPB 1SS2A 3O8EB 1G4FA 1HFHA 1H03P 1Z92B 1HFIA 1SRZA 1GPZA 1GKGA 1MD7A 2RLQA 2ERJA 3L89M 4K12A 1LY2A 2XRDA 2RKYA 1TPNA 1ELVA 4F4OC 2W80A 3R62A 3OP8A 3RJ3D 1GKNA 2XWJI 2CKUA 3ZD2A 4ONTD 3ERBA 3GXEA 2WIIC 4LOSA 1E8BA 3NFPI 4DJZA 3INBC 5HYPA 5I0QB 1G4GA 2RL0A 1E5GA 2MCZA 2XQWC 4C16A 4MUCA 2JGWA 3KXVA 3EJHA 3T5OA 1OJYA 1PPQA 1VVCA 2KRIA 3OEDC 1QGBA 1CKLA 5HYUB 2B5ID 2LOJA 1QUBA 1H2QP 2EC3A 2G7IA 1U5MA 1QO6A 3ZD1A 4AYMA 1OK2A 2V8EA 5FO8C 3IX0A 4LOTA 4FXGG 2JRAA 3M7PA 4B2SA 1FBRA 1OJWA 2W81A 4YNXA 3MQLA 2KMSA 1VVDA 4A5WB
chains in the Genus database with same CATH superfamily
1O9AA 2YBYA 1GHQB 2BZMA 2EHFA 2RKZA 1ZJKA 1TPMA 4AYEA 5DN4A 2QY0A 2YRAA 3ZRZA 4B2RA 2Y8SA 2I2LA 2XRBA 1OK1A 4PZ5A 2Y8TA 2CG7A 5DN5A 3F6KA 3TVJA 1UOTP 1RLHA 1OK9A 3OXUD 1NWVA 4MSLA 2XWBF 4CSYA 3IU3I 2CG6A 3K3TA 1OK3A 2IZ3A 1H2PP 4N7EA 5JPMG 2O39C 2JGXA 1C1ZA 1TPGA 4KKDA 2IZ4A 4JHSA 2Y8RA 5HYTB 1E88A 4AYDA 2X2ZA 3GOVA 4AYIA 4ZH1D 4YIZA 1HCCA 2MCYA 1OJVA 2A55A 4WJG2 3SW0X 2RLPA 2ZYCA 3NJAA 1MD8A 3CALA 2UWNA 1H04P 3CI0J 4IGDA 1Q3XA 3KZJA 4J38B 3ZLEA 5HZPB 1SS2A 4APLA 3O8EB 1G4FA 1HFHA 1H03P 1Z92B 1HFIA 1SRZA 1GPZA 1GKGA 1MD7A 2RLQA 2ERJA 3L89M 4K12A 3WSYA 4BWCA 3VWOA 1LY2A 2XRDA 2RKYA 1TPNA 1ELVA 4F4OC 2W80A 3R62A 3OP8A 3RJ3D 1GKNA 2XWJI 2CKUA 3ZD2A 4ONTD 3ERBA 3GXEA 2WIIC 4LOSA 1E8BA 3NFPI 4DJZA 3INBC 5HYPA 5I0QB 3FGRA 1G4GA 2RL0A 1E5GA 2MCZA 2XQWC 4C16A 4MUCA 2JGWA 3KXVA 3EJHA 3T5OA 1OJYA 3FGTA 1PPQA 1VVCA 4PO7A 3WSXA 2KRIA 3OEDC 1QGBA 1CKLA 5HYUB 2B5ID 2LOJA 1QUBA 1H2QP 2EC3A 2G7IA 3ZLDA 1U5MA 1QO6A 3ZD1A 4AYMA 1OK2A 2V8EA 5FO8C 3IX0A 4LOTA 4FXGG 2JRAA 3M7PA 4B2SA 1FBRA 1OJWA 2W81A 4YNXA 3MQLA 2KMSA 1VVDA 4A5WB
chains in the Genus database with same CATH topology
1O9AA 2YBYA 1GHQB 2BZMA 2EHFA 2RKZA 1ZJKA 1TPMA 4AYEA 2QY0A 2YRAA 3ZRZA 4B2RA 2XRBA 1OK1A 4PZ5A 2CG7A 3TVJA 1UOTP 1OK9A 3OXUD 1NWVA 2XWBF 4CSYA 3IU3I 2CG6A 1OK3A 2IZ3A 1H2PP 5JPMG 2O39C 2JGXA 1C1ZA 1TPGA 4KKDA 2IZ4A 4JHSA 5HYTB 1E88A 4AYDA 3GOVA 4AYIA 4ZH1D 1HCCA 2MCYA 1OJVA 2A55A 4WJG2 3SW0X 2RLPA 1MD8A 3CALA 2UWNA 1H04P 4IGDA 1Q3XA 3KZJA 4J38B 5HZPB 1SS2A 3O8EB 1G4FA 1HFHA 1H03P 1Z92B 1HFIA 1SRZA 1GPZA 1GKGA 1MD7A 2RLQA 2ERJA 3L89M 4K12A 1LY2A 2XRDA 2RKYA 1TPNA 1ELVA 4F4OC 2W80A 3R62A 3OP8A 3RJ3D 1GKNA 2XWJI 2CKUA 3ZD2A 4ONTD 3ERBA 3GXEA 2WIIC 4LOSA 1E8BA 3NFPI 4DJZA 3INBC 5HYPA 5I0QB 1G4GA 2RL0A 1E5GA 2MCZA 2XQWC 4C16A 4MUCA 2JGWA 