2I2LA

X-ray crystal structure of protein yopx from bacillus subtilis. northeast structural genomics consortium target sr411.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
134
structure length
130
Chain Sequence
MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKYDVTAVGWVEYATIEVIGDVYQNPELLEGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YopX protein
publication title Crystal structure of the hypothetical protein yopX from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 13
structure length 130
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.50 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2i2lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2i2lA02
4EMKA 2QTXA 4M77C 1B34B 1D3BA 3HFNA 4QVDA 3V7SA 4C8QC 3RERA 4HT9A 1YCYA 4C92E 4M7DD 4PJOB 2EJGA 2E41A 4J5YA 4JLIA 3JCMf 5LJ3j 4NL3A 1LOJA 1KQ2A 1MGQA 4M75A 1I5LA 4XTVA 5LJ3f 3SWNB 4X9CA 4XU1A 1BIBA 1JRIA 5LJ5g 4M7AG 4M7AA 3JCMP 4J6XA 4XU0A 4PJOE 4M7AF 4M7DB 2DZCA 3QHSA 3RKWA 4A54A 4F7UG 2DTOA 4M78G 4EMKC 1LJOA 4F7UA 3FJPA 2VXEA 1M5Q1 4M78A 4F7UF 3JCMe 4M78F 5GMKh 3BY7A 4JUVA 1TH7A 2DTHA 1WPYA 3JB9D 5GMKi 4DQ2A 1BIAA 5GAMg 4C92G 2RD1A 2VC8A 4M7DE 4C92A 3BFMA 3FIFA 1JBMA 4XTYA 2YLCA 3QO3A 4JRIA 4M75C 4C92F 3JCMW 2RB6A 4M77D 1B34A 3JCMJ 4M7AC 2E10A 2JN0A 5GANd 1U1TA 4XTZA 4C8QD 4NL2A 3V8LA 4PJOG 5LJ3h 5LJ5h 1WQ7A 2Y90A 3BW1A 3PGGA 4M78C 4PJOF 5GAOp 5I21A 3AHUA 2CGHA 2EJ9A 4M77B 3JCMg 2FB7A 4Y91A 5GANe 3SWNA 3JCMQ 1LNXA 4XQ3A 2E1HA 3V8JA 3V7RA 4C92C 1KQ1A 5LJ3g 4M7DG 3EFRA 3L2ZA 5GAMh 4M7DF 4RCBA 4M77E 4HA8A 1U1SA 5GAN3 3HSBA 5GAOq 4XU2A 2DXTA 2RA2A 4EMGA 4C8QE 5GANj 4EMHA 4PJOC 1HXDA 4V2SA 3RKYA 4JRKA 4EMKB 2HNIA 5GAOr 2YLBA 4M75D 5CAIA 4XTUA 5GANf 5GAN8 3SWNC 5GAOl 3EFSA 5GMKl 4M7AD 3JCMh 4WF2A 2EJFA 5GAOm 3L1AA 1N9RA 2EAYA 2K57A 5GAOn 3RKXA 5GMKm 4J6YA 3V8KA 4OP0A 4PNOA 3V7CA 4HT8A 4M75B 4PJOA 4M77G 2VXFA 3JCMc 5GAN5 3JCMX 4N0AA 2FYKA 4M77F 4XTWA 1I8FA 4NOYA 4C8QG 4A53A 2DTIA 5LJ5d 1N9SA 5GAN4 5GAN6 3JB9I 4C8QB 3JB9J 1WQWA 5GMKj 1I81A 3BDUA 4PJOD 1M8VA 4M7DA 4M75E 3FB9A 3QSUA 3RESA 3JCMb 5LJ5e 5GAN2 4M7AE 1Y96B 2RM4A 4J6WA 5GANh 2E65A 5GAMd 4F7UE 3INZA 5DY9A 4M78E 3GIBA 4RCCA 4XU3A 3RIRA 2DEQA 2DVEA 3HFOA 2DZ9A 2I2LA 4N0AC 3RUXA 1D3BB 1H641 5GAMe 5GANg 5GMKe 3JB9G 4MMLA 5LJ5j 4XTXA 4M7DC 4QVCA 2DXUA 2ZGWA 3JB9F 4M75G 1WNLA 2DKGA 5GAN7 4M78D 5LJ5f 2DJZA 2YHTA 4M75F 3VU3C 3JCMd 4M77A 3JCMV 2E64A 1HK9A 1I4K1 4M7AB 4X9DA 5LJ3d 3SB2A 4C8QA 5GAMj 1X01A 4C92D 4C8QF 4F7UB 4M78B 3M4GA 2EWNA 5GAMf 1Y96A 5LJ3e 3JB9H 4MMKA 4C92B 3QUIA
chains in the Genus database with same CATH superfamily
4JJNK 3MPUB 4M77C 1VQ5Q 1RADB 4ORZA 3UT1A 4C8QC 4JLIA 2E41A 4J5YA 2PU9B 3EGXB 4DBFA 1OOTA 3EFOA 1PCXA 5CK9A 2DZCA 2KK4A 4DJZA 2JTFA 2RH2A 1M90U 3CCJQ 2OX7A 1KQSP 2DTHA 5GAMg 4DQ2A 2E6NA 4HCZA 1Q86R 1UB4A 4J9EA 1Y57A 2LJ1A 5KYYB 4NL2A 4R55A 3AHUA 4M78C 3G71A 3G6EA 2HBWA 3VJPA 1NEBA 3FGTA 4M7DG 3VS3A 1TOVA 4LDYA 2CT4A 1VQPA 1JJ2A 4DOWA 4HA8A 4BI8B 2QA4A 4OVAA 3I35A 3OY9A 2K7AA 5DLQE 2DF6A 5GANj 4ATOA 2QY0A 1NBEB 3TREA 2HNIA 3CC7T 2HSEB 2QAZA 4XTUA 3VKIA 1G5VA 2KNBB 2EKOA 2M51A 1MMDA 3JCMh 4PFPA 2K57A 3EG2A 4ELYC 4OP0A 5KYWA 2JRAA 4OF1A 3PIOA 1PM3A 2GFAA 1X75C 1D09B 2DEQA 1X43A 5DN5A 1V29B 1H641 4E7KA 1Q81C 4HKEA 2LTOA 2W81A 4WCIA 5GMKe 4IUQA 2LNVA 1VQ6A 3CD6Q 1NEGA 1BKBA 4M78D 2MCNA 2K5LA 3FJ5A 4M77A 3JCMV 1EZZB 2NUPA 3E19A 3CPWP 2Y8RA 1KFZA 4C8QA 3CBMA 4OB3B 1DJ7B 3H41A 1WXTA 3SDZA 3MO8A 3QZ9B 3NTKA 3SHWA 2ZPHB 4JS4A 3LLRA 1LOJA 1KHCA 1HSQA 5LJ3f 2A08A 3A8GB 4XU1A 1BIBA 1G2BA 5LJ5g 2JGWA 2RHXA 1WHGA 4M7DB 2DTOA 2ZZDA 1VQKT 4FCYA 4M78A 1M5Q1 5KYXB 5IHIA 2DIGA 2RKYA 2CZ1B 2EQKA 4XTYA 4M75C 2QI2A 1WHHA 1M27C 1M1KR 1ABQA 2WSCE 1MMAA 1V1CA 4Y91A 2E12A 1SEMA 3CCJT 4RTUA 1AZGB 2VGMA 3CXCP 1NPRA 7AT1B 2O9VA 2KDSA 2JS2A 4JRQA 2X35A 3L2QA 1K8AC 2SRCA 1KQSA 4FYXB 5FU6C 2EJFA 4C5IA 3RKXA 1RAHB 3VUBA 4M77G 3EFOB 5KCOA 3CCRA 1OYXA 3NFPI 4C8QG 1OX9A 1AHJB 1IGUA 1WQWA 2KMSA 1R77A 1OULA 3FB9A 2L89A 1YWOA 1YFNA 5GANh 2E65A 1IREB 1WJRA 1K1ZA 4KULA 1UOTP 2EYXA 4XU3A 1M1KU 2DZ9A 2DEUA 3ZLDA 2IZ4A 5D6XA 4RTZA 4II1A 1Y07A 2JOYA 2O4XA 4HCBA 2Z0WA 2QTVA 2QQBA 1VQOA 3CCVQ 1MD7A 2KEAA 5C6SA 3M4GA 3CCUQ 5AT1B 1VIFA 1LVKA 3QUIA 4CC2A 3CC2T 3CD6T 2J6FA 2L3PA 2MOXA 1IGQA 2AZSA 1PC0A 1H3HA 2D6FA 4PJJA 4FSXA 4ANJA 4M75A 4XTVA 3LH5A 4M7AG 3KZJA 5FROA 2L8DA 1AD5A 5LL6S 3TEEA 2JNGA 1UJYA 4KGXB 3CPWA 3P8HA 1MHNA 2QQRA 2CKKA 1BIAA 2LT1A 2LQKA 1YHQQ 1B34A 2V1RA 1CKLA 1BU1A 4PLLA 4M77B 1TG0A 3JCMg 1VYTA 1YJNA 4K11A 4J9IA 1OJYA 3REBB 3V8JA 3V7RA 1X6OA 5A0DA 5GAN3 3K3TA 4D8DA 1UG1A 5HY6A 3WSXA 5GAOl 1S72A 2KROA 2YSQA 3NPFA 3EFSA 4A4HA 4BACA 2DM1A 2V8IA 1EIFA 2RF0A 2LP5A 1FWZA 2AHJB 1TUDA 1M30A 3BDUA 2HAXA 3JCMb 5CR2A 3CCMA 3NFCA 1CKAA 2KMTA 1VUBA 1NJIU 1OQKA 4LUDA 2KQWA 1E5GA 2ZGWA 3TQ7P 4M75G 3CCET 2PZ1A 1CSKA 4M7AB 2OI3A 4QQDA 2LX9A 4C8QF 2MI6A 1GXIE 5LJ3e 2QGGA 5IAYA 3CMAQ 3CBPA 3JB9H 4MMKA 2QTXA 4ZGEB 1Q95G 4AFUC 2KXDA 3CEYA 4ZTJA 1M3AA 3CCQA 3CCVT 3CC4Q 2LQWA 4AFQC 3CCUT 4GLKA 3I5RA 3JCMP 5IT9E 2KGTA 1UECA 3CQTA 4MSLA 3FJPA 3M9QA 4RUGA 2GNCA 4M78F 3MEWA 4J9FA 3RDVA 4C92G 3BFMA 3FIFA 4OMPA 2NUTA 1X6BA 2DL5A 2LMJA 3LWIA 1K8AR 2XIDA 1T0HA 2A0FB 4XTZA 3C12A 4KUDK 2O4XB 1KD1C 1YITQ 4LNPA 1BYMA 4C5HA 1FX7A 3HHTB 2HCKA 1YHQT 2BZYA 2QQ9A 2F2XA 2QYZA 3CCSQ 2EQUA 2L3SA 4FYVB 5CO7A 1WHLA 2DBMA 2Y4YA 5GMKl 1IHVA 2P4TA 3QXEB 3I56A 4HT8A 4M75B 5A0GA 3OYEA 2FG0A 1HYOA 2KAFA 1GFCA 2DLPA 1I81A 2RKZA 2D1XA 1HFHA 1VQLQ 4DBRA 1QQJA 1O9SA 3T5OA 3OW2P 1OPKA 4ME7A 3GIBA 3INZA 1K8AU 2DNUA 1FMVA 2GBQA 3G4SQ 1W1FA 4LOSA 3HKSA 1NLPC 1H8KA 1C1ZA 3G7ZA 1I0CA 5FU6B 1YNZA 3ME9A 1MMGA 1RI9A 1OX8A 2E4HA 4MUCA 2CUDA 3ULRB 3RR6A 1NM7A 2ATCB 2J6OA 4C92B 2GF7A 3PNWC 3OYKA 3V7SA 1J3TA 3L2RA 2R57A 2DL7A 1UGPB 2EJGA 4B9XA 2PVOB 4MDWA 3S6WA 2K3BA 2ZCFB 3CC7A 3X26B 1IB8A 3EG9A 3A5ZB 3VS1A 4B2SA 5L8RE 4F7UA 3VS2A 1YIJA 4J9BA 5KCHA 4HVVA 1H3ZA 2XG8D 4WJG2 3CC4T 2E10A 4BI3A 1VQ4Q 2PVGB 4CSYA 3MEVA 3PGGA 3R62A 3HPWA 1WFWA 2FB7A 4ZN3A 5LJ3g 3VRYA 1M3CA 3S3NA 4E7HA 5I0QB 2PNIA 2IVWA 2ZAEA 2MIOA 2JVVA 3RKYA 5HYUB 2KT1A 2IG0A 3SWNC 3MCAB 2ED1A 2C0IA 1YITT 3JAME 2FPDA 4OMNA 2RN8A 2HSPA 1PKTA 4Q5WA 1K76A 4RTWA 1I8FA 2JW4A 3CCST 1UHFA 5GMKj 2J05A 1ABOA 2PVDB 2X4JA 2OTLQ 1U8RA 2ERJA 1ZHIA 1E8BA 1VQ7T 5GAMd 3OMCA 2RNAA 4RCCA 1TPMA 2EC3A 1QVPA 2CP6A 3L2VA 1QGBA 2CP0A 2XU8A 1VQ5A 1WNLA 2XD0A 2DJZA 1VQLT 3H8ZA 4JZ4A 1VQMQ 4OMQA 3OBWA 4BE2A 4KT0E 1VQ9Q 1C6VX 3M0TA 3OYYA 3CCLA 3G4ST 2CUBA 5HKCA 1QVGP 3T9NA 3CCJA 4LD9K 3OW2A 4IUTA 1UE9A 2X3XD 1AWWA 3IU3I 1NWVA 3OSSC 2P84A 1EFNA 1MV3A 1KK7A 4BY6B 3PTAA 1WJQA 4AYMA 2J6KA 2YUOA 1KD1R 3QHSA 3HRSA 3L2WA 3M4YA 3X25B 4PJNA 1D0YA 1BB9A 1N27A 1KSWA 2A37A 1FMWA 1N8RU 4IUVA 2RHUA 1M8MA 1JU5C 1GFDA 5DN4A 2EKHA 2NLUA 1AVZC 2JM9A 2JZ2A 3SWNA 3JV3A 1ARKA 2KE9A 1KIKA 4DBHA 5I22A 3FLGA 2I0NA 1NLOC 1WXUA 4J8OA 2DA9A 2X51A 4LE9A 3VS7A 3C4SA 2RQRA 1ZBJA 1VQ4T 2DXBA 3R6NA 5GANf 4E7LA 3GXEA 1YJWT 3L42A 3OBYA 4A4EA 4DEYA 3OYLA 3EG9B 4E2FB 5LJ5d 2DTIA 1CKBA 3JB9I 