1OJYA

Decay accelerating factor (cd55): the structure of an intact human complement regulator.
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
252
structure length
252
Chain Sequence
QDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Complement Regulation at the Molecular Level: The Structure of Decay-Accelerating Factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Regulator of complement pathway
total genus 40
structure length 252
sequence length 252
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ojyA04
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ojyA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ojyA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1ojyA02
3ZD1A 3ZD2A 1E88A 2XRBA 2KRIA 2YRAA 1Q3XA 2A55A 1O9AA 2QY0A 5HYPA 2CG7A 1MD7A 4DJZA 1GHQB 3INBC 1OJYA 5HYTB 3O8EB 2RLQA 3OP8A 3MQLA 2RKZA 1ELVA 1UOTP 1GPZA 1VVDA 1QO6A 1CKLA 1ZJKA 2JRAA 2W81A 5HYUB 4A5WB 4AYIA 2XWBF 1SRZA 1H2QP 4F4OC 1Z92B 1PPQA 2MCYA 1HFIA 1H03P 2G7IA 2XQWC 2MCZA 3ZRZA 1MD8A 4K12A 2JGWA 2W80A 2RLPA 1LY2A 3OEDC 2WIIC 1GKNA 3IU3I 4AYMA 3EJHA 2IZ3A 4KKDA 2IZ4A 2XWJI 4AYEA 1SS2A 3RJ3D 4C16A 1OK2A 3KZJA 2EC3A 2EHFA 3T5OA 4LOSA 1TPGA 2KMSA 5HZPB 2BZMA 2O39C 4LOTA 3R62A 1OJWA 1OK3A 1VVCA 1OK1A 1GKGA 1TPMA 4B2RA 4JHSA 1H2PP 1NWVA 1C1ZA 1OJVA 3IX0A 3GOVA 4J38B 1G4FA 5I0QB 1E8BA 1E5GA 3L89M 2CKUA 3OXUD 4IGDA 2RL0A 2JGXA 4AYDA 1QUBA 1U5MA 1FBRA 2CG6A 2RKYA 1QGBA 2V8EA 3SW0X 2UWNA 3KXVA 1HFHA 4MUCA 3NFPI 2XRDA 4FXGG 2LOJA 2YBYA 4CSYA 4WJG2 3ERBA 5JPMG 1HCCA 3M7PA 3GXEA 1OK9A 1G4GA 5FO8C 3TVJA 3CALA 4ONTD 1H04P 4ZH1D 1TPNA 2ERJA 4PZ5A 4B2SA 2B5ID 4YNXA
chains in the Genus database with same CATH superfamily
3ZD1A 3ZD2A 1E88A 2XRBA 2KRIA 3F6KA 2YRAA 1Q3XA 2A55A 1O9AA 2QY0A 5HYPA 2CG7A 1MD7A 3VWOA 4DJZA 2ZYCA 1GHQB 3INBC 5DN5A 2Y8TA 1OJYA 5HYTB 3O8EB 2RLQA 3OP8A 3MQLA 2RKZA 1ELVA 3ZLDA 1UOTP 1GPZA 1VVDA 1QO6A 1CKLA 1ZJKA 2JRAA 2W81A 5HYUB 4A5WB 4AYIA 2XWBF 1SRZA 1H2QP 4F4OC 1Z92B 1PPQA 2MCYA 1HFIA 1H03P 2G7IA 2XQWC 2MCZA 5DN4A 1MD8A 4K12A 3ZRZA 2JGWA 2W80A 