2RLPA

Nmr structure of ccp modules 1-2 of complement factor h
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
123
structure length
123
Chain Sequence
DCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement factor H
publication title Structure of the N-terminal region of complement factor H and conformational implications of disease-linked sequence variations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2007-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlpA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2rlpA01
4JHSA 3MQLA 4B2RA 1TPGA 1O9AA 2WIIC 2XQWC 1E88A 1OK1A 3M7PA 4A5WB 2XWJI 4MUCA 2JRAA 3OP8A 5FO8C 3T5OA 4AYEA 4J38B 1NWVA 1GPZA 4KKDA 3TVJA 1OK3A 4B2SA 4ZH1D 3R62A 1GHQB 3GXEA 4F4OC 1ZJKA 3OXUD 3SW0X 1GKGA 1SS2A 1H2QP 2KRIA 3KXVA 2RLPA 1E8BA 1U5MA 1C1ZA 1MD7A 2ERJA 2IZ4A 3KZJA 1OJYA 2YRAA 2CG7A 1Z92B 4IGDA 1TPMA 2B5ID 2BZMA 5HYTB 1VVCA 1H04P 3OEDC 1UOTP 1LY2A 1HFHA 4CSYA 3L89M 2XRBA 2CG6A 1MD8A 4YNXA 3EJHA 1Q3XA 2V8EA 1TPNA 3GOVA 4LOSA 2MCZA 3O8EB 1HFIA 4AYIA 2LOJA 5I0QB 1H03P 3INBC 4PZ5A 1HCCA 2G7IA 5HZPB 3ERBA 2EC3A 2JGWA 3IU3I 5HYPA 1VVDA 2W81A 3ZD1A 1GKNA 5JPMG 2IZ3A 2XWBF 2QY0A 1OJVA 2W80A 4AYMA 2O39C 1G4GA 1G4FA 1ELVA 2RL0A 1FBRA 4LOTA 2RKZA 4ONTD 4FXGG 2RKYA 4DJZA 1SRZA 4AYDA 1QGBA 2UWNA 3RJ3D 3NFPI 1QUBA 3IX0A 2RLQA 1OK2A 2CKUA 1E5GA 4WJG2 1CKLA 1H2PP 4K12A 4C16A 1OJWA 2A55A 2YBYA 2JGXA 3CALA 3ZD2A 1OK9A 5HYUB 2KMSA 2XRDA 3ZRZA 1QO6A 2EHFA 2MCYA 1PPQA
chains in the Genus database with same CATH superfamily
4JHSA 3MQLA 3ZLEA 4B2RA 1TPGA 1O9AA 2WIIC 2XQWC 1E88A 1OK1A 1RLHA 3M7PA 4A5WB 2XWJI 4MUCA 2JRAA 3FGRA 3OP8A 3WSXA 5FO8C 3F6KA 3T5OA 3WSYA 4J38B 4AYEA 1NWVA 1GPZA 4KKDA 3TVJA 1OK3A 4B2SA 4ZH1D 3R62A 4YIZA 1GHQB 2ZYCA 4APLA 3GXEA 4F4OC 1ZJKA 3OXUD 3SW0X 1GKGA 1SS2A 1H2QP 2KRIA 3KXVA 2RLPA 1E8BA 1U5MA 1C1ZA 1MD7A 2ERJA 2IZ4A 3KZJA 1OJYA 2YRAA 2CG7A 1Z92B 4IGDA 2I2LA 1TPMA 2B5ID 2BZMA 5HYTB 4N7EA 1VVCA 3FGTA 1H04P 3OEDC 1UOTP 1LY2A 1HFHA 4CSYA 3L89M 2XRBA 2X2ZA 2CG6A 1MD8A 