3JB9J 1WA7A 5CCAA 3OP8A 4FL6A 3E1SA 2KRIA 1PWTA 2MF2A 4ZGDB 2O31A 1C1AA 1RAGB 1XOVA 1YP5A 2EPDA 4BWCA 2XWJI 4RMOA 2ROTA 5HK0A 2ENMA 3EGDB 3JB9F 2DKGA 1WJSA 4OB2B 1NYGA 3R6OA 1QWFA 2OTLT 5J39A 3CMEQ 4PKCC 4LXCA 1YN8A 4JJBA 2BZMA 2L3QA 1Q86U 2QQAA 3OYHA 4OGCA 2B5ID 5HZPB 1F1BB 1JXMA 3FRNA 2RHIA 3OS0A 1RAIB 2MCYA 1ZJKA 2IZ3A 1VQMT 2VVKA 3CC2Q 1VQ9T 1I5LA 2ZYCA 1GKGA 3I5SA 1WHKA 4J6XA 4RTYA 3RKWA 1W2BS 1MV0B 2YRDA 4PK4A 3C94A 2XHCA 1PPQA 4F7UF 3JCMe 1V76A 4P5NA 4OB1B 4JUVA 1GRIA 3QYGB 1SF9A 3EG3A 5CKEA 3G71Q 1GCPA 3TCJA 1MMNA 4A5WB 4C0DC 3JCMJ 4QKUA 1QVGA 2RPNA 1U1TA 2BUDA 1LY2A 2DD4A 1K9AA 2FZCB 3UPUA 1AWXA 1KQ1A 2LC4A 3TVJA 3EFRA 1IXDA 1YJ9T 2W80A 2F2WA 3M53A 2IPOB 3EH1A 4X34A 1C0MA 4PFOA 2EYQA 4PJOC 4V2SA 2HKQB 1Q82C 5CAIA 1Z9QA 2QGFB 4M7AD 2E5KA 2EAYA 2LCLA 3VV0A 1WZOA 3JCMc 1HD3A 2DYIA 2V8JA 4IIOA 5GAN4 4BI4A 3KXTA 1H2QP 1JO8A 3DKMA 2FRWA 2R5MA 2QDLA 5CQXA 3OA6A 3WSYA 3CCVA 5IXFA 2H3EB 2EGCA 3CCUA 1R0BG 1QVFS 1M2VA 5GJWB 4HCCA 5JPMG 2DL8A 3UA6A 5I2MA 2V8EA 4XTXA 4HXJA 2LVMA 1PG5B 1OK9A 3KUFA 3JCMd 1W2BP 3M5AA 4OMFB 2J7IA 2BE9B 5HCKA 2L5QA 3CCEQ 1M2OA 2RJEA 1BI1A 4O6JA 1TS9A 1SRMA 3GLXA 3EHRA 4JDSA 2RI2A 2FZKB 1O75A 5FU7C 4GBQA 4PJOD 1X69A 3NHNA 1RI0A 2RQUA 3QWXX 2ZPGB 5GJVB 1IZ6A 1PKSA 1YHQA 2KRMA 4F14A 5AYFA 2EVRA 3CMET 2DFUA 2KY9A 2DX1A 2QK0A 4XU0A 2FHDA 1TPGA 2JS0A 4M78G 1LJOA 1VVCA 2YUPA 3DB3A 4FYWB 2B86A 1PRLC 2VUBA 2YLCA 1HCCA 2XDDA 1OI1A 3QYHB 2IIMA 3MHXA 1R8OB 2P0PA 3OYAA 3E9FA 1HJDA 5KYWB 5GANe 1UGSB 2V26A 2FRYA 2MK5A 4DA4A 4F4OC 1E6HA 5FRNA 1ZUUA 3H9NA 3G71T 2MCZA 4R0KA 2DRMA 1VOMA 1YCSB 4JLGA 2DERA 1KJWA 4HCKA 1BCOA 1LPLA 3QDFA 5GAOm 3HTRA 2K2VA 3L1AA 3PMTA 5HK3A 4E6RA 4JRPA 3E9GA 1K73C 2VXFA 3I55Q 2NUPB 4A53A 1O9AA 2CG7A 5FO8C 2YUQA 4C8QB 4NS5A 1ZX6A 2MWOA 2ZPIB 4M7AE 2BE7D 2WACA 1IHWA 3TVTA 2Y8SA 1SRZA 4PO7A 4EIKA 2E5QA 4QQGA 3A8LB 3CMAA 3GBQA 2DETA 3M59A 2KVQG 3P8DA 2LOJA 3OS2A 2F69A 3CPFA 3PT9A 1Q81R 1BI0A 4K12A 1I07A 3REAB 3ASKA 2E64A 1I4K1 3OB9A 4X9DA 5EC7A 2VGNA 1M4ZA 1VYVA 3A1PA 5GAMj 5A2QE 1QUBA 4M78B 1SKUB 1VQ6T 2EWNA 2RL0A 1VA7A 1PHTA 2EYYA 4N4HA 2M9UA 4OGEA 4FSSA 1UTIA 2KXCA 4LUEA 1D3BA 5L23A 2COWA 1IRXA 1M3BA 4MZPA 1AEYA 4LD6A 1NE8A 1BI3A 2RQVA 4PJOE 2DILA 2MPXC 1P92A 1YITA 1W2BA 2VXEA 5HYTB 2EYWA 2BTTA 2JGXA 1U5SA 1OK1A 2BKDN 3CI0J 1M2VB 2PQWA 1H92A 3CCSA 2AZVA 2HQXA 1PRMC 1AWJA 3BDLA 2YRAA 1Q81U 1Z9ZA 3M7PA 1Q82R 2AKKA 2KR3A 2XRDA 2HBPA 2F5KA 3LH0A 2VV5A 1ZSZC 4KGVB 2ESWA 4VUBA 4EDUA 2K79A 1ACMB 2YXYA 3P8BB 3OQ5A 1R0CB 3M0PA 1XJWB 3EGUA 4E7IA 1RACB 2DXTA 4EMGA 4F16A 3LWHA 3OYNA 1QCNA 2JMAA 3OMGA 1VQLA 2CREA 3FC3A 4AYDA 1KC8C 3J80E 3C0CA 2CH4W 2QQSA 1T3LA 5CQYA 1UGVA 5GMKm 3ZRZA 1A0NB 4APLA 1ELVA 3G4SA 4C0DB 4Z02A 2LCSA 2RK1A 3CCMQ 2KYBA 1U06A 1N5ZA 1TTHB 1UUEA 1M90C 2A28A 5M9OA 3ZD1A 3L89M 3OYIA 3CCRT 2K2MA 2COZA 5DY9A 2MYSA 3WXMB 3RIRA 4KH1B 1QVFA 1VQ7Q 1WIEA 5GANg 3S3MA 2HL3A 3I55T 5LJ5j 1QO6A 2DXUA 2M0YA 1QW1A 5FW9A 3PVQA 1JEGA 2VB6A 2GGRA 3URGA 4Y92A 4C0FA 4C0ZA 2G6FX 1YBYA 5LJ3d 3SB2A 4A4KA 1PD0A 4IUUA 4C5EA 1D0XA 2FEIA 2ROLA 1Y96A 3N5BB 3LW5E 2NWMA 2Y8TA 4CC4B 2GFUA 4PJLA 4LDUA 1B34B 2DVJA 3HFNA 4MZTA 3RERA 4HT9A 2HL5C 1KHIA 2A3LA 1E6GA 1S1NA 2EIFA 2ZPBB 4RG2A 8ATCB 1VQ4A 2KRNA 1G3YA 4UC4A 2M02A 1BI2A 1I1JA 1D1BA 1E7OA 1X6GA 2D0NA 2ABLA 3M54A 2LT4A 5J26A 5GMKi 1ZSZA 4DBQA 4JRIA 3GOXA 4AFSC 4CC7A 3M55A 4IKFA 1QCOA 1UFFA 4BB7A 2HQEA 3OYCA 5FU7B 5CVIA 1WQ7A 3PMIA 4OMLA 4PJOF 3GOVA 3HL8A 1OU8A 2EJ9A 4FT4A 4Z8AA 2DE0X 1W6XA 1VYUA 1M9SA 1K73R 3GNGA 1VQ8Q 3OS5A 2FL7A 1WXBA 1G3TA 3M0SA 4C5GA 2LZ6B 2RA2A 1XTDA 4X1VA 1W4SA 4EMHA 2DMOA 2FPEA 2OTLA 4JRKA 4PZ5A 4J7FA 3VS5A 3OYFA 3I56Q 1TUCA 4JJDA 1X2KA 3M58A 2JMCA 2XI9A 4RTXA 3QWYA 5KYYA 4L6V5 2QEXQ 4LDXA 5DM7R 1VIEA 1FBRA 1XNIA 1WGSA 5GAN5 5I11A 4XTWA 1S72T 2CDTA 2XICA 1YJWQ 4AMCA 1VQMA 2FZGB 3SEMA 1VQ9A 2O01E 5J3BA 1OZ3A 2AT1B 2KYMA 3H0FA 1PNJA 2C06A 1MUZA 3MJXA 3JB9G 4MMLA 3CCMT 3GF5A 1OZ2A 1JQQA 3ERBA 4KBMB 3QKJA 2CZ0B 1RAEB 2FO0A 1LCKA 2R5AA 2AIRB 4QW2A 3THKA 3GNFB 3OYBA 1H04P 4A4FA 4PLIA 2DK3A 2EFIA 2NUTB 2E3IA 4J83A 4QVDA 5DLOA 5HYPA 3HRUA 4FIBA 1VQKA 4M7DD 4NL3A 1MGQA 1TWBA 2DL4A 1YIJQ 4XAXB 1Y0MA 3NTIA 4F7UG 2JM8A 4EMKC 4J9GA 2ZPEB 1K9MC 3BY7A 3Q1JA 4IURA 1RUWA 1KQSS 4J9DA 4R56A 3ZD2A 2CS7A 2FVUA 1YI2Q 2RK2A 4CI0C 3JSCA 2KRSA 1KC8R 4L5GA 2QG9B 2RI3A 3UF4A 1WHMA 2X3WD 3VS4A 2PUOB 2OTJQ 2W0ZA 4RKUE 1K0XA 4IIMA 3JCMQ 1PSEA 1E88A 2XRBA 1LNXA 2JUFA 3L2ZA 2JT4A 5KYXA 3HSBA 4XU2A 2VKNA 1M90R 1HXDA 1RAAB 1MD8A 2HEQA 3PIPA 2LCCA 4QVZA 5KE3A 1YJ9Q 4WF2A 3META 1KG1A 3V8KA 2HKNA 2CSIA 5CKFA 5KE2A 1VQ8T 1VQNQ 2WSEE 3JCMX 2H8HA 4ONTD 2X9HA 2EGAA 2JTEA 2MMPA 4FYYB 3H0HA 5GAN6 4M4ZA 1SHGA 1G8XA 3QPHA 2K5FA 2K3YA 3I56T 2XK0A 1NYFA 3CMEA 3DLLA 1ZSZB 4J9HA 2UWNA 2VWFA 4Z89A 1KC8U 3VS6A 1EX4A 2O88A 3ZLEA 2QEXT 2RJCA 3EAEA 2YDLA 1QKWA 3MP1A 4AYIA 3LX7A 2CSQA 1D0ZA 1KD1U 2L3RA 1RAFB 3DLMA 3CCLQ 3CC2A 4LDWA 3CD6A 3CPWS 4F7UB 2P0KA 3RJ3D 3VYHB 1MNEA 5IHKA 3EJHA 2RHYA 3ZBDA 5D7UA 5FWBA 4ZN1A 4DEXA 2DPPB 5D6YA 1GBRA 4EMKA 1ZBXA 3UATA 2DO3A 4JS5A 3NGPA 3QZ5B 1KQ2A 4ZGJB 2QDYB 1JRIA 1OJWA 1RABB 1WX6A 9ATCB 3G1JA 5GMKh 3GPLA 2EQMA 4QQ6A 2O39C 4OMMA 1WPYA 4M7DE 2VASA 2RD1A 2CP2A 3JRZA 1NJIC 4M77D 1SG5A 2DD5A 3FDRA 4M7AC 2JN0A 3RMSA 1YIJT 4C8QD 2D8JA 3V8LA 1UGQB 5GAOp 5I21A 1N6AA 3H0IA 2E1HA 2BZ8A 4E47A 3CXCS 4B2RA 1YWPA 1YI2T 3QJ6A 3U23A 4ZTFA 3MKDA 1Q7YC 4B6MA 3QG1A 5GAOr 5GAN8 2KSSA 4D8KA 2OTJT 5I2SA 3S3OA 3L2UA 2BIVA 4YNXA 3G6EQ 4N4GA 1N9RA 1OK3A 2HMAA 1QLYA 1SPKA 5CIUA 4J38B 2AK5A 3M0UA 1VQPQ 2RLPA 1K4US 2QA4Q 1M8VA 1TSFA 2OAWA 3EG1A 2EHFA 1FXXA 5GAN2 3KFVA 4LOTA 2D9TA 4RTTA 2DYBA 3CCEA 1W70A 1G4FA 2RI5A 5KH6A 2O2OA 1VQNT 2F5TX 5GAN7 2X4YA 3M0QA 4YTLA 1H2PP 3VU3C 3AT1B 1U5MA 1AT1B 2G7IA 3FEOA 1G3SA 2HDAA 5IN1A 4A63B 2XWBF 1X01A 1AZEA 1RLPC 1VQ5T 5C0MA 2OAUA 3A8HB 2DAQA 1ZSGA 1K9MR 2E3HA 1GPZA 5KYNA 3PFSA 1VQ6Q 4C0GA 3O5ZA 1YCYA 5LJ3j 2ZPFB 4DOVA 3CCLT 5A0LA 3SWNB 4AFZC 4BD3A 2QXFA 4M7AA 2LRQA 2X4WA 2H3JA 3M57A 4KUIA 2V1QA 2A7YA 1M1GA 1IO6A 1TPNA 2HQHA 1GBQA 2B8AA 5IH2A 3OSVA 2A55A 2CGHA 1B7TA 4JJCA 4FU6A 2SEMA 1PSFA 1QP3A 3IQLA 1BCMA 4C92C 1XQHA 2CP7A 2L0AA 3X24B 4M7DF 4GY5A 2RQWA 1UHCA 1K9MU 4M77E 3I55A 4KGZB 5GAOq 1SS2A 4C8QE 2LDMA 1QWEA 2YUNA 2OJ2A 4EMKB 4FXGG 3SW0X 4M75D 3F6KA 3C95A 2CYZB 2HZYA 2DXCA 5GAOn 4J6YA 4PJOA 4F04B 4BDZA 3BE3A 1G3WA 4NOYA 3A8OB 3X20B 3QSUA 2W10A 3EG0A 4FM4B 3UA7A 1M1FA 1QVFP 2Y4XA 2YT6A 4M78E 4ELZC 3G6ET 3VYGA 3HFOA 1RL2A 4N0AC 1VQPT 3CCRQ 1OPLA 2P0QA 2QA4T 2MAMA 3PE0A 1RLQC 3QJYA 4E7JA 1AWOA 2YHTA 3TSZA 4PJMA 4FW1A 4C92D 6AT1B 2J06A 5GAMf 3FGRA 3EH2A 4N4IA 1OU9A 1HFIA 1JB0E 3VRZA 2G3RA 1ZLMA 1AOJA 2E6ZA 1NJIR 2DL3A 2RJDA 1WHJA 1VQOQ 3QIIA 1GHQB 1B3QA 1Y71A 4MZMA 1SRLA 2WSFE 4IUPA 2K3XA 1GCQC 4LN2A 3CC4A 3NJAA 4AG1C 2VC8A 4C92A 2DJQA 2YBYA 2A36A 1SHFA 1Q7YR 4OB0B 5IXBA 5GANd 4PJOG 5LJ3h 2K6DA 2COYA 4ESRA 3SD4A 4LDVA 1QMCA 4Z88A 1UJ0A 4XQ3A 1QCFA 3NTHA 3CXCA 2EQIA 4RCBA 2YWWA 1U1SA 8AT1B 2FPFA 2QASA 2XKOC 2LNHB 1QP2A 4BDYA 2LX7A 2ED0A 2K5IA 1Y7XA 4BY6C 1GKNA 1YJNQ 2JXBA 