2RLPA 1LY2A 3OEDC 2WIIC 4BWCA 3IU3I 1GKNA 4AYMA 3EJHA 2IZ3A 2Y8SA 4KKDA 4MSLA 2IZ4A 2XWJI 4AYEA 1SS2A 3RJ3D 4C16A 1OK2A 2X2ZA 3KZJA 2EC3A 2EHFA 3T5OA 4LOSA 1TPGA 2KMSA 5HZPB 2BZMA 2O39C 4LOTA 3R62A 1OJWA 1OK3A 1VVCA 3FGRA 2I2LA 1OK1A 1GKGA 1TPMA 4B2RA 3WSYA 4JHSA 1H2PP 1NWVA 1C1ZA 1OJVA 3ZLEA 3IX0A 3NJAA 3GOVA 4N7EA 4J38B 1G4FA 5I0QB 1E8BA 1E5GA 3L89M 2CKUA 3OXUD 4IGDA 2RL0A 3WSXA 4APLA 2JGXA 4AYDA 1QUBA 1U5MA 1FBRA 2CG6A 2RKYA 1QGBA 2V8EA 3FGTA 3SW0X 2UWNA 2Y8RA 3KXVA 1HFHA 3CI0J 4MUCA 3NFPI 2XRDA 3K3TA 4FXGG 4YIZA 2LOJA 2YBYA 4CSYA 4WJG2 3ERBA 5JPMG 1HCCA 3M7PA 3GXEA 1OK9A 1G4GA 1RLHA 5FO8C 3TVJA 3CALA 4ONTD 1H04P 4ZH1D 1TPNA 2ERJA 4PO7A 4PZ5A 4B2SA 2B5ID 4YNXA
chains in the Genus database with same CATH topology
3ZD1A 3ZD2A 1E88A 2XRBA 2KRIA 2YRAA 1Q3XA 2A55A 1O9AA 2QY0A 5HYPA 2CG7A 1MD7A 4DJZA 1GHQB 3INBC 1OJYA 5HYTB 3O8EB 2RLQA 3OP8A 3MQLA 2RKZA 1ELVA 1UOTP 1GPZA 1VVDA 1QO6A 1CKLA 1ZJKA 2JRAA 2W81A 5HYUB 4A5WB 4AYIA 2XWBF 1SRZA 1H2QP 4F4OC 1Z92B 1PPQA 2MCYA 1HFIA 1H03P 2G7IA 2XQWC 2MCZA 3ZRZA 1MD8A 4K12A 2JGWA 2W80A 2RLPA 1LY2A 3OEDC 2WIIC 1GKNA 3IU3I 4AYMA 3EJHA 2IZ3A 4KKDA 2IZ4A 2XWJI 4AYEA 1SS2A 3RJ3D 4C16A 1OK2A 3KZJA 2EC3A 2EHFA 3T5OA 4LOSA 1TPGA 2KMSA 5HZPB 2BZMA 2O39C 4LOTA 3R62A 1OJWA 1OK3A 1VVCA 1OK1A 1GKGA 1TPMA 4B2RA 4JHSA 1H2PP 1NWVA 1C1ZA 1OJVA 3IX0A 3GOVA 4J38B 1G4FA 5I0QB 1E8BA 1E5GA 3L89M 2CKUA 3OXUD 4IGDA 2RL0A 2JGXA 4AYDA 1QUBA 1U5MA 1FBRA 2CG6A 2RKYA 1QGBA 2V8EA 3SW0X 2UWNA 3KXVA 1HFHA 4MUCA 3NFPI 2XRDA 4FXGG 2LOJA 2YBYA 4CSYA 4WJG2 3ERBA 5JPMG 1HCCA 3M7PA 3GXEA 1OK9A 1G4GA 5FO8C 3TVJA 3CALA 4ONTD 1H04P 4ZH1D 1TPNA 2ERJA 4PZ5A 4B2SA 2B5ID 4YNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZD1 A;  3ZD2 A;  1E88 A;  2XRB A;  2KRI A;  2YRA A;  1Q3X A;  2A55 A;  1O9A A;  2QY0 A;  5HYP A;  2CG7 A;  1MD7 A;  4DJZ A;  1GHQ B;  3INB C;  1OJY A;  5HYT B;  3O8E B;  2RLQ A;  3OP8 A;  3MQL A;  2RKZ A;  1ELV A;  1UOT P;  1GPZ A;  1VVD A;  1QO6 A;  1CKL A;  1ZJK A;  2JRA A;  2W81 A;  5HYU B;  4A5W B;  4AYI A;  2XWB F;  1SRZ A;  1H2Q