4MSLA 4YNXA 3EJHA 1Q3XA 2V8EA 1TPNA 3GOVA 4LOSA 2MCZA 3O8EB 1HFIA 4AYIA 2LOJA 5I0QB 1H03P 3INBC 4PZ5A 2Y8TA 3CI0J 1HCCA 2G7IA 5DN4A 3ERBA 5HZPB 2EC3A 3ZLDA 2JGWA 4BWCA 3IU3I 5HYPA 1VVDA 2W81A 3ZD1A 1GKNA 5JPMG 2IZ3A 2XWBF 2QY0A 1OJVA 2W80A 4AYMA 2O39C 3VWOA 1G4GA 1G4FA 1ELVA 2RL0A 1FBRA 4LOTA 2RKZA 4ONTD 4FXGG 2RKYA 4DJZA 1SRZA 5DN5A 4AYDA 1QGBA 2UWNA 4PO7A 3RJ3D 3NFPI 1QUBA 3IX0A 2RLQA 1OK2A 2Y8SA 2CKUA 2Y8RA 1E5GA 4WJG2 1CKLA 1H2PP 4K12A 4C16A 1OJWA 2A55A 2YBYA 2JGXA 3CALA 3ZD2A 3K3TA 1OK9A 3NJAA 5HYUB 2KMSA 2XRDA 3ZRZA 1QO6A 2EHFA 2MCYA 1PPQA
chains in the Genus database with same CATH topology
4JHSA 3MQLA 4B2RA 1TPGA 1O9AA 2WIIC 2XQWC 1E88A 1OK1A 3M7PA 4A5WB 2XWJI 4MUCA 2JRAA 3OP8A 5FO8C 3T5OA 4AYEA 4J38B 1NWVA 1GPZA 4KKDA 3TVJA 1OK3A 4B2SA 4ZH1D 3R62A 1GHQB 3GXEA 4F4OC 1ZJKA 3OXUD 3SW0X 1GKGA 1SS2A 1H2QP 2KRIA 3KXVA 2RLPA 1E8BA 1U5MA 1C1ZA 1MD7A 2ERJA 2IZ4A 3KZJA 1OJYA 2YRAA 2CG7A 1Z92B 4IGDA 1TPMA 2B5ID 2BZMA 5HYTB 1VVCA 1H04P 3OEDC 1UOTP 1LY2A 1HFHA 4CSYA 3L89M 2XRBA 2CG6A 1MD8A 4YNXA 3EJHA 1Q3XA 2V8EA 1TPNA 3GOVA 4LOSA 2MCZA 3O8EB 1HFIA 4AYIA 2LOJA 5I0QB 1H03P 3INBC 4PZ5A 1HCCA 2G7IA 5HZPB 3ERBA 2EC3A 2JGWA 3IU3I 5HYPA 1VVDA 2W81A 3ZD1A 1GKNA 5JPMG 2IZ3A 2XWBF 2QY0A 1OJVA 2W80A 4AYMA 2O39C 1G4GA 1G4FA 1ELVA 2RL0A 1FBRA 4LOTA 2RKZA 4ONTD 4FXGG 2RKYA 4DJZA 1SRZA 4AYDA 1QGBA 2UWNA 3RJ3D 3NFPI 1QUBA 3IX0A 2RLQA 1OK2A 2CKUA 1E5GA 4WJG2 1CKLA 1H2PP 4K12A 4C16A 1OJWA 2A55A 2YBYA 2JGXA 3CALA 3ZD2A 1OK9A 5HYUB 2KMSA 2XRDA 3ZRZA 1QO6A 2EHFA 2MCYA 1PPQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHS A;  3MQL A;  4B2R A;  1TPG A;  1O9A A;  2WII C;  2XQW C;  1E88 A;  1OK1 A;  3M7P A;  4A5W B;  2XWJ I;  4MUC A;  2JRA A;  3OP8 A;  5FO8 C;  3T5O A;  4AYE A;  4J38 B;  1NWV A;  1GPZ A;  4KKD A;  3TVJ A;  1OK3 A;  4B2S A;  4ZH1 D;  3R62 A;  1GHQ B;  3GXE A;  4F4O C;  1ZJK A;  3OXU D;  3SW0 X;  1GKG A;  1SS2 A;  1H2Q P;  2KRI A;  3KXV A;  2RLP A;  1E8B A;  1U5M A;  1C1Z A;  1MD7 A;  2ERJ A;  2IZ4 A;  3KZJ A;  1OJY