3KXVA 3EJHA 3T5OA 1OJYA 1PPQA 1VVCA 2KRIA 3OEDC 1QGBA 1CKLA 5HYUB 2B5ID 2LOJA 1QUBA 1H2QP 2EC3A 2G7IA 1U5MA 1QO6A 3ZD1A 4AYMA 1OK2A 2V8EA 5FO8C 3IX0A 4LOTA 4FXGG 2JRAA 3M7PA 4B2SA 1FBRA 1OJWA 2W81A 4YNXA 3MQLA 2KMSA 1VVDA 4A5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9A A;  2YBY A;  1GHQ B;  2BZM A;  2EHF A;  2RKZ A;  1ZJK A;  1TPM A;  4AYE A;  2QY0 A;  2YRA A;  3ZRZ A;  4B2R A;  2XRB A;  1OK1 A;  4PZ5 A;  2CG7 A;  3TVJ A;  1UOT P;  1OK9 A;  3OXU D;  1NWV A;  2XWB F;  4CSY A;  3IU3 I;  2CG6 A;  1OK3 A;  2IZ3 A;  1H2P P;  5JPM G;  2O39 C;  2JGX A;  1C1Z A;  1TPG A;  4KKD A;  2IZ4 A;  4JHS A;  5HYT B;  1E88 A;  4AYD A;  3GOV A;  4AYI A;  4ZH1 D;  1HCC A;  2MCY A;  1OJV A;  2A55 A;  4WJG 2;  3SW0 X;  2RLP A;  1MD8 A;  3CAL A;  2UWN A;  1H04 P;  4IGD A;  1Q3X A;  3KZJ A;  4J38 B;  5HZP B;  1SS2 A;  3O8E B;  1G4F A;  1HFH A;  1H03 P;  1Z92 B;  1HFI A;  1SRZ A;  1GPZ A;  1GKG A;  1MD7 A;  2RLQ A;  2ERJ A;  3L89 M;  4K12 A;  1LY2 A;  2XRD A;  2RKY A;  1TPN A;  1ELV A;  4F4O C;  2W80 A;  3R62 A;  3OP8 A;  3RJ3 D;  1GKN A;  2XWJ I;  2CKU A;  3ZD2 A;  4ONT D;  3ERB A;  3GXE A;  2WII C;  4LOS A;  1E8B A;  3NFP I;  4DJZ A;  3INB C;  5HYP A;  5I0Q B;  1G4G A;  2RL0 A;  1E5G A;  2MCZ A;  2XQW C;  4C16 A;  4MUC A;  2JGW A;  3KXV A;  3EJH A;  3T5O A;  1OJY A;  1PPQ A;  1VVC A;  2KRI A;  3OED C;  1QGB A;  1CKL A;  5HYU B;  2B5I D;  2LOJ A;  1QUB A;  1H2Q P;  2EC3 A;  2G7I A;  1U5M A;  1QO6 A;  3ZD1 A;  4AYM A;  1OK2 A;  2V8E A;  5FO8 C;  3IX0 A;  4LOT A;  4FXG G;  2JRA A;  3M7P A;  4B2S A;  1FBR A;  1OJW A;  2W81 A;  4YNX A;  3MQL A;  2KMS A;  1VVD A;  4A5W B; 
#chains in the Genus database with same CATH topology
 1O9A A;  2YBY A;  1GHQ B;  2BZM A;  2EHF A;  2RKZ A;  1ZJK A;  1TPM A;  4AYE A;  5DN4 A;  2QY0 A;  2YRA A;  3ZRZ A;  4B2R A;  2Y8S A;  2I2L A;  2XRB A;  1OK1 A;  4PZ5 A;  2Y8T A;  2CG7 A;  5DN5 A;  3F6K A;  3TVJ A;  1UOT P;  1RLH A;  1OK9 A;  3OXU D;  1NWV A;  4MSL A;  2XWB F;  4CSY A;  3IU3 I;  2CG6 A;  3K3T A;  1OK3 A;  2IZ3 A;  1H2P P;  4N7E A;  5JPM G;  2O39 C;  2JGX A;  1C1Z A;  1TPG A;  4KKD A;  2IZ4 A;  4JHS A;  2Y8R A;  5HYT B;  1E88 A;  4AYD A;  2X2Z A;  3GOV A;  4AYI A;  4ZH1 D;  4YIZ A;  1HCC A;  2MCY A;  1OJV A;  2A55 A;  4WJG 2;  3SW0 X;  2RLP A;  2ZYC A;  3NJA A;  1MD8 A;  3CAL A;  2UWN A;  1H04 P;  3CI0 J;  4IGD A;  1Q3X A;  3KZJ A;  