P;  4F4O C;  1Z92 B;  1PPQ A;  2MCY A;  1HFI A;  1H03 P;  2G7I A;  2XQW C;  2MCZ A;  3ZRZ A;  1MD8 A;  4K12 A;  2JGW A;  2W80 A;  2RLP A;  1LY2 A;  3OED C;  2WII C;  1GKN A;  3IU3 I;  4AYM A;  3EJH A;  2IZ3 A;  4KKD A;  2IZ4 A;  2XWJ I;  4AYE A;  1SS2 A;  3RJ3 D;  4C16 A;  1OK2 A;  3KZJ A;  2EC3 A;  2EHF A;  3T5O A;  4LOS A;  1TPG A;  2KMS A;  5HZP B;  2BZM A;  2O39 C;  4LOT A;  3R62 A;  1OJW A;  1OK3 A;  1VVC A;  1OK1 A;  1GKG A;  1TPM A;  4B2R A;  4JHS A;  1H2P P;  1NWV A;  1C1Z A;  1OJV A;  3IX0 A;  3GOV A;  4J38 B;  1G4F A;  5I0Q B;  1E8B A;  1E5G A;  3L89 M;  2CKU A;  3OXU D;  4IGD A;  2RL0 A;  2JGX A;  4AYD A;  1QUB A;  1U5M A;  1FBR A;  2CG6 A;  2RKY A;  1QGB A;  2V8E A;  3SW0 X;  2UWN A;  3KXV A;  1HFH A;  4MUC A;  3NFP I;  2XRD A;  4FXG G;  2LOJ A;  2YBY A;  4CSY A;  4WJG 2;  3ERB A;  5JPM G;  1HCC A;  3M7P A;  3GXE A;  1OK9 A;  1G4G A;  5FO8 C;  3TVJ A;  3CAL A;  4ONT D;  1H04 P;  4ZH1 D;  1TPN A;  2ERJ A;  4PZ5 A;  4B2S A;  2B5I D;  4YNX A; 
#chains in the Genus database with same CATH topology
 3ZD1 A;  3ZD2 A;  1E88 A;  2XRB A;  2KRI A;  3F6K A;  2YRA A;  1Q3X A;  2A55 A;  1O9A A;  2QY0 A;  5HYP A;  2CG7 A;  1MD7 A;  3VWO A;  4DJZ A;  2ZYC A;  1GHQ B;  3INB C;  5DN5 A;  2Y8T A;  1OJY A;  5HYT B;  3O8E B;  2RLQ A;  3OP8 A;  3MQL A;  2RKZ A;  1ELV A;  3ZLD A;  1UOT P;  1GPZ A;  1VVD A;  1QO6 A;  1CKL A;  1ZJK A;  2JRA A;  2W81 A;  5HYU B;  4A5W B;  4AYI A;  2XWB F;  1SRZ A;  1H2Q P;  4F4O C;  1Z92 B;  1PPQ A;  2MCY A;  1HFI A;  1H03 P;  2G7I A;  2XQW C;  2MCZ A;  5DN4 A;  1MD8 A;  4K12 A;  3ZRZ A;  2JGW A;  2W80 A;  2RLP A;  1LY2 A;  3OED C;  2WII C;  4BWC A;  3IU3 I;  1GKN A;  4AYM A;  3EJH A;  2IZ3 A;  2Y8S A;  4KKD A;  4MSL A;  2IZ4 A;  2XWJ I;  4AYE A;  1SS2 A;  3RJ3 D;  4C16 A;  1OK2 A;  2X2Z A;  3KZJ A;  2EC3 A;  2EHF A;  3T5O A;  4LOS A;  1TPG A;  2KMS A;  5HZP B;  2BZM A;  2O39 C;  4LOT A;  3R62 A;  1OJW A;  1OK3 A;  1VVC A;  3FGR A;  2I2L A;  1OK1 A;  1GKG A;  1TPM A;  4B2R A;  3WSY A;  4JHS A;  1H2P P;  1NWV A;  1C1Z A;  1OJV A;  