4BUGA 3OEDC 4BE0A 1VQ7A 4PFZA 4N0AA 2FYKA 3E2UA 4M77F 2EYZA 4N7EA 1WLPB 2F2VA 4AG2C 4AT1B 4FW2A 3VWOA 3DB4A 4M75E 5CKHA 4FT2A 1WDXA 4CRIA 3GP8A 4KH0B 2RM4A 4J6WA 1S72Q 1Q7YU 3D7SB 2EBPA 1RLHA 2VYTA 3OW2S 2V8KA 2BZXA 2DVEA 5FLXE 2I2LA 3WVDB 1ZA1B 1X27A 4PL6A 4XK8E 1N8RC 3KBGA 1UDLA 3KXVA 3NMZC 4D6WA 4E7ZA 1G83A 5LJ5f 1ZUYA 2M0OA 2RHZA 3TSWA 1WYXA 2M16A 4A4GA 1VQKQ 2XQWC 4YIZA 2JTMA 5IHNA 4L59A 3F70A 1Q82U 3UDCA 2K4YA 1GCQA 1QKXA 1OV3A 1NG2A 3LYIA 4C92E 4PJOB 2EQJA 4AYEA 1Q3XA 2NYSA 3INBC 1TUGB 4M7AF 2LJ0A 2JJ9A 4A54A 3MQLA 1VQ8A 1Z92B 3JB9D 2D8HA 2R58A 3QO3A 3JCMW 4KRTA 2RB6A 5KYUA 4RG8A 1VQOT 1UEBA 3CCQQ 3M56A 4OMOA 3ZFJA 2EGEA 2O9SA 2Y90A 3BW1A 1G4GA 2C0TA 3A8MB 1SSHA 4CC3A 1MNDA 4RTVA 3IX0A 3OYJA 2QEXA 3H6ZA 2RLQA 2LQ8A 3A98A 3VS0A 1JJ2S 1OEBA 5GAMh 2XMFA 1ZA2B 1X2QA 1Q86C 2EW3A 4HVWA 1YJWA 2X2ZA 2NUZA 1OK2A 3ER0A 2YRCA 4C16A 2YLBA 1NZ9A 3HP9A 4B9WA 3UWNA 4PNOA 3V7CA 3EGXA 2L2PA 2K9GA 2GCXA 1BK2A 2CZ6B 2DBKA 3TU4K 2CH4A 2C0OA 1YJNT 2X4XA 5D6WA 1B07A 1D3BB 3O8VA 3LGLA 2CP3A 5GAMe 4WTOB 3CALA 5CKBA 4M7DC 2KI7A 4QVCA 1I5OB 2HD0A 4M75F 4ZNXA 3CMAT 2PUKB 2D0QB 2GQVA 3J7AF 3SFMA 3WVEB 3MP8A 1QVGS 2CZ7B 3PVLA 3EGDA 3ZL7C 3JCMf 1YI2A 4GLMA 1U3OA 1K73U 1TU0B 4X9CA 1JJ2P 3ZEHA 2OTJA 2P4RA 3QBYA 3VUZA 1TH7A 4JHSA 4JPBW 1PD1A 2GTOA 1FMKA 1GL5A 5EG2A 2M1HA 1JBMA 2KBTA 3CBOA 4C92F 4KKDA 4QT7A 1TXQA 3LGFA 2CP5A 2PTKA 3EHQA 3M0RA 2DRKA 3I9QA 4BE1A 1YJ9A 5LJ5h 3CC7Q 3J81E 2RO0A 2GQIA 3RMQA 2RJFA 1SSFA 5FWCA 2F1LA 1VQNA 1VVDA 1T0JA 3O8EB 2CT3A 3CCQT 1OJVA 1BBZA 3QDRB 1M1KC 2ECZA 4J7IA 3OXUD 4F17A 1N8RR 1H03P 3OYDA 2CKUA 2YRVA 4TVRA 2XDPA 1N9SA 3MP6A 4JZ3A 3MEAA 4M7DA 1D1CA 2RQTA 3HRTA 3RESA 3OS1A 2E70A 5LJ5e 1Y96B 1K0SA 2MWPA 4F7UE 5FRMA 2RMOA 4MDXA 2GTJA 3MEUA 5KYUB 3RUXA 2KT8A 4Y28E 1D1AA 3RBBB 1JXOA 4J9CA 2AKLA 1UGRB 1WI7A 2XDBA 2WIIC 3OYGA 2LJ3A 1ZUKA 3X28B 1HK9A 4ZH1D 1ZQ1A 1T3SA 2LQNA 4IGDA 3OYMA 1NPPA 4E7SA 4O5VA 1FYNA 3RNJA 5CKDA 5ECAA 4EPCA 4HVUA 2CG6A 2DIQA
chains in the Genus database with same CATH topology
4JJNK 3PNWC 3PFSA 4M77C 1D3BA 4C0GA 3OYKA 3V7SA 3UT1A 4C8QC 1YCYA 2R57A 3L2RA 4B9XA 1UGPB 2EJGA 2E41A 2ZPFB 2PU9B 4J5YA 4JLIA 2PVOB 4DOVA 5LJ3j 3CCLT 5A0LA 4MDWA 3S6WA 2ZCFB 3SWNB 4BD3A 2QXFA 4MZPA 3CC7A 3X26B 4M7AA 4LD6A 2LRQA 1NE8A 1BI3A 3A5ZB 4PJOE 5CK9A 2DZCA 2KK4A 2X4WA 2JTFA 2H3JA 3M57A 5L8RE 4F7UA 1P92A 2RH2A 1YITA 2VXEA 4KUIA 1W2BA 1M90U 1YIJA 2DTHA 2A7YA 5KCHA 4DQ2A 2E6NA 4HCZA 5GAMg 2BKDN 2PQWA 1H3ZA 1M1GA 1UB4A 3CCSA 2XG8D 2HQXA 3BDLA 3CC4T 1Q81U 2E10A 4BI3A 2B8AA 4NL2A 2PVGB 4R55A 3MEVA 3PGGA 3AHUA 4M78C 3G71A 3OSVA 2HBPA 2CGHA 3HPWA 2FB7A 2F5KA 3G6EA 3LH0A 4FU6A 3VJPA 4ZN3A 1PSFA 1QP3A 2VV5A 4EDUA 4VUBA 5LJ3g 4M7DG 3FGTA 4C92C 1XQHA 3X24B 3P8BB 3OQ5A 4LDYA 3S3NA 4GY5A 1VQPA 4E7HA 1K9MU 1JJ2A 4M77E 4HA8A 4DOWA 4BI8B 2IVWA 3I55A 2QA4A 4OVAA 3OY9A 5GAOq 4E7IA 2DXTA 5DLQE 4EMGA 4C8QE 3LWHA 3OYNA 2JVVA 2LDMA 3L2WA 3OMGA 5GANj 1VQLA 4ATOA 3RKYA 3TREA 4EMKB 2HNIA 3FC3A 3CC7T 4M75D 1KC8C 4XTUA 3VKIA 3F6KA 2IG0A 3C95A 3SWNC 3MCAB 2CYZB 3J80E 2EKOA 1G5VA 3JCMh 1YITT 2DXCA 2QQSA 3JAME 2K57A 5GAOn 5CQYA 5GMKm 4J6YA 4ELYC 4OP0A 4PJOA 4APLA 3G4SA 4Q5WA 4C0DB 4BDZA 4Z02A 4OF1A 1G3WA 1I8FA 2RK1A 4NOYA 3PIOA 3CCST 5GMKj 2GFAA 3A8OB 3X20B 1M90C 2PVDB 2X4JA 5M9OA 1X75C 3QSUA 1U8RA 1ZHIA 4FM4B 1M1FA 3OYIA 1VQ7T 3CCRT 5GAMd 2Y4XA 5DY9A 4M78E 4ELZC 3OMCA 3G6ET 3VYGA 4RCCA 3WXMB 3RIRA 2DEQA 3HFOA 1RL2A 1QVPA 4N0AC 1QVFA 1V29B 1H641 4E7KA 3L2VA 1Q81C 5GANg 4HKEA 2LTOA 3S3MA 1VQPT 5GMKe 4IUQA 2XU8A 3I55T 2LNVA 2P0QA 5LJ5j 2QA4T 2MAMA 2DXUA 1VQ6A 1QW1A 1VQ5A 1WNLA 1BKBA 3QJYA 4M78D 4E7JA 2XD0A 2K5LA 2DJZA 2YHTA 1VQLT 3URGA 4C0FA 3H8ZA 4M77A 3JCMV 4C0ZA 3E19A 2Y8RA 1YBYA 3OBWA 5LJ3d 3SB2A 4KT0E 4A4KA 4C8QA 4C92D 4BE2A 4IUUA 3CBMA 4OB3B 1DJ7B 4C5EA 3OYYA 5GAMf 1Y96A 3FGRA 3LW5E 3N5BB 3SDZA 3CCLA 2Y8TA 4N4IA 3MO8A 3G4ST 3QZ9B 5HKCA 2GFUA 3T9NA 3CCJA 4LD9K 3NTKA 4LDUA 1JB0E 3OW2A 4IUTA 2G3RA 1B34B 3HFNA 2E6ZA 4MZTA 3RERA 4HT9A 2ZPHB 2RJDA 3OSSC 4JS4A 3LLRA 1LOJA 1KHIA 2A3LA 1KHCA 2ZPBB 2EIFA 3QIIA 4RG2A 5LJ3f 1VQ4A 3A8GB 4XU1A 1Y71A 1BIBA 4BY6B 5LJ5g 1G3YA 1WJQA 4MZMA 4UC4A 3PTAA 2RHXA 4M7DB 3QHSA 2WSFE 2DTOA 2ZZDA 2K3XA 3HRSA 1BI2A 4IUPA 3M4YA 1M5Q1 4M78A 3X25B 1VQKT 3CC4A 2DIGA 3NJAA 3M54A 2LT4A 5J26A 5GMKi 1N27A 2VC8A 4C92A 2CZ1B 2EQKA 4XTYA 4JRIA 3GOXA 4M75C 2QI2A 3M55A 1N8RU 4OB0B 4IUVA 2RHUA 4IKFA 5GANd 4BB7A 2HQEA 4PJOG 3OYCA 5FU7B 5CVIA 2WSCE 1WQ7A 5LJ3h 3PMIA 4PJOF 3HL8A 2EJ9A 2NLUA 2JZ2A 2E12A 4FT4A 4LDVA 3SD4A 3SWNA 4Y91A 3CCJT 2VGMA 1M9SA 4XQ3A 1NPRA 3GNGA 2KDSA 2FL7A 3FLGA 3NTHA 3OS5A 4RCBA 3CXCA 4JRQA 1U1SA 4J8OA 1G3TA 4C5GA 2X35A 2RA2A 1XTDA 1W4SA 2DIQA 2XKOC 4EMHA 3C4SA 3L2QA 4BDYA 1QP2A 1VQ4T 2DXBA 4JRKA 2OTLA 1K8AC 4J7FA 3OYFA 2K5IA 1KQSA 5GANf 1Y7XA 4BY6C 5FU6C 3M58A 4E7LA 2EJFA 2XI9A 4C5IA 4BUGA 3RKXA 4L6V5 4LDXA 1YJWT 5DM7R 1VIEA 3L42A 3OBYA 4BE0A 3VUBA 1XNIA 4M77G 1WGSA 5GAN5 4A4EA 5KCOA 1VQ7A 3CCRA 4N0AA 2FYKA 4M77F 4XTWA 1OYXA 3OYLA 1S72T 4C8QG 5LJ5d 2DTIA 4N7EA 3JB9I 1AHJB 3JB9J 1WQWA 2XICA 5CCAA 3DB4A 4M75E 5CKHA 3FB9A 4FL6A 4FT2A 4CRIA 3GP8A 1VQMA 3E1SA 2L89A 2MF2A 2RM4A 4J6WA 4ZGDB 1VQ9A 2O01E 5GANh 5J3BA 1OZ3A 2E65A 1Q7YU 1IREB 1XOVA 1WJRA 2VYTA 3OW2S 2V8KA 4KULA 4XU3A 1M1KU 2DVEA 5FLXE 4BWCA 2I2LA 2DZ9A 3WVDB 3ZLDA 4PL6A 4XK8E 5HK0A 4RMOA 1N8RC 2C06A 3JB9G 4MMLA 3KBGA 3CCMT 3GF5A 5D6XA 1OZ2A 3JB9F 4D6WA 2DKGA 1WJSA 4OB2B 4KBMB 4II1A 1Y07A 2JOYA 5LJ5f 3R6OA 3QKJA 2O4XA 2M0OA 2OTLT 2RHZA 4HCBA 2CZ0B 5J39A 2M16A 4PKCC 2QQBA 1VQOA 4A4GA 5C6SA 3M4GA 4YIZA 2JTMA 2R5AA 3TU4K 1Q86U 1VIFA 4QW2A 2QQAA 3OYHA 3GNFB 3OYBA 4L59A 4OGCA 4A4FA 3QUIA 4PLIA 3F70A 2DK3A 2EFIA 2K4YA 3UDCA 1Q82U 3CC2T 3CD6T 3FRNA 2RHIA 4J83A 4QVDA 5DLOA 3OS0A 3HRUA 4FIBA 2D6FA 3LYIA 1VQMT 1VQKA 4C92E 4M7DD 4PJOB 4NL3A 4FSXA 1VQ9T 2EQJA 1MGQA 4M75A 1I5LA 4XTVA 4M7AG 4XAXB 5FROA 4J6XA 2L8DA 4M7AF 3NTIA 3RKWA 1W2BS 5LL6S 4A54A 4F7UG 3C94A 3TEEA 4EMKC 2JNGA 2XHCA 4F7UF 3JCMe 4P5NA 2ZPEB 3CPWA 3P8HA 1K9MC 1MHNA 3BY7A 4OB1B 4JUVA 1VQ8A 2QQRA 3JB9D 3Q1JA 4IURA 2CKKA 1BIAA 1KQSS 3QYGB 2R58A 5CKEA 4R56A 3QO3A 2LT1A 2CS7A 2FVUA 2LQKA 3TCJA 3JCMW 2RK2A 2RB6A 4C0DC 1B34A 3JCMJ 4RG8A 4CI0C 1VQOT 3JSCA 1UEBA 1QVGA 1U1TA 3M56A 4L5GA 3ZFJA 2BUDA 2RI3A 2DD4A 2Y90A 3BW1A 2PUOB 4PLLA 4RKUE 3A8MB 4M77B 3JCMg 1YJNA 3JCMQ 1PSEA 3UPUA 3OYJA 2QEXA 3H6ZA 1LNXA 3V8JA 2LQ8A 2JUFA 1X6OA 1KQ1A 2LC4A 3V7RA 1JJ2S 3EFRA 3L2ZA 5GAMh 5A0DA 1YJ9T 3M53A 5GAN3 3HSBA 4M7DF 4XU2A 4X34A 1Q86C 1YJWA 2EYQA 4PJOC 4V2SA 1HXDA 2X2ZA 3PIPA 2LCCA 3ER0A 4QVZA 3WSXA 5HY6A 2YLBA 5KE3A 1Q82C 1NZ9A 5CAIA 5GAOl 1S72A 3EFSA 3HP9A 4M7AD 4WF2A 4A4HA 3META 4B9WA 4BACA 2EAYA 2LCLA 3UWNA 3VV0A 3V8KA 2V8IA 1EIFA 4PNOA 5CKFA 3V7CA 5KE2A 1VQ8T 1KG1A 3JCMc 1FWZA 2WSEE 3JCMX 2AHJB 2V8JA 2MMPA 5GAN4 5GAN6 4BI4A 3BDUA 2GCXA 3KXTA 3QPHA 2CZ6B 2HAXA 2K5FA 2K3YA 3DKMA 2R5MA 2XK0A 5CR2A 5CQXA 3NFCA 3JCMb 3I56T 3OA6A 3CMEA 3DLLA 3WSYA 3CCMA 2KMTA 3CCVA 1YJNT 1VUBA 2X4XA 3CCUA 1KC8U 1QVFS 3ZLEA 2QEXT 4HCCA 1NJIU 2RJCA 3EAEA 5D6WA 1D3BB 3O8VA 