4J38 B;  3ZLE A;  5HZP B;  1SS2 A;  4APL A;  3O8E B;  1G4F A;  1HFH A;  1H03 P;  1Z92 B;  1HFI A;  1SRZ A;  1GPZ A;  1GKG A;  1MD7 A;  2RLQ A;  2ERJ A;  3L89 M;  4K12 A;  3WSY A;  4BWC A;  3VWO A;  1LY2 A;  2XRD A;  2RKY A;  1TPN A;  1ELV A;  4F4O C;  2W80 A;  3R62 A;  3OP8 A;  3RJ3 D;  1GKN A;  2XWJ I;  2CKU A;  3ZD2 A;  4ONT D;  3ERB A;  3GXE A;  2WII C;  4LOS A;  1E8B A;  3NFP I;  4DJZ A;  3INB C;  5HYP A;  5I0Q B;  3FGR A;  1G4G A;  2RL0 A;  1E5G A;  2MCZ A;  2XQW C;  4C16 A;  4MUC A;  2JGW A;  3KXV A;  3EJH A;  3T5O A;  1OJY A;  3FGT A;  1PPQ A;  1VVC A;  4PO7 A;  3WSX A;  2KRI A;  3OED C;  1QGB A;  1CKL A;  5HYU B;  2B5I D;  2LOJ A;  1QUB A;  1H2Q P;  2EC3 A;  2G7I A;  3ZLD A;  1U5M A;  1QO6 A;  3ZD1 A;  4AYM A;  1OK2 A;  2V8E A;  5FO8 C;  3IX0 A;  4LOT A;  4FXG G;  2JRA A;  3M7P A;  4B2S A;  1FBR A;  1OJW A;  2W81 A;  4YNX A;  3MQL A;  2KMS A;  1VVD A;  4A5W B; 
#chains in the Genus database with same CATH homology
 1O9A A;  2YBY A;  1GHQ B;  2BZM A;  2EHF A;  2RKZ A;  1ZJK A;  1TPM A;  4AYE A;  2QY0 A;  2YRA A;  3ZRZ A;  4B2R A;  2XRB A;  1OK1 A;  4PZ5 A;  2CG7 A;  3TVJ A;  1UOT P;  1OK9 A;  3OXU D;  1NWV A;  2XWB F;  4CSY A;  3IU3 I;  2CG6 A;  1OK3 A;  2IZ3 A;  1H2P P;  5JPM G;  2O39 C;  2JGX A;  1C1Z A;  1TPG A;  4KKD A;  2IZ4 A;  4JHS A;  5HYT B;  1E88 A;  4AYD A;  3GOV A;  4AYI A;  4ZH1 D;  1HCC A;  2MCY A;  1OJV A;  2A55 A;  4WJG 2;  3SW0 X;  2RLP A;  1MD8 A;  3CAL A;  2UWN A;  1H04 P;  4IGD A;  1Q3X A;  3KZJ A;  4J38 B;  5HZP B;  1SS2 A;  3O8E B;  1G4F A;  1HFH A;  1H03 P;  1Z92 B;  1HFI A;  1SRZ A;  1GPZ A;  1GKG A;  1MD7 A;  2RLQ A;  2ERJ A;  3L89 M;  4K12 A;  1LY2 A;  2XRD A;  2RKY A;  1TPN A;  1ELV A;  4F4O C;  2W80 A;  3R62 A;  3OP8 A;  3RJ3 D;  1GKN A;  2XWJ I;  2CKU A;  3ZD2 A;  4ONT D;  3ERB A;  3GXE A;  2WII C;  4LOS A;  1E8B A;  3NFP I;  4DJZ A;  3INB C;  5HYP A;  5I0Q B;  1G4G A;  2RL0 A;  1E5G A;  2MCZ A;  2XQW C;  4C16 A;  4MUC A;  2JGW A;  3KXV A;  3EJH A;  3T5O A;  1OJY A;  1PPQ A;  1VVC A;  2KRI A;  3OED C;  1QGB A;  1CKL A;  5HYU B;  2B5I D;  2LOJ A;  1QUB A;  1H2Q P;  2EC3 A;  2G7I A;  1U5M A;  1QO6 A;  3ZD1 A;  4AYM A;  1OK2 A;  2V8E A;  5FO8 C;  3IX0 A;  4LOT A;  4FXG G;  2JRA A;  3M7P A;  4B2S A;  1FBR A;  1OJW A;  2W81 A;  4YNX A;  3MQL A;  2KMS A;  1VVD A;  4A5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...