A;  2YRA A;  2CG7 A;  1Z92 B;  4IGD A;  1TPM A;  2B5I D;  2BZM A;  5HYT B;  1VVC A;  1H04 P;  3OED C;  1UOT P;  1LY2 A;  1HFH A;  4CSY A;  3L89 M;  2XRB A;  2CG6 A;  1MD8 A;  4YNX A;  3EJH A;  1Q3X A;  2V8E A;  1TPN A;  3GOV A;  4LOS A;  2MCZ A;  3O8E B;  1HFI A;  4AYI A;  2LOJ A;  5I0Q B;  1H03 P;  3INB C;  4PZ5 A;  1HCC A;  2G7I A;  5HZP B;  3ERB A;  2EC3 A;  2JGW A;  3IU3 I;  5HYP A;  1VVD A;  2W81 A;  3ZD1 A;  1GKN A;  5JPM G;  2IZ3 A;  2XWB F;  2QY0 A;  1OJV A;  2W80 A;  4AYM A;  2O39 C;  1G4G A;  1G4F A;  1ELV A;  2RL0 A;  1FBR A;  4LOT A;  2RKZ A;  4ONT D;  4FXG G;  2RKY A;  4DJZ A;  1SRZ A;  4AYD A;  1QGB A;  2UWN A;  3RJ3 D;  3NFP I;  1QUB A;  3IX0 A;  2RLQ A;  1OK2 A;  2CKU A;  1E5G A;  4WJG 2;  1CKL A;  1H2P P;  4K12 A;  4C16 A;  1OJW A;  2A55 A;  2YBY A;  2JGX A;  3CAL A;  3ZD2 A;  1OK9 A;  5HYU B;  2KMS A;  2XRD A;  3ZRZ A;  1QO6 A;  2EHF A;  2MCY A;  1PPQ A; 
#chains in the Genus database with same CATH topology
 4JHS A;  3MQL A;  3ZLE A;  4B2R A;  1TPG A;  1O9A A;  2WII C;  2XQW C;  1E88 A;  1OK1 A;  1RLH A;  3M7P A;  4A5W B;  2XWJ I;  4MUC A;  2JRA A;  3FGR A;  3OP8 A;  3WSX A;  5FO8 C;  3F6K A;  3T5O A;  3WSY A;  4J38 B;  4AYE A;  1NWV A;  1GPZ A;  4KKD A;  3TVJ A;  1OK3 A;  4B2S A;  4ZH1 D;  3R62 A;  4YIZ A;  1GHQ B;  2ZYC A;  4APL A;  3GXE A;  4F4O C;  1ZJK A;  3OXU D;  3SW0 X;  1GKG A;  1SS2 A;  1H2Q P;  2KRI A;  3KXV A;  2RLP A;  1E8B A;  1U5M A;  1C1Z A;  1MD7 A;  2ERJ A;  2IZ4 A;  3KZJ A;  1OJY A;  2YRA A;  2CG7 A;  1Z92 B;  4IGD A;  2I2L A;  1TPM A;  2B5I D;  2BZM A;  5HYT B;  4N7E A;  1VVC A;  3FGT A;  1H04 P;  3OED C;  1UOT P;  1LY2 A;  1HFH A;  4CSY A;  3L89 M;  2XRB A;  2X2Z A;  2CG6 A;  1MD8 A;  4MSL A;  4YNX A;  3EJH A;  1Q3X A;  2V8E A;  1TPN A;  3GOV A;  4LOS A;  2MCZ A;  3O8E B;  1HFI A;  4AYI A;  2LOJ A;  5I0Q B;  1H03 P;  3INB C;  4PZ5 A;  2Y8T A;  3CI0 J;  1HCC A;  2G7I A;  5DN4 A;  3ERB A;  5HZP B;  2EC3 A;  3ZLD A;  2JGW A;  4BWC A;  3IU3 I;  5HYP A;  1VVD A;  2W81 A;  3ZD1 