3LGLA 5GAMe 5I2MA 5CKBA 3MP1A 4XTXA 4QVCA 2KQWA 3LX7A 2ZGWA 2HD0A 2LVMA 4M75G 4M7DC 3KUFA 3CCET 4M75F 3JCMd 1KD1U 2L3RA 4M7AB 3DLMA 3M5AA 4OMFB 4QQDA 2LX9A 4LDWA 3CC2A 3CMAT 3CPWS 3CD6A 4C8QF 4F7UB 2PUKB 2L5QA 2MI6A 2P0KA 1GXIE 3VYHB 2RJEA 1BI1A 4O6JA 5LJ3e 5IAYA 2D0QB 2GQVA 3GLXA 3J7AF 2RHYA 4JDSA 2RI2A 3CBPA 1O75A 3ZBDA 4MMKA 3SFMA 5FU7C 3JB9H 4PJOD 4ZN1A 3WVEB 3MP8A 2DPPB 5D6YA 1QVGS 4EMKA 1ZBXA 2QTXA 1RI0A 4ZGEB 2CZ7B 2DO3A 4JS5A 2ZPGB 3QZ5B 1IZ6A 1YHQA 3JCMf 3CEYA 5AYFA 1YI2A 3CMET 4ZTJA 1KQ2A 4ZGJB 1K73U 3CCQA 3CCVT 2QDYB 2KY9A 3CCUT 4X9CA 4GLKA 1JRIA 3ZEHA 3JCMP 4XU0A 5IT9E 2OTJA 2FHDA 5GMKh 4MSLA 4M78G 1LJOA 3GPLA 3FJPA 3M9QA 3DB3A 2EQMA 3QBYA 4M78F 4QQ6A 3MEWA 3VUZA 1TH7A 2VUBA 1WPYA 4M7DE 4C92G 2RD1A 5EG2A 2M1HA 3BFMA 3FIFA 3JRZA 1JBMA 3CBOA 2YLCA 4C92F 2XDDA 1NJIC 1OI1A 3LWIA 4M77D 2DD5A 3FDRA 3QYHB 4M7AC 2JN0A 3MHXA 1R8OB 2P0PA 2XIDA 3LGFA 4XTZA 3RMSA 3V8LA 4C8QD 3C12A 3OYAA 1YIJT 4BE1A 1YJ9A 5LJ5h 3E9FA 4KUDK 1UGQB 3J81E 2RO0A 5I21A 5GAOp 1N6AA 2O4XB 3RMQA 5GANe 1KD1C 1UGSB 2RJFA 1BYMA 1SSFA 2E1HA 4DA4A 4E47A 3CXCS 4C5HA 1VQNA 5FRNA 1FX7A 3G71T 3HHTB 1YHQT 1YI2T 2QQ9A 3QJ6A 2EQUA 3CCQT 4ZTFA 1Q7YC 5CO7A 5GAOr 3QG1A 4JLGA 5GAN8 2KSSA 3QDRB 1M1KC 2OTJT 5I2SA 2Y4YA 3S3OA 4J7IA 5GMKl 5GAOm 2BIVA 3L2UA 2K2VA 3L1AA 3PMTA 4N4GA 1N9RA 2P4TA 5HK3A 3QXEB 4JRPA 3I56A 4HT8A 4M75B 3E9GA 5A0GA 3OYDA 1K73C 2VXFA 2YRVA 5CIUA 3OYEA 4TVRA 2XDPA 4A53A 2KAFA 1N9SA 3MP6A 3MEAA 4C8QB 1M8VA 1I81A 4M7DA 4NS5A 3HRTA 3RESA 3OS1A 2MWOA 2E70A 2ZPIB 1FXXA 5LJ5e 5GAN2 4M7AE 1Y96B 1O9SA 2WACA 2D9TA 2MWPA 4ME7A 3GIBA 4F7UE 2Y8SA 3INZA 3CCEA 1K8AU 5FRMA 4MDXA 3MEUA 4PO7A 2RI5A 2E5QA 4QQGA 3RUXA 3A8LB 5KH6A 3CMAA 4Y28E 1VQNT 3M59A 3HKSA 2F5TX 2KVQG 3P8DA 3OS2A 1UGRB 5GAN7 2F69A 2XDBA 3OYGA 3CPFA 3PT9A 2X4YA 1BI0A 4YTLA 3VU3C 3ASKA 3G7ZA 5FU6B 2E64A 3X28B 3FEOA 1HK9A 1G3SA 1I4K1 3ME9A 3OB9A 4X9DA 5IN1A 2VGNA 1M4ZA 1X01A 5GAMj 5A2QE 1ZQ1A 4M78B 3OYMA 1VQ6T 2EWNA 1VQ5T 1NPPA 4N4HA 4O5VA 5C0MA 2OAUA 3A8HB 5CKDA 2DAQA 4EPCA 4C92B 2M9UA 4OGEA 2GF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMK A;  2QTX A;  4M77 C;  1B34 B;  1D3B A;  3HFN A;  4QVD A;  3V7S A;  4C8Q C;  3RER A;  4HT9 A;  1YCY A;  4C92 E;  4M7D D;  4PJO B;  2EJG A;  2E41 A;  4J5Y A;  4JLI A;  3JCM f;  5LJ3 j;  4NL3 A;  1LOJ A;  1KQ2 A;  1MGQ A;  4M75 A;  1I5L A;  4XTV A;  5LJ3 f;  3SWN B;  4X9C A;  4XU1 A;  1BIB A;  1JRI A;  5LJ5 g;  4M7A G;  4M7A A;  3JCM P;  4J6X A;  4XU0 A;  4PJO E;  4M7A F;  4M7D B;  2DZC A;  3QHS A;  3RKW A;  4A54 A;  4F7U G;  2DTO A;  4M78 G;  4EMK C;  1LJO A;  4F7U A;  3FJP A;  2VXE A;  1M5Q 1;  4M78 A;  4F7U F;  3JCM e;  4M78 F;  5GMK h;  3BY7 A;  4JUV A;  1TH7 A;  2DTH A;  1WPY A;  3JB9 D;  5GMK i;  4DQ2 A;  1BIA A;  5GAM g;  4C92 G;  2RD1 A;  2VC8 A;  4M7D E;  4C92 A;  3BFM A;  3FIF A;  1JBM A;  4XTY A;  2YLC A;  3QO3 A;  4JRI A;  4M75 C;  4C92 F;  3JCM W;  2RB6 A;  4M77 D;  1B34 A;  3JCM J;  4M7A C;  2E10 A;  2JN0 A;  5GAN d;  1U1T A;  4XTZ A;  4C8Q D;  4NL2 A;  3V8L A;  4PJO G;  5LJ3 h;  5LJ5 h;  1WQ7 A;  2Y90 A;  3BW1 A;  3PGG A;  4M78 C;  4PJO F;  5GAO p;  5I21 A;  3AHU A;  2CGH A;  2EJ9 A;  4M77 B;  3JCM g;  2FB7 A;  4Y91 A;  5GAN e;  3SWN A;  3JCM Q;  1LNX A;  4XQ3 A;  2E1H A;  3V8J A;  3V7R A;  4C92 C;  1KQ1 A;  5LJ3 g;  4M7D G;  3EFR A;  3L2Z A;  5GAM h;  4M7D F;  4RCB A;  4M77 E;  4HA8 A;  1U1S A;  5GAN 3;  3HSB A;  5GAO q;  4XU2 A;  2DXT A;  2RA2 A;  4EMG A;  4C8Q E;  5GAN j;  4EMH A;  4PJO C;  1HXD A;  4V2S A;  3RKY A;  4JRK A;  4EMK B;  2HNI A;  5GAO r;  2YLB A;  4M75 D;  5CAI A;  4XTU A;  5GAN f;  5GAN 8;  3SWN C;  5GAO l;  3EFS A;  5GMK l;  4M7A D;  3JCM h;  4WF2 A;  2EJF A;  5GAO m;  3L1A A;  1N9R A;  2EAY A;  2K57 A;  5GAO n;  3RKX A;  5GMK m;  4J6Y A;  3V8K A;  4OP0 A;  4PNO A;  3V7C A;  4HT8 A;  4M75 B;  4PJO A;  4M77 G;  2VXF A;  3JCM c;  5GAN 5;  3JCM X;  4N0A A;  2FYK A;  4M77 F;  4XTW A;  1I8F A;  4NOY A;  4C8Q G;  4A53 A;  2DTI A;  5LJ5 d;  1N9S A;  5GAN 4;  5GAN 6;  3JB9 I;  4C8Q B;  3JB9 J;  1WQW A;  5GMK j;  1I81 A;  3BDU A;  4PJO D;  1M8V A;  4M7D A;  4M75 E;  3FB9 A;  3QSU A;  3RES A;  3JCM b;  5LJ5 e;  5GAN 2;  4M7A E;  1Y96 B;  2RM4 A;  4J6W A;  5GAN h;  2E65 A;  5GAM d;  4F7U E;  3INZ A;  5DY9 A;  4M78 E;  3GIB A;  4RCC A;  4XU3 A;  3RIR A;  2DEQ A;  2DVE A;  3HFO A;  2DZ9 A;  2I2L A;  4N0A C;  3RUX A;  1D3B B;  1H64 1;  5GAM e;  5GAN g;  5GMK e;  3JB9 G;  4MML A;  5LJ5 j;  4XTX A;  4M7D C;  4QVC A;  2DXU A;  2ZGW A;  3JB9 F;  4M75 G;  1WNL A;  2DKG A;  5GAN 7;  4M78 D;  5LJ5 f;  2DJZ A;  2YHT A;  4M75 F;  3VU3 C;  3JCM d;  4M77 A;  3JCM V;  2E64 A;  1HK9 A;  1I4K 1;  4M7A B;  4X9D A;  5LJ3 d;  3SB2 A;  4C8Q A;  5GAM j;  1X01 A;  4C92 D;  4C8Q F;  4F7U B;  4M78 B;  3M4G A;  2EWN A;  5GAM f;  1Y96 A;  5LJ3 e;  3JB9 H;  4MMK A;  4C92 B;  3QUI A; 
#chains in the Genus database with same CATH topology
 4JJN K;  3MPU B;  4M77 C;  1VQ5 Q;  1RAD B;  4ORZ A;  3UT1 A;  4C8Q C;  4JLI A;  2E41 A;  4J5Y A;  2PU9 B;  3EGX B;  4DBF A;  1OOT A;  3EFO A;  1PCX A;  5CK9 A;  2DZC A;  2KK4 A;  4DJZ A;  2JTF A;  2RH2 A;  1M90 U;  3CCJ Q;  2OX7 A;  1KQS P;  2DTH A;  5GAM g;  4DQ2 A;  2E6N A;  4HCZ A;  1Q86 R;  1UB4 A;  4J9E A;  1Y57 A;  2LJ1 A;  5KYY B;  4NL2 A;  4R55 A;  3AHU A;  4M78 C;  3G71 A;  3G6E A;  2HBW A;  3VJP A;  1NEB A;  3FGT A;  4M7D G;  3VS3 A;  1TOV A;  4LDY A;  2CT4 A;  1VQP A;  1JJ2 A;  4DOW A;  4HA8 A;  4BI8 B;  2QA4 A;  4OVA A;  3I35 A;  3OY9 A;  2K7A A;  5DLQ E;  2DF6 A;  5GAN j;  4ATO A;  2QY0 A;  1NBE B;  3TRE A;  2HNI A;  3CC7 T;  2HSE B;  2QAZ A;  4XTU A;  3VKI A;  1G5V A;  2KNB B;  2EKO A;  2M51 A;  1MMD A;  3JCM h;  4PFP A;  2K57 A;  3EG2 A;  4ELY C;  4OP0 A;  5KYW A;  2JRA A;  4OF1 A;  3PIO A;  1PM3 A;  2GFA A;  1X75 C;  1D09 B;  2DEQ A;  1X43 A;  5DN5 A;  1V29 B;  1H64 1;  4E7K A;  1Q81 C;  4HKE A;  2LTO A;  2W81 A;  4WCI A;  5GMK e;  4IUQ A;  2LNV A;  1VQ6 A;  3CD6 Q;  1NEG A;  1BKB A;  4M78 D;  2MCN A;  2K5L A;  3FJ5 A;  4M77 A;  3JCM V;  1EZZ B;  2NUP A;  3E19 A;  3CPW P;  2Y8R A;  1KFZ A;  4C8Q A;  3CBM A;  4OB3 B;  1DJ7 B;  3H41 A;  1WXT A;  3SDZ A;  3MO8 A;  3QZ9 B;  3NTK A;  3SHW A;  2ZPH B;  4JS4 A;  3LLR A;  1LOJ A;  1KHC A;  1HSQ A;  5LJ3 f;  2A08 A;  3A8G B;  4XU1 A;  1BIB A;  1G2B A;  5LJ5 g;  2JGW A;  2RHX A;  1WHG A;  4M7D B;  2DTO A;  2ZZD A;  1VQK T;  4FCY A;  4M78 A;  1M5Q 1;  5KYX B;  5IHI A;  2DIG A;  2RKY A;  2CZ1 B;  2EQK A;  4XTY A;  4M75 C;  2QI2 A;  1WHH A;  1M27 C;  1M1K R;  1ABQ A;  2WSC E;  1MMA A;  1V1C A;  4Y91 A;  2E12 A;  1SEM A;  3CCJ T;  4RTU A;  1AZG B;  2VGM A;  3CXC P;  1NPR A;  7AT1 B;  2O9V A;  2KDS A;  2JS2 A;  4JRQ A;  2X35 A;  3L2Q A;  1K8A C;  2SRC A;  1KQS A;  4FYX B;  5FU6 C;  2EJF A;  4C5I A;  3RKX A;  1RAH B;  3VUB A;  4M77 G;  3EFO B;  5KCO A;  3CCR A;  1OYX A;  3NFP I;  4C8Q G;  1OX9 A;  1AHJ B;  1IGU A;  1WQW A;  2KMS A;  1R77 A;  1OUL A;  3FB9 A;  2L89 A;  1YWO A;  1YFN A;  5GAN h;  2E65 A;  