3ZLE A;  3IX0 A;  3NJA A;  3GOV A;  4N7E A;  4J38 B;  1G4F A;  5I0Q B;  1E8B A;  1E5G A;  3L89 M;  2CKU A;  3OXU D;  4IGD A;  2RL0 A;  3WSX A;  4APL A;  2JGX A;  4AYD A;  1QUB A;  1U5M A;  1FBR A;  2CG6 A;  2RKY A;  1QGB A;  2V8E A;  3FGT A;  3SW0 X;  2UWN A;  2Y8R A;  3KXV A;  1HFH A;  3CI0 J;  4MUC A;  3NFP I;  2XRD A;  3K3T A;  4FXG G;  4YIZ A;  2LOJ A;  2YBY A;  4CSY A;  4WJG 2;  3ERB A;  5JPM G;  1HCC A;  3M7P A;  3GXE A;  1OK9 A;  1G4G A;  1RLH A;  5FO8 C;  3TVJ A;  3CAL A;  4ONT D;  1H04 P;  4ZH1 D;  1TPN A;  2ERJ A;  4PO7 A;  4PZ5 A;  4B2S A;  2B5I D;  4YNX A; 
#chains in the Genus database with same CATH homology
 3ZD1 A;  3ZD2 A;  1E88 A;  2XRB A;  2KRI A;  2YRA A;  1Q3X A;  2A55 A;  1O9A A;  2QY0 A;  5HYP A;  2CG7 A;  1MD7 A;  4DJZ A;  1GHQ B;  3INB C;  1OJY A;  5HYT B;  3O8E B;  2RLQ A;  3OP8 A;  3MQL A;  2RKZ A;  1ELV A;  1UOT P;  1GPZ A;  1VVD A;  1QO6 A;  1CKL A;  1ZJK A;  2JRA A;  2W81 A;  5HYU B;  4A5W B;  4AYI A;  2XWB F;  1SRZ A;  1H2Q P;  4F4O C;  1Z92 B;  1PPQ A;  2MCY A;  1HFI A;  1H03 P;  2G7I A;  2XQW C;  2MCZ A;  3ZRZ A;  1MD8 A;  4K12 A;  2JGW A;  2W80 A;  2RLP A;  1LY2 A;  3OED C;  2WII C;  1GKN A;  3IU3 I;  4AYM A;  3EJH A;  2IZ3 A;  4KKD A;  2IZ4 A;  2XWJ I;  4AYE A;  1SS2 A;  3RJ3 D;  4C16 A;  1OK2 A;  3KZJ A;  2EC3 A;  2EHF A;  3T5O A;  4LOS A;  1TPG A;  2KMS A;  5HZP B;  2BZM A;  2O39 C;  4LOT A;  3R62 A;  1OJW A;  1OK3 A;  1VVC A;  1OK1 A;  1GKG A;  1TPM A;  4B2R A;  4JHS A;  1H2P P;  1NWV A;  1C1Z A;  1OJV A;  3IX0 A;  3GOV A;  4J38 B;  1G4F A;  5I0Q B;  1E8B A;  1E5G A;  3L89 M;  2CKU A;  3OXU D;  4IGD A;  2RL0 A;  2JGX A;  4AYD A;  1QUB A;  1U5M A;  1FBR A;  2CG6 A;  2RKY A;  1QGB A;  2V8E A;  3SW0 X;  2UWN A;  3KXV A;  1HFH A;  4MUC A;  3NFP I;  2XRD A;  4FXG G;  2LOJ A;  2YBY A;  4CSY A;  4WJG 2;  3ERB A;  5JPM G;  1HCC A;  3M7P A;  3GXE A;  1OK9 A;  1G4G A;  5FO8 C;  3TVJ A;  3CAL A;  4ONT D;  1H04 P;  4ZH1 D;  1TPN A;  2ERJ A;  4PZ5 A;  4B2S A;  2B5I D;  4YNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...