A;  1GKN A;  5JPM G;  2IZ3 A;  2XWB F;  2QY0 A;  1OJV A;  2W80 A;  4AYM A;  2O39 C;  3VWO A;  1G4G A;  1G4F A;  1ELV A;  2RL0 A;  1FBR A;  4LOT A;  2RKZ A;  4ONT D;  4FXG G;  2RKY A;  4DJZ A;  1SRZ A;  5DN5 A;  4AYD A;  1QGB A;  2UWN A;  4PO7 A;  3RJ3 D;  3NFP I;  1QUB A;  3IX0 A;  2RLQ A;  1OK2 A;  2Y8S A;  2CKU A;  2Y8R A;  1E5G A;  4WJG 2;  1CKL A;  1H2P P;  4K12 A;  4C16 A;  1OJW A;  2A55 A;  2YBY A;  2JGX A;  3CAL A;  3ZD2 A;  3K3T A;  1OK9 A;  3NJA A;  5HYU B;  2KMS A;  2XRD A;  3ZRZ A;  1QO6 A;  2EHF A;  2MCY A;  1PPQ A; 
#chains in the Genus database with same CATH homology
 4JHS A;  3MQL A;  4B2R A;  1TPG A;  1O9A A;  2WII C;  2XQW C;  1E88 A;  1OK1 A;  3M7P A;  4A5W B;  2XWJ I;  4MUC A;  2JRA A;  3OP8 A;  5FO8 C;  3T5O A;  4AYE A;  4J38 B;  1NWV A;  1GPZ A;  4KKD A;  3TVJ A;  1OK3 A;  4B2S A;  4ZH1 D;  3R62 A;  1GHQ B;  3GXE A;  4F4O C;  1ZJK A;  3OXU D;  3SW0 X;  1GKG A;  1SS2 A;  1H2Q P;  2KRI A;  3KXV A;  2RLP A;  1E8B A;  1U5M A;  1C1Z A;  1MD7 A;  2ERJ A;  2IZ4 A;  3KZJ A;  1OJY A;  2YRA A;  2CG7 A;  1Z92 B;  4IGD A;  1TPM A;  2B5I D;  2BZM A;  5HYT B;  1VVC A;  1H04 P;  3OED C;  1UOT P;  1LY2 A;  1HFH A;  4CSY A;  3L89 M;  2XRB A;  2CG6 A;  1MD8 A;  4YNX A;  3EJH A;  1Q3X A;  2V8E A;  1TPN A;  3GOV A;  4LOS A;  2MCZ A;  3O8E B;  1HFI A;  4AYI A;  2LOJ A;  5I0Q B;  1H03 P;  3INB C;  4PZ5 A;  1HCC A;  2G7I A;  5HZP B;  3ERB A;  2EC3 A;  2JGW A;  3IU3 I;  5HYP A;  1VVD A;  2W81 A;  3ZD1 A;  1GKN A;  5JPM G;  2IZ3 A;  2XWB F;  2QY0 A;  1OJV A;  2W80 A;  4AYM A;  2O39 C;  1G4G A;  1G4F A;  1ELV A;  2RL0 A;  1FBR A;  4LOT A;  2RKZ A;  4ONT D;  4FXG G;  2RKY A;  4DJZ A;  1SRZ A;  4AYD A;  1QGB A;  2UWN A;  3RJ3 D;  3NFP I;  1QUB A;  3IX0 A;  2RLQ A;  1OK2 A;  2CKU A;  1E5G A;  4WJG 2;  1CKL A;  1H2P P;  4K12 A;  4C16 A;  1OJW A;  2A55 A;  2YBY A;  2JGX A;  3CAL A;  3ZD2 A;  1OK9 A;  5HYU B;  2KMS A;  2XRD A;  3ZRZ A;  1QO6 A;  2EHF A;  2MCY A;  1PPQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...