1IRE B;  1WJR A;  1K1Z A;  4KUL A;  1UOT P;  2EYX A;  4XU3 A;  1M1K U;  2DZ9 A;  2DEU A;  3ZLD A;  2IZ4 A;  5D6X A;  4RTZ A;  4II1 A;  1Y07 A;  2JOY A;  2O4X A;  4HCB A;  2Z0W A;  2QTV A;  2QQB A;  1VQO A;  3CCV Q;  1MD7 A;  2KEA A;  5C6S A;  3M4G A;  3CCU Q;  5AT1 B;  1VIF A;  1LVK A;  3QUI A;  4CC2 A;  3CC2 T;  3CD6 T;  2J6F A;  2L3P A;  2MOX A;  1IGQ A;  2AZS A;  1PC0 A;  1H3H A;  2D6F A;  4PJJ A;  4FSX A;  4ANJ A;  4M75 A;  4XTV A;  3LH5 A;  4M7A G;  3KZJ A;  5FRO A;  2L8D A;  1AD5 A;  5LL6 S;  3TEE A;  2JNG A;  1UJY A;  4KGX B;  3CPW A;  3P8H A;  1MHN A;  2QQR A;  2CKK A;  1BIA A;  2LT1 A;  2LQK A;  1YHQ Q;  1B34 A;  2V1R A;  1CKL A;  1BU1 A;  4PLL A;  4M77 B;  1TG0 A;  3JCM g;  1VYT A;  1YJN A;  4K11 A;  4J9I A;  1OJY A;  3REB B;  3V8J A;  3V7R A;  1X6O A;  5A0D A;  5GAN 3;  3K3T A;  4D8D A;  1UG1 A;  5HY6 A;  3WSX A;  5GAO l;  1S72 A;  2KRO A;  2YSQ A;  3NPF A;  3EFS A;  4A4H A;  4BAC A;  2DM1 A;  2V8I A;  1EIF A;  2RF0 A;  2LP5 A;  1FWZ A;  2AHJ B;  1TUD A;  1M30 A;  3BDU A;  2HAX A;  3JCM b;  5CR2 A;  3CCM A;  3NFC A;  1CKA A;  2KMT A;  1VUB A;  1NJI U;  1OQK A;  4LUD A;  2KQW A;  1E5G A;  2ZGW A;  3TQ7 P;  4M75 G;  3CCE T;  2PZ1 A;  1CSK A;  4M7A B;  2OI3 A;  4QQD A;  2LX9 A;  4C8Q F;  2MI6 A;  1GXI E;  5LJ3 e;  2QGG A;  5IAY A;  3CMA Q;  3CBP A;  3JB9 H;  4MMK A;  2QTX A;  4ZGE B;  1Q95 G;  4AFU C;  2KXD A;  3CEY A;  4ZTJ A;  1M3A A;  3CCQ A;  3CCV T;  3CC4 Q;  2LQW A;  4AFQ C;  3CCU T;  4GLK A;  3I5R A;  3JCM P;  5IT9 E;  2KGT A;  1UEC A;  3CQT A;  4MSL A;  3FJP A;  3M9Q A;  4RUG A;  2GNC A;  4M78 F;  3MEW A;  4J9F A;  3RDV A;  4C92 G;  3BFM A;  3FIF A;  4OMP A;  2NUT A;  1X6B A;  2DL5 A;  2LMJ A;  3LWI A;  1K8A R;  2XID A;  1T0H A;  2A0F B;  4XTZ A;  3C12 A;  4KUD K;  2O4X B;  1KD1 C;  1YIT Q;  4LNP A;  1BYM A;  4C5H A;  1FX7 A;  3HHT B;  2HCK A;  1YHQ T;  2BZY A;  2QQ9 A;  2F2X A;  2QYZ A;  3CCS Q;  2EQU A;  2L3S A;  4FYV B;  5CO7 A;  1WHL A;  2DBM A;  2Y4Y A;  5GMK l;  1IHV A;  2P4T A;  3QXE B;  3I56 A;  4HT8 A;  4M75 B;  5A0G A;  3OYE A;  2FG0 A;  1HYO A;  2KAF A;  1GFC A;  2DLP A;  1I81 A;  2RKZ A;  2D1X A;  1HFH A;  1VQL Q;  4DBR A;  1QQJ A;  1O9S A;  3T5O A;  3OW2 P;  1OPK A;  4ME7 A;  3GIB A;  3INZ A;  1K8A U;  2DNU A;  1FMV A;  2GBQ A;  3G4S Q;  1W1F A;  4LOS A;  3HKS A;  1NLP C;  1H8K A;  1C1Z A;  3G7Z A;  1I0C A;  5FU6 B;  1YNZ A;  3ME9 A;  1MMG A;  1RI9 A;  1OX8 A;  2E4H A;  4MUC A;  2CUD A;  3ULR B;  3RR6 A;  1NM7 A;  2ATC B;  2J6O A;  4C92 B;  2GF7 A;  3PNW C;  3OYK A;  3V7S A;  1J3T A;  3L2R A;  2R57 A;  2DL7 A;  1UGP B;  2EJG A;  4B9X A;  2PVO B;  4MDW A;  3S6W A;  2K3B A;  2ZCF B;  3CC7 A;  3X26 B;  1IB8 A;  3EG9 A;  3A5Z B;  3VS1 A;  4B2S A;  5L8R E;  4F7U A;  3VS2 A;  1YIJ A;  4J9B A;  5KCH A;  4HVV A;  1H3Z A;  2XG8 D;  4WJG 2;  3CC4 T;  2E10 A;  4BI3 A;  1VQ4 Q;  2PVG B;  4CSY A;  3MEV A;  3PGG A;  3R62 A;  3HPW A;  1WFW A;  2FB7 A;  4ZN3 A;  5LJ3 g;  3VRY A;  1M3C A;  3S3N A;  4E7H A;  5I0Q B;  2PNI A;  2IVW A;  2ZAE A;  2MIO A;  2JVV A;  3RKY A;  5HYU B;  2KT1 A;  2IG0 A;  3SWN C;  3MCA B;  2ED1 A;  2C0I A;  1YIT T;  3JAM E;  2FPD A;  4OMN A;  2RN8 A;  2HSP A;  1PKT A;  4Q5W A;  1K76 A;  4RTW A;  1I8F A;  2JW4 A;  3CCS T;  1UHF A;  5GMK j;  2J05 A;  1ABO A;  2PVD B;  2X4J A;  2OTL Q;  1U8R A;  2ERJ A;  1ZHI A;  1E8B A;  1VQ7 T;  5GAM d;  3OMC A;  2RNA A;  4RCC A;  1TPM A;  2EC3 A;  1QVP A;  2CP6 A;  3L2V A;  1QGB A;  2CP0 A;  2XU8 A;  1VQ5 A;  1WNL A;  2XD0 A;  2DJZ A;  1VQL T;  3H8Z A;  4JZ4 A;  1VQM Q;  4OMQ A;  3OBW A;  4BE2 A;  4KT0 E;  1VQ9 Q;  1C6V X;  3M0T A;  3OYY A;  3CCL A;  3G4S T;  2CUB A;  5HKC A;  1QVG P;  3T9N A;  3CCJ A;  4LD9 K;  3OW2 A;  4IUT A;  1UE9 A;  2X3X D;  1AWW A;  3IU3 I;  1NWV A;  3OSS C;  2P84 A;  1EFN A;  1MV3 A;  1KK7 A;  4BY6 B;  3PTA A;  1WJQ A;  4AYM A;  2J6K A;  2YUO A;  1KD1 R;  3QHS A;  3HRS A;  3L2W A;  3M4Y A;  3X25 B;  4PJN A;  1D0Y A;  1BB9 A;  1N27 A;  1KSW A;  2A37 A;  1FMW A;  1N8R U;  4IUV A;  2RHU A;  1M8M A;  1JU5 C;  1GFD A;  5DN4 A;  2EKH A;  2NLU A;  1AVZ C;  2JM9 A;  2JZ2 A;  3SWN A;  3JV3 A;  1ARK A;  2KE9 A;  1KIK A;  4DBH A;  5I22 A;  3FLG A;  2I0N A;  1NLO C;  1WXU A;  4J8O A;  2DA9 A;  2X51 A;  4LE9 A;  3VS7 A;  3C4S A;  2RQR A;  1ZBJ A;  1VQ4 T;  2DXB A;  3R6N A;  5GAN f;  4E7L A;  3GXE A;  1YJW T;  3L42 A;  3OBY A;  4A4E A;  4DEY A;  3OYL A;  3EG9 B;  4E2F B;  5LJ5 d;  2DTI A;  1CKB A;  3JB9 I;  3JB9 J;  1WA7 A;  5CCA A;  3OP8 A;  4FL6 A;  3E1S A;  2KRI A;  1PWT A;  2MF2 A;  4ZGD B;  2O31 A;  1C1A A;  1RAG B;  1XOV A;  1YP5 A;  2EPD A;  4BWC A;  2XWJ I;  4RMO A;  2ROT A;  5HK0 A;  2ENM A;  3EGD B;  3JB9 F;  2DKG A;  1WJS A;  4OB2 B;  1NYG A;  3R6O A;  1QWF A;  2OTL T;  5J39 A;  3CME Q;  4PKC C;  4LXC A;  1YN8 A;  4JJB A;  2BZM A;  2L3Q A;  1Q86 U;  2QQA A;  3OYH A;  4OGC A;  2B5I D;  5HZP B;  1F1B B;  1JXM A;  3FRN A;  2RHI A;  3OS0 A;  1RAI B;  2MCY A;  1ZJK A;  2IZ3 A;  1VQM T;  2VVK A;  3CC2 Q;  1VQ9 T;  1I5L A;  2ZYC A;  1GKG A;  3I5S A;  1WHK A;  4J6X A;  4RTY A;  3RKW A;  1W2B S;  1MV0 B;  2YRD A;  4PK4 A;  3C94 A;  2XHC A;  1PPQ A;  4F7U F;  3JCM e;  1V76 A;  4P5N A;  4OB1 B;  4JUV A;  1GRI A;  3QYG B;  1SF9 A;  3EG3 A;  5CKE A;  3G71 Q;  1GCP A;  3TCJ A;  1MMN A;  4A5W B;  4C0D C;  3JCM J;  4QKU A;  1QVG A;  2RPN A;  1U1T A;  2BUD A;  1LY2 A;  2DD4 A;  1K9A A;  2FZC B;  3UPU A;  1AWX A;  1KQ1 A;  2LC4 A;  3TVJ A;  3EFR A;  1IXD A;  1YJ9 T;  2W80 A;  2F2W A;  3M53 A;  2IPO B;  3EH1 A;  4X34 A;  1C0M A;  4PFO A;  2EYQ A;  4PJO C;  4V2S A;  2HKQ B;  1Q82 C;  5CAI A;  1Z9Q A;  2QGF B;  4M7A D;  2E5K A;  2EAY A;  2LCL A;  3VV0 A;  1WZO A;  3JCM c;  1HD3 A;  2DYI A;  2V8J A;  4IIO A;  5GAN 4;  4BI4 A;  3KXT A;  1H2Q P;  1JO8 A;  3DKM A;  2FRW A;  2R5M A;  2QDL A;  5CQX A;  3OA6 A;  3WSY A;  3CCV A;  5IXF A;  2H3E B;  2EGC A;  3CCU A;  1R0B G;  1QVF S;  1M2V A;  5GJW B;  4HCC A;  5JPM G;  2DL8 A;  3UA6 A;  5I2M A;  2V8E A;  4XTX A;  4HXJ A;  2LVM A;  1PG5 B;  1OK9 A;  3KUF A;  3JCM d;  1W2B P;  3M5A A;  4OMF B;  2J7I A;  2BE9 B;  5HCK A;  2L5Q A;  3CCE Q;  1M2O A;  2RJE A;  1BI1 A;  4O6J A;  1TS9 A;  1SRM A;  3GLX A;  3EHR A;  4JDS A;  2RI2 A;  2FZK B;  1O75 A;  5FU7 C;  4GBQ A;  4PJO D;  1X69 A;  3NHN A;  1RI0 A;  2RQU A;  3QWX X;  2ZPG B;  5GJV B;  1IZ6 A;  1PKS A;  1YHQ A;  2KRM A;  4F14 A;  5AYF A;  2EVR A;  3CME T;  2DFU A;  2KY9 A;  2DX1 A;  2QK0 A;  4XU0 A;  2FHD A;  1TPG A;  2JS0 A;  4M78 G;  1LJO A;  1VVC A;  2YUP A;  3DB3 A;  4FYW B;  2B86 A;  1PRL C;  2VUB A;  2YLC A;  1HCC A;  2XDD A;  1OI1 A;  3QYH B;  2IIM A;  3MHX A;  1R8O B;  2P0P A;  3OYA A;  3E9F A;  1HJD A;  5KYW B;  5GAN e;  1UGS B;  2V26 A;  2FRY A;  2MK5 A;  4DA4 A;  4F4O C;  1E6H A;  5FRN A;  1ZUU A;  3H9N A;  3G71 T;  2MCZ A;  4R0K A;  2DRM A;  1VOM A;  1YCS B;  4JLG A;  2DER A;  1KJW A;  4HCK A;  1BCO A;  1LPL A;  3QDF A;  5GAO m;  3HTR A;  2K2V A;  3L1A A;  3PMT A;  5HK3 A;  4E6R A;  4JRP A;  3E9G A;  1K73 C;  2VXF A;  3I55 Q;  2NUP B;  4A53 A;  1O9A A;  2CG7 A;  5FO8 C;  2YUQ A;  4C8Q B;  4NS5 A;  1ZX6 A;  2MWO A;  2ZPI B;  4M7A E;  2BE7 D;  2WAC A;  1IHW A;  3TVT A;  2Y8S A;  1SRZ A;  4PO7 A;  4EIK A;  2E5Q A;  4QQG A;  3A8L B;  3CMA A;  3GBQ A;  2DET A;  3M59 A;  2KVQ G;  3P8D A;  2LOJ A;  3OS2 A;  2F69 A;  3CPF A;  3PT9 A;  1Q81 R;  1BI0 A;  4K12 A;  1I07 A;  3REA B;  3ASK A;  2E64 A;  1I4K 1;  3OB9 A;  4X9D A;  5EC7 A;  2VGN A;  1M4Z A;  1VYV A;  3A1P A;  5GAM j;  5A2Q E;  1QUB A;  4M78 B;  1SKU B;  1VQ6 T;  2EWN A;  2RL0 A;  1VA7 A;  1PHT A;  2EYY A;  4N4H A;  2M9U A;  4OGE A;  4FSS A;  1UTI A;  2KXC A;  4LUE A;  1D3B A;  5L23 A;  2COW A;  1IRX A;  1M3B A;  4MZP A;  1AEY A;  4LD6 A;  1NE8 A;  1BI3 A;  2RQV A;  4PJO E;  2DIL A;  2MPX C;  1P92 A;  1YIT A;  1W2B A;  2VXE A;  5HYT B;  2EYW A;  2BTT A;  2JGX A;  1U5S A;  1OK1 A;  2BKD N;  3CI0 J;  1M2V B;  2PQW A;  1H92 A;  3CCS A;  2AZV A;  2HQX A;  1PRM C;  1AWJ A;  3BDL A;  2YRA A;  1Q81 U;  1Z9Z A;  3M7P A;  1Q82 R;  2AKK A;  2KR3 A;  2XRD A;  2HBP A;  2F5K A;  3LH0 A;  2VV5 A;  1ZSZ C;  4KGV B;  2ESW A;  4VUB A;  4EDU A;  2K79 A;  1ACM B;  2YXY A;  3P8B B;  3OQ5 A;  1R0C B;  3M0P A;  1XJW B;  3EGU A;  4E7I A;  1RAC B;  2DXT A;  4EMG A;  4F16 A;  3LWH A;  3OYN A;  1QCN A;  2JMA A;  3OMG A;  1VQL A;  2CRE A;  3FC3 A;  4AYD A;  1KC8 C;  3J80 E;  3C0C A;  2CH4 W;  2QQS A;  1T3L A;  5CQY A;  1UGV A;  5GMK m;  3ZRZ A;  1A0N B;  4APL A;  1ELV A;  3G4S A;  4C0D B;  4Z02 A;  2LCS A;  2RK1 A;  3CCM Q;  2KYB A;  1U06 A;  1N5Z A;  1TTH B;  1UUE A;  1M90 C;  2A28 A;  5M9O A;  3ZD1 A;  3L89 M;  3OYI A;  3CCR T;  2K2M A;  2COZ A;  5DY9 A;  2MYS A;  3WXM B;  3RIR A;  4KH1 B;  1QVF A;  1VQ7 Q;  1WIE A;  5GAN g;  3S3M A;  2HL3 A;  3I55 T;  5LJ5 j;  1QO6 A;  2DXU A;  2M0Y A;  1QW1 A;  5FW9 A;  3PVQ A;  1JEG A;  2VB6 A;  2GGR A;  3URG A;  4Y92 A;  4C0F A;  4C0Z A;  2G6F X;  1YBY A;  5LJ3 d;  3SB2 A;  4A4K A;  1PD0 A;  4IUU A;  4C5E A;  1D0X A;  2FEI A;  2ROL A;  1Y96 A;  3N5B B;  3LW5 E;  2NWM A;  2Y8T A;  4CC4 B;  2GFU A;  4PJL A;  4LDU A;  1B34 B;  2DVJ A;  3HFN A;  4MZT A;  3RER A;  4HT9 A;  2HL5 C;  1KHI A;  2A3L A;  1E6G A;  1S1N A;  2EIF A;  2ZPB B;  4RG2 A;  8ATC B;  1VQ4 A;  2KRN A;  1G3Y A;  4UC4 A;  2M02 A;  1BI2 A;  1I1J A;  1D1B A;  1E7O A;  1X6G A;  2D0N A;  2ABL A;  3M54 A;  2LT4 A;  5J26 A;  5GMK i;  1ZSZ A;  4DBQ A;  4JRI A;  3GOX A;  4AFS C;  4CC7 A;  3M55 A;  4IKF A;  1QCO A;  1UFF A;  4BB7 A;  2HQE A;  3OYC A;  5FU7 B;  5CVI A;  1WQ7 A;  3PMI A;  4OML A;  4PJO F;  3GOV A;  3HL8 A;  1OU8 A;  2EJ9 A;  4FT4 A;  4Z8A A;  2DE0 X;  1W6X A;  1VYU A;  1M9S A;  1K73 R;  3GNG A;  1VQ8 Q;  3OS5 A;  2FL7 A;  1WXB A;  1G3T A;  3M0S A;  4C5G A;  2LZ6 B;  2RA2 A;  1XTD A;  4X1V A;  1W4S A;  4EMH A;  2DMO A;  2FPE A;  2OTL A;  4JRK A;  4PZ5 A;  4J7F A;  3VS5 A;  3OYF A;  3I56 Q;  1TUC A;  4JJD A;  1X2K A;  3M58 A;  2JMC A;  2XI9 A;  4RTX A;  3QWY A;  5KYY A;  4L6V 5;  2QEX Q;  4LDX A;  5DM7 R;  1VIE A;  1FBR A;  1XNI A;  1WGS A;  5GAN 5;  5I11 A;  4XTW A;  1S72 T;  2CDT A;  2XIC A;  1YJW Q;  4AMC A;  1VQM A;  2FZG B;  3SEM A;  1VQ9 A;  2O01 E;  5J3B A;  1OZ3 A;  2AT1 B;  2KYM A;  3H0F A;  1PNJ A;  2C06 A;  1MUZ A;  3MJX A;  3JB9 G;  4MML A;  3CCM T;  3GF5 A;  1OZ2 A;  1JQQ A;  3ERB A;  4KBM B;  3QKJ A;  2CZ0 B;  1RAE B;  2FO0 A;  1LCK A;  2R5A A;  2AIR B;  4QW2 A;  3THK A;  3GNF B;  3OYB A;  1H04 P;  4A4F A;  4PLI A;  2DK3 A;  2EFI A;  2NUT B;  2E3I A;  4J83 A;  4QVD A;  5DLO A;  5HYP A;  3HRU A;  4FIB A;  1VQK A;  4M7D D;  4NL3 A;  1MGQ A;  1TWB A;  2DL4 A;  1YIJ Q;  4XAX B;  1Y0M A;  3NTI A;  4F7U G;  2JM8 A;  4EMK C;  4J9G A;  2ZPE B;  1K9M C;  3BY7 A;  3Q1J A;  4IUR A;  1RUW A;  1KQS S;  4J9D A;  4R56 A;  3ZD2 A;  2CS7 A;  2FVU A;  1YI2 Q;  2RK2 A;  4CI0 C;  3JSC A;  2KRS A;  1KC8 R;  4L5G A;  2QG9 B;  2RI3 A;  3UF4 A;  1WHM A;  2X3W D;  3VS4 A;  2PUO B;  2OTJ Q;  2W0Z A;  4RKU E;  1K0X A;  4IIM A;  3JCM Q;  1PSE A;  1E88 A;  2XRB A;  1LNX A;  2JUF A;  3L2Z A;  2JT4 A;  5KYX A;  3HSB A;  4XU2 A;  2VKN A;  1M90 R;  1HXD A;  1RAA B;  1MD8 A;  2HEQ A;  3PIP A;  2LCC A;  4QVZ A;  5KE3 A;  1YJ9 Q;  4WF2 A;  3MET A;  1KG1 A;  3V8K A;  2HKN A;  2CSI A;  5CKF A;  5KE2 A;  1VQ8 T;  1VQN Q;  2WSE E;  3JCM X;  2H8H A;  4ONT D;  2X9H A;  2EGA A;  2JTE A;  2MMP A;  4FYY B;  3H0H A;  5GAN 6;  4M4Z A;  1SHG A;  1G8X A;  3QPH A;  2K5F A;  2K3Y A;  3I56 T;  2XK0 A;  1NYF A;  3CME A;  3DLL A;  1ZSZ B;  4J9H A;  2UWN A;  2VWF A;  4Z89 A;  1KC8 U;  3VS6 A;  1EX4 A;  2O88 A;  3ZLE A;  2QEX T;  2RJC A;  3EAE A;  2YDL A;  1QKW A;  3MP1 A;  4AYI A;  3LX7 A;  2CSQ A;  1D0Z A;  1KD1 U;  2L3R A;  1RAF B;  3DLM A;  3CCL Q;  3CC2 A;  4LDW A;  3CD6 A;  3CPW S;  4F7U B;  2P0K A;  3RJ3 D;  3VYH B;  1MNE A;  5IHK A;  3EJH A;  2RHY A;  3ZBD A;  5D7U A;  5FWB A;  4ZN1 A;  4DEX A;  2DPP B;  5D6Y A;  1GBR A;  4EMK A;  1ZBX A;  3UAT A;  2DO3 A;  4JS5 A;  3NGP A;  3QZ5 B;  1KQ2 A;  4ZGJ B;  2QDY B;  1JRI A;  1OJW A;  1RAB B;  1WX6 A;  9ATC B;  3G1J A;  5GMK h;  3GPL A;  2EQM A;  4QQ6 A;  2O39 C;  4OMM A;  1WPY A;  4M7D E;  2VAS A;  2RD1 A;  2CP2 A;  3JRZ A;  1NJI C;  4M77 D;  1SG5 A;  2DD5 A;  3FDR A;  4M7A C;  2JN0 A;  3RMS A;  1YIJ T;  4C8Q D;  2D8J A;  3V8L A;  1UGQ B;  5GAO p;  5I21 A;  1N6A A;  3H0I A;  2E1H A;  2BZ8 A;  4E47 A;  3CXC S;  4B2R A;  1YWP A;  1YI2 T;  3QJ6 A;  3U23 A;  4ZTF A;  3MKD A;  1Q7Y C;  4B6M A;  3QG1 A;  5GAO r;  5GAN 8;  2KSS A;  4D8K A;  2OTJ T;  5I2S A;  3S3O A;  3L2U A;  2BIV A;  4YNX A;  3G6E Q;  4N4G A;  1N9R A;  1OK3 A;  2HMA A;  1QLY A;  1SPK A;  5CIU A;  4J38 B;  2AK5 A;  3M0U A;  1VQP Q;  2RLP A;  1K4U S;  2QA4 Q;  1M8V A;  1TSF A;  2OAW A;  3EG1 A;  2EHF A;  1FXX A;  5GAN 2;  3KFV A;  4LOT A;  2D9T A;  4RTT A;  2DYB A;  3CCE A;  1W70 A;  1G4F A;  2RI5 A;  5KH6 A;  2O2O A;  1VQN T;  2F5T X;  5GAN 7;  2X4Y A;  3M0Q A;  4YTL A;  1H2P P;  3VU3 C;  3AT1 B;  1U5M A;  1AT1 B;  2G7I A;  3FEO A;  1G3S A;  2HDA A;  5IN1 A;  4A63 B;  2XWB F;  1X01 A;  1AZE A;  1RLP C;  1VQ5 T;  5C0M A;  2OAU A;  3A8H B;  2DAQ A;  1ZSG A;  1K9M R;  2E3H A;  1GPZ A;  5KYN A;  3PFS A;  1VQ6 Q;  4C0G A;  3O5Z A;  1YCY A;  5LJ3 j;  2ZPF B;  4DOV A;  3CCL T;  5A0L A;  3SWN B;  4AFZ C;  4BD3 A;  2QXF A;  4M7A A;  2LRQ A;  2X4W A;  2H3J A;  3M57 A;  4KUI A;  2V1Q A;  2A7Y A;  1M1G A;  1IO6 A;  1TPN A;  2HQH A;  1GBQ A;  2B8A A;  5IH2 A;  3OSV A;  2A55 A;  2CGH A;  1B7T A;  4JJC A;  4FU6 A;  2SEM A;  1PSF A;  1QP3 A;  3IQL A;  1BCM A;  4C92 C;  1XQH A;  2CP7 A;  2L0A A;  3X24 B;  4M7D F;  4GY5 A;  2RQW A;  1UHC A;  1K9M U;  4M77 E;  3I55 A;  4KGZ B;  5GAO q;  1SS2 A;  4C8Q E;  2LDM A;  1QWE A;  2YUN A;  2OJ2 A;  4EMK B;  4FXG G;  3SW0 X;  4M75 D;  3F6K A;  3C95 A;  2CYZ B;  2HZY A;  2DXC A;  5GAO n;  4J6Y A;  4PJO A;  4F04 B;  4BDZ A;  3BE3 A;  1G3W A;  4NOY A;  3A8O B;  3X20 B;  3QSU A;  2W10 A;  3EG0 A;  4FM4 B;  3UA7 A;  1M1F A;  1QVF P;  2Y4X A;  2YT6 A;  4M78 E;  4ELZ C;  3G6E T;  3VYG A;  3HFO A;  1RL2 A;  4N0A C;  1VQP T;  3CCR Q;  1OPL A;  2P0Q A;  2QA4 T;  2MAM A;  3PE0 A;  1RLQ C;  3QJY A;  4E7J A;  1AWO A;  2YHT A;  3TSZ A;  4PJM A;  4FW1 A;  4C92 D;  6AT1 B;  2J06 A;  5GAM f;  3FGR A;  3EH2 A;  4N4I A;  1OU9 A;  1HFI A;  1JB0 E;  3VRZ A;  2G3R A;  1ZLM A;  1AOJ A;  2E6Z A;  1NJI R;  2DL3 A;  2RJD A;  1WHJ A;  1VQO Q;  3QII A;  1GHQ B;  1B3Q A;  1Y71 A;  4MZM A;  1SRL A;  2WSF E;  4IUP A;  2K3X A;  1GCQ C;  4LN2 A;  3CC4 A;  3NJA A;  4AG1 C;  2VC8 A;  4C92 A;  2DJQ A;  2YBY A;  2A36 A;  1SHF A;  1Q7Y R;  4OB0 B;  5IXB A;  5GAN d;  4PJO G;  5LJ3 h;  2K6D A;  2COY A;  4ESR A;  3SD4 A;  4LDV A;  1QMC A;  4Z88 A;  1UJ0 A;  4XQ3 A;  1QCF A;  3NTH A;  3CXC A;  2EQI A;  4RCB A;  2YWW A;  1U1S A;  8AT1 B;  2FPF A;  2QAS A;  2XKO C;  2LNH B;  1QP2 A;  4BDY A;  2LX7 A;  2ED0 A;  2K5I A;  1Y7X A;  4BY6 C;  1GKN A;  1YJN Q;  2JXB A;  4BUG A;  3OED C;  4BE0 A;  1VQ7 A;  4PFZ A;  4N0A A;  2FYK A;  3E2U A;  4M77 F;  2EYZ A;  4N7E A;  1WLP B;  2F2V A;  4AG2 C;  4AT1 B;  4FW2 A;  3VWO A;  3DB4 A;  4M75 E;  5CKH A;  4FT2 A;  1WDX A;  4CRI A;  3GP8 A;  4KH0 B;  2RM4 A;  4J6W A;  1S72 Q;  1Q7Y U;  3D7S B;  2EBP A;  1RLH A;  2VYT A;  3OW2 S;  2V8K A;  2BZX A;  2DVE A;  5FLX E;  2I2L A;  3WVD B;  1ZA1 B;  1X27 A;  4PL6 A;  4XK8 E;  1N8R C;  3KBG A;  1UDL A;  3KXV A;  3NMZ C;  4D6W A;  4E7Z A;  1G83 A;  5LJ5 f;  1ZUY A;  2M0O A;  2RHZ A;  3TSW A;  1WYX A;  2M16 A;  4A4G A;  1VQK Q;  2XQW C;  4YIZ A;  2JTM A;  5IHN A;  4L59 A;  3F70 A;  1Q82 U;  3UDC A;  2K4Y A;  1GCQ A;  1QKX A;  1OV3 A;  1NG2 A;  3LYI A;  4C92 E;  4PJO B;  2EQJ A;  4AYE A;  1Q3X A;  2NYS A;  3INB C;  1TUG B;  4M7A F;  2LJ0 A;  2JJ9 A;  4A54 A;  3MQL A;  1VQ8 A;  1Z92 B;  3JB9 D;  2D8H A;  2R58 A;  3QO3 A;  3JCM W;  4KRT A;  2RB6 A;  5KYU A;  4RG8 A;  1VQO T;  1UEB A;  3CCQ Q;  3M56 A;  4OMO A;  3ZFJ A;  2EGE A;  2O9S A;  2Y90 A;  3BW1 A;  1G4G A;  2C0T A;  3A8M B;  1SSH A;  4CC3 A;  1MND A;  4RTV A;  3IX0 A;  3OYJ A;  2QEX A;  3H6Z A;  2RLQ A;  2LQ8 A;  3A98 A;  3VS0 A;  1JJ2 S;  1OEB A;  5GAM h;  2XMF A;  1ZA2 B;  1X2Q A;  1Q86 C;  2EW3 A;  4HVW A;  1YJW A;  2X2Z A;  2NUZ A;  1OK2 A;  3ER0 A;  2YRC A;  4C16 A;  2YLB A;  1NZ9 A;  3HP9 A;  4B9W A;  3UWN A;  4PNO A;  3V7C A;  3EGX A;  2L2P A;  2K9G A;  2GCX A;  1BK2 A;  2CZ6 B;  2DBK A;  3TU4 K;  2CH4 A;  2C0O A;  1YJN T;  2X4X A;  5D6W A;  1B07 A;  1D3B B;  3O8V A;  3LGL A;  2CP3 A;  5GAM e;  4WTO B;  3CAL A;  5CKB A;  4M7D C;  2KI7 A;  4QVC A;  1I5O B;  2HD0 A;  4M75 F;  4ZNX A;  3CMA T;  2PUK B;  2D0Q B;  2GQV A;  3J7A F;  3SFM A;  3WVE B;  3MP8 A;  1QVG S;  2CZ7 B;  3PVL A;  3EGD A;  3ZL7 C;  3JCM f;  1YI2 A;  4GLM A;  1U3O A;  1K73 U;  1TU0 B;  4X9C A;  1JJ2 P;  3ZEH A;  2OTJ A;  2P4R A;  3QBY A;  3VUZ A;  1TH7 A;  4JHS A;  4JPB W;  1PD1 A;  2GTO A;  1FMK A;  1GL5 A;  5EG2 A;  2M1H A;  1JBM A;  2KBT A;  3CBO A;  4C92 F;  4KKD A;  4QT7 A;  1TXQ A;  3LGF A;  2CP5 A;  2PTK A;  3EHQ A;  3M0R A;  2DRK A;  3I9Q A;  4BE1 A;  1YJ9 A;  5LJ5 h;  3CC7 Q;  3J81 E;  2RO0 A;  2GQI A;  3RMQ A;  2RJF A;  1SSF A;  5FWC A;  2F1L A;  1VQN A;  1VVD A;  1T0J A;  3O8E B;  2CT3 A;  3CCQ T;  1OJV A;  1BBZ A;  3QDR B;  1M1K C;  2ECZ A;  4J7I A;  3OXU D;  4F17 A;  1N8R R;  1H03 P;  3OYD A;  2CKU A;  2YRV A;  4TVR A;  2XDP A;  1N9S A;  3MP6 A;  4JZ3 A;  3MEA A;  4M7D A;  1D1C A;  2RQT A;  3HRT A;  3RES A;  3OS1 A;  2E70 A;  5LJ5 e;  1Y96 B;  1K0S A;  2MWP A;  4F7U E;  5FRM A;  2RMO A;  4MDX A;  2GTJ A;  3MEU A;  5KYU B;  3RUX A;  2KT8 A;  4Y28 E;  1D1A A;  3RBB B;  1JXO A;  4J9C A;  2AKL A;  1UGR B;  1WI7 A;  2XDB A;  2WII C;  3OYG A;  2LJ3 A;  1ZUK A;  3X28 B;  1HK9 A;  4ZH1 D;  1ZQ1 A;  1T3S A;  2LQN A;  4IGD A;  3OYM A;  1NPP A;  4E7S A;  4O5V A;  1FYN A;  3RNJ A;  5CKD A;  5ECA A;  4EPC A;  4HVU A;  2CG6 A;  2DIQ A; 
#chains in the Genus database with same CATH homology
 4JJN K;  3PNW C;  3PFS A;  4M77 C;  1D3B A;  4C0G A;  3OYK A;  3V7S A;  3UT1 A;  4C8Q C;  1YCY A;  2R57 A;  3L2R A;  4B9X A;  1UGP B;  2EJG A;  2E41 A;  2ZPF B;  2PU9 B;  4J5Y A;  4JLI A;  2PVO B;  4DOV A;  5LJ3 j;  3CCL T;  5A0L A;  4MDW A;  3S6W A;  2ZCF B;  3SWN B;  4BD3 A;  2QXF A;  4MZP A;  3CC7 A;  3X26 B;  4M7A A;  4LD6 A;  2LRQ A;  1NE8 A;  1BI3 A;  3A5Z B;  4PJO E;  5CK9 A;  2DZC A;  2KK4 A;  2X4W A;  2JTF A;  2H3J A;  3M57 A;  5L8R E;  4F7U A;  1P92 A;  2RH2 A;  1YIT A;  2VXE A;  4KUI A;  1W2B A;  1M90 U;  1YIJ A;  2DTH A;  2A7Y A;  5KCH A;  4DQ2 A;  2E6N A;  4HCZ A;  5GAM g;  2BKD N;  2PQW A;  1H3Z A;  1M1G A;  1UB4 A;  3CCS A;  2XG8 D;  2HQX A;  3BDL A;  3CC4 T;  1Q81 U;  2E10 A;  4BI3 A;  2B8A A;  4NL2 A;  2PVG B;  4R55 A;  3MEV A;  3PGG A;  3AHU A;  4M78 C;  3G71 A;  3OSV A;  2HBP A;  2CGH A;  3HPW A;  2FB7 A;  2F5K A;  3G6E A;  3LH0 A;  4FU6 A;  3VJP A;  4ZN3 A;  1PSF A;  1QP3 A;  2VV5 A;  4EDU A;  4VUB A;  5LJ3 g;  4M7D G;  3FGT A;  4C92 C;  1XQH A;  3X24 B;  3P8B B;  3OQ5 A;  4LDY A;  3S3N A;  4GY5 A;  1VQP A;  4E7H A;  1K9M U;  1JJ2 A;  4M77 E;  4HA8 A;  4DOW A;  4BI8 B;  2IVW A;  3I55 A;  2QA4 A;  4OVA A;  3OY9 A;  5GAO q;  4E7I A;  2DXT A;  5DLQ E;  4EMG A;  4C8Q E;  3LWH A;  3OYN A;  2JVV A;  2LDM A;  3L2W A;  3OMG A;  5GAN j;  1VQL A;  4ATO A;  3RKY A;  3TRE A;  4EMK B;  2HNI A;  3FC3 A;  3CC7 T;  4M75 D;  1KC8 C;  4XTU A;  3VKI A;  3F6K A;  2IG0 A;  3C95 A;  3SWN C;  3MCA B;  2CYZ B;  3J80 E;  2EKO A;  1G5V A;  3JCM h;  1YIT T;  2DXC A;  2QQS A;  3JAM E;  2K57 A;  5GAO n;  5CQY A;  5GMK m;  4J6Y A;  4ELY C;  4OP0 A;  4PJO A;  4APL A;  3G4S A;  4Q5W A;  4C0D B;  4BDZ A;  4Z02 A;  4OF1 A;  1G3W A;  1I8F A;  2RK1 A;  4NOY A;  3PIO A;  3CCS T;  5GMK j;  2GFA A;  3A8O B;  3X20 B;  1M90 C;  2PVD B;  2X4J A;  5M9O A;  1X75 C;  3QSU A;  1U8R A;  1ZHI A;  4FM4 B;  1M1F A;  3OYI A;  1VQ7 T;  3CCR T;  5GAM d;  2Y4X A;  5DY9 A;  4M78 E;  4ELZ C;  3OMC A;  3G6E T;  3VYG A;  4RCC A;  3WXM B;  3RIR A;  2DEQ A;  3HFO A;  1RL2 A;  1QVP A;  4N0A C;  1QVF A;  1V29 B;  1H64 1;  4E7K A;  3L2V A;  1Q81 C;  5GAN g;  4HKE A;  2LTO A;  3S3M A;  1VQP T;  5GMK e;  4IUQ A;  2XU8 A;  3I55 T;  2LNV A;  2P0Q A;  5LJ5 j;  2QA4 T;  2MAM A;  2DXU A;  1VQ6 A;  1QW1 A;  1VQ5 A;  1WNL A;  1BKB A;  3QJY A;  4M78 D;  4E7J A;  2XD0 A;  2K5L A;  2DJZ A;  2YHT A;  1VQL T;  3URG A;  4C0F A;  3H8Z A;  4M77 A;  3JCM V;  4C0Z A;  3E19 A;  2Y8R A;  1YBY A;  3OBW A;  5LJ3 d;  3SB2 A;  4KT0 E;  4A4K A;  4C8Q A;  4C92 D;  4BE2 A;  4IUU A;  3CBM A;  4OB3 B;  1DJ7 B;  4C5E A;  3OYY A;  5GAM f;  1Y96 A;  3FGR A;  3LW5 E;  3N5B B;  3SDZ A;  3CCL A;  2Y8T A;  4N4I A;  3MO8 A;  3G4S T;  3QZ9 B;  5HKC A;  2GFU A;  3T9N A;  3CCJ A;  4LD9 K;  3NTK A;  4LDU A;  1JB0 E;  3OW2 A;  4IUT A;  2G3R A;  1B34 B;  3HFN A;  2E6Z A;  4MZT A;  3RER A;  4HT9 A;  2ZPH B;  2RJD A;  3OSS C;  4JS4 A;  3LLR A;  1LOJ A;  1KHI A;  2A3L A;  1KHC A;  2ZPB B;  2EIF A;  3QII A;  4RG2 A;  5LJ3 f;  1VQ4 A;  3A8G B;  4XU1 A;  1Y71 A;  1BIB A;  4BY6 B;  5LJ5 g;  1G3Y A;  1WJQ A;  4MZM A;  4UC4 A;  3PTA A;  2RHX A;  4M7D B;  3QHS A;  2WSF E;  2DTO A;  2ZZD A;  2K3X A;  3HRS A;  1BI2 A;  4IUP A;  3M4Y A;  1M5Q 1;  4M78 A;  3X25 B;  1VQK T;  3CC4 A;  2DIG A;  3NJA A;  3M54 A;  2LT4 A;  5J26 A;  5GMK i;  1N27 A;  2VC8 A;  4C92 A;  2CZ1 B;  2EQK A;  4XTY A;  4JRI A;  3GOX A;  4M75 C;  2QI2 A;  3M55 A;  1N8R U;  4OB0 B;  4IUV A;  2RHU A;  4IKF A;  5GAN d;  4BB7 A;  2HQE A;  4PJO G;  3OYC A;  5FU7 B;  5CVI A;  2WSC E;  1WQ7 A;  5LJ3 h;  3PMI A;  4PJO F;  3HL8 A;  2EJ9 A;  2NLU A;  2JZ2 A;  2E12 A;  4FT4 A;  4LDV A;  3SD4 A;  3SWN A;  4Y91 A;  3CCJ T;  2VGM A;  1M9S A;  4XQ3 A;  1NPR A;  3GNG A;  2KDS A;  2FL7 A;  3FLG A;  3NTH A;  3OS5 A;  4RCB A;  3CXC A;  4JRQ A;  1U1S A;  4J8O A;  1G3T A;  4C5G A;  2X35 A;  2RA2 A;  1XTD A;  1W4S A;  2DIQ A;  2XKO C;  4EMH A;  3C4S A;  3L2Q A;  4BDY A;  1QP2 A;  1VQ4 T;  2DXB A;  4JRK A;  2OTL A;  1K8A C;  4J7F A;  3OYF A;  2K5I A;  1KQS A;  5GAN f;  1Y7X A;  4BY6 C;  5FU6 C;  3M58 A;  4E7L A;  2EJF A;  2XI9 A;  4C5I A;  4BUG A;  3RKX A;  4L6V 5;  4LDX A;  1YJW T;  5DM7 R;  1VIE A;  3L42 A;  3OBY A;  4BE0 A;  3VUB A;  1XNI A;  4M77 G;  1WGS A;  5GAN 5;  4A4E A;  5KCO A;  1VQ7 A;  3CCR A;  4N0A A;  2FYK A;  4M77 F;  4XTW A;  1OYX A;  3OYL A;  1S72 T;  4C8Q G;  5LJ5 d;  2DTI A;  4N7E A;  3JB9 I;  1AHJ B;  3JB9 J;  1WQW A;  2XIC A;  5CCA A;  3DB4 A;  4M75 E;  5CKH A;  3FB9 A;  4FL6 A;  4FT2 A;  4CRI A;  3GP8 A;  1VQM A;  3E1S A;  2L89 A;  2MF2 A;  2RM4 A;  4J6W A;  4ZGD B;  1VQ9 A;  2O01 E;  5GAN h;  5J3B A;  1OZ3 A;  2E65 A;  1Q7Y U;  1IRE B;  1XOV A;  1WJR A;  2VYT A;  3OW2 S;  2V8K A;  4KUL A;  4XU3 A;  1M1K U;  2DVE A;  5FLX E;  4BWC A;  2I2L A;  2DZ9 A;  3WVD B;  3ZLD A;  4PL6 A;  4XK8 E;  5HK0 A;  4RMO A;  1N8R C;  2C06 A;  3JB9 G;  4MML A;  3KBG A;  3CCM T;  3GF5 A;  5D6X A;  1OZ2 A;  3JB9 F;  4D6W A;  2DKG A;  1WJS A;  4OB2 B;  4KBM B;  4II1 A;  1Y07 A;  2JOY A;  5LJ5 f;  3R6O A;  3QKJ A;  2O4X A;  2M0O A;  2OTL T;  2RHZ A;  4HCB A;  2CZ0 B;  5J39 A;  2M16 A;  4PKC C;  2QQB A;  1VQO A;  4A4G A;  5C6S A;  3M4G A;  4YIZ A;  2JTM A;  2R5A A;  3TU4 K;  1Q86 U;  1VIF A;  4QW2 A;  2QQA A;  3OYH A;  3GNF B;  3OYB A;  4L59 A;  4OGC A;  4A4F A;  3QUI A;  4PLI A;  3F70 A;  2DK3 A;  2EFI A;  2K4Y A;  3UDC A;  1Q82 U;  3CC2 T;  3CD6 T;  3FRN A;  2RHI A;  4J83 A;  4QVD A;  5DLO A;  3OS0 A;  3HRU A;  4FIB A;  2D6F A;  3LYI A;  1VQM T;  1VQK A;  4C92 E;  4M7D D;  4PJO B;  4NL3 A;  4FSX A;  1VQ9 T;  2EQJ A;  1MGQ A;  4M75 A;  1I5L A;  4XTV A;  4M7A G;  4XAX B;  5FRO A;  4J6X A;  2L8D A;  4M7A F;  3NTI A;  3RKW A;  1W2B S;  5LL6 S;  4A54 A;  4F7U G;  3C94 A;  3TEE A;  4EMK C;  2JNG A;  2XHC A;  4F7U F;  3JCM e;  4P5N A;  2ZPE B;  3CPW A;  3P8H A;  1K9M C;  1MHN A;  3BY7 A;  4OB1 B;  4JUV A;  1VQ8 A;  2QQR A;  3JB9 D;  3Q1J A;  4IUR A;  2CKK A;  1BIA A;  1KQS S;  3QYG B;  2R58 A;  5CKE A;  4R56 A;  3QO3 A;  2LT1 A;  2CS7 A;  2FVU A;  2LQK A;  3TCJ A;  3JCM W;  2RK2 A;  2RB6 A;  4C0D C;  1B34 A;  3JCM J;  4RG8 A;  4CI0 C;  1VQO T;  3JSC A;  1UEB A;  1QVG A;  1U1T A;  3M56 A;  4L5G A;  3ZFJ A;  2BUD A;  2RI3 A;  2DD4 A;  2Y90 A;  3BW1 A;  2PUO B;  4PLL A;  4RKU E;  3A8M B;  4M77 B;  3JCM g;  1YJN A;  3JCM Q;  1PSE A;  3UPU A;  3OYJ A;  2QEX A;  3H6Z A;  1LNX A;  3V8J A;  2LQ8 A;  2JUF A;  1X6O A;  1KQ1 A;  2LC4 A;  3V7R A;  1JJ2 S;  3EFR A;  3L2Z A;  5GAM h;  5A0D A;  1YJ9 T;  3M53 A;  5GAN 3;  3HSB A;  4M7D F;  4XU2 A;  4X34 A;  1Q86 C;  1YJW A;  2EYQ A;  4PJO C;  4V2S A;  1HXD A;  2X2Z A;  3PIP A;  2LCC A;  3ER0 A;  4QVZ A;  3WSX A;  5HY6 A;  2YLB A;  5KE3 A;  1Q82 C;  1NZ9 A;  5CAI A;  5GAO l;  1S72 A;  3EFS A;  3HP9 A;  4M7A D;  4WF2 A;  4A4H A;  3MET A;  4B9W A;  4BAC A;  2EAY A;  2LCL A;  3UWN A;  3VV0 A;  3V8K A;  2V8I A;  1EIF A;  4PNO A;  5CKF A;  3V7C A;  5KE2 A;  1VQ8 T;  1KG1 A;  3JCM c;  1FWZ A;  2WSE E;  3JCM X;  2AHJ B;  2V8J A;  2MMP A;  5GAN 4;  5GAN 6;  4BI4 A;  3BDU A;  2GCX A;  3KXT A;  3QPH A;  2CZ6 B;  2HAX A;  2K5F A;  2K3Y A;  3DKM A;  2R5M A;  2XK0 A;  5CR2 A;  5CQX A;  3NFC A;  3JCM b;  3I56 T;  3OA6 A;  3CME A;  3DLL A;  3WSY A;  3CCM A;  2KMT A;  3CCV A;  1YJN T;  1VUB A;  2X4X A;  3CCU A;  1KC8 U;  1QVF S;  3ZLE A;  2QEX T;  4HCC A;  1NJI U;  2RJC A;  3EAE A;  5D6W A;  1D3B B;  3O8V A;  3LGL A;  5GAM e;  5I2M A;  5CKB A;  3MP1 A;  4XTX A;  4QVC A;  2KQW A;  3LX7 A;  2ZGW A;  2HD0 A;  2LVM A;  4M75 G;  4M7D C;  3KUF A;  3CCE T;  4M75 F;  3JCM d;  1KD1 U;  2L3R A;  4M7A B;  3DLM A;  3M5A A;  4OMF B;  4QQD A;  2LX9 A;  4LDW A;  3CC2 A;  3CMA T;  3CPW S;  3CD6 A;  4C8Q F;  4F7U B;  2PUK B;  2L5Q A;  2MI6 A;  2P0K A;  1GXI E;  3VYH B;  2RJE A;  1BI1 A;  4O6J A;  5LJ3 e;  5IAY A;  2D0Q B;  2GQV A;  3GLX A;  3J7A F;  2RHY A;  4JDS A;  2RI2 A;  3CBP A;  1O75 A;  3ZBD A;  4MMK A;  3SFM A;  5FU7 C;  3JB9 H;  4PJO D;  4ZN1 A;  3WVE B;  3MP8 A;  2DPP B;  5D6Y A;  1QVG S;  4EMK A;  1ZBX A;  2QTX A;  1RI0 A;  4ZGE B;  2CZ7 B;  2DO3 A;  4JS5 A;  2ZPG B;  3QZ5 B;  1IZ6 A;  1YHQ A;  3JCM f;  3CEY A;  5AYF A;  1YI2 A;  3CME T;  4ZTJ A;  1KQ2 A;  4ZGJ B;  1K73 U;  3CCQ A;  3CCV T;  2QDY B;  2KY9 A;  3CCU T;  4X9C A;  4GLK A;  1JRI A;  3ZEH A;  3JCM P;  4XU0 A;  5IT9 E;  2OTJ A;  2FHD A;  5GMK h;  4MSL A;  4M78 G;  1LJO A;  3GPL A;  3FJP A;  3M9Q A;  3DB3 A;  2EQM A;  3QBY A;  4M78 F;  4QQ6 A;  3MEW A;  3VUZ A;  1TH7 A;  2VUB A;  1WPY A;  4M7D E;  4C92 G;  2RD1 A;  5EG2 A;  2M1H A;  3BFM A;  3FIF A;  3JRZ A;  1JBM A;  3CBO A;  2YLC A;  4C92 F;  2XDD A;  1NJI C;  1OI1 A;  3LWI A;  4M77 D;  2DD5 A;  3FDR A;  3QYH B;  4M7A C;  2JN0 A;  3MHX A;  1R8O B;  2P0P A;  2XID A;  3LGF A;  4XTZ A;  3RMS A;  3V8L A;  4C8Q D;  3C12 A;  3OYA A;  1YIJ T;  4BE1 A;  1YJ9 A;  5LJ5 h;  3E9F A;  4KUD K;  1UGQ B;  3J81 E;  2RO0 A;  5I21 A;  5GAO p;  1N6A A;  2O4X B;  3RMQ A;  5GAN e;  1KD1 C;  1UGS B;  2RJF A;  1BYM A;  1SSF A;  2E1H A;  4DA4 A;  4E47 A;  3CXC S;  4C5H A;  1VQN A;  5FRN A;  1FX7 A;  3G71 T;  3HHT B;  1YHQ T;  1YI2 T;  2QQ9 A;  3QJ6 A;  2EQU A;  3CCQ T;  4ZTF A;  1Q7Y C;  5CO7 A;  5GAO r;  3QG1 A;  4JLG A;  5GAN 8;  2KSS A;  3QDR B;  1M1K C;  2OTJ T;  5I2S A;  2Y4Y A;  3S3O A;  4J7I A;  5GMK l;  5GAO m;  2BIV A;  3L2U A;  2K2V A;  3L1A A;  3PMT A;  4N4G A;  1N9R A;  2P4T A;  5HK3 A;  3QXE B;  4JRP A;  3I56 A;  4HT8 A;  4M75 B;  3E9G A;  5A0G A;  3OYD A;  1K73 C;  2VXF A;  2YRV A;  5CIU A;  3OYE A;  4TVR A;  2XDP A;  4A53 A;  2KAF A;  1N9S A;  3MP6 A;  3MEA A;  4C8Q B;  1M8V A;  1I81 A;  4M7D A;  4NS5 A;  3HRT A;  3RES A;  3OS1 A;  2MWO A;  2E70 A;  2ZPI B;  1FXX A;  5LJ5 e;  5GAN 2;  4M7A E;  1Y96 B;  1O9S A;  2WAC A;  2D9T A;  2MWP A;  4ME7 A;  3GIB A;  4F7U E;  2Y8S A;  3INZ A;  3CCE A;  1K8A U;  5FRM A;  4MDX A;  3MEU A;  4PO7 A;  2RI5 A;  2E5Q A;  4QQG A;  3RUX A;  3A8L B;  5KH6 A;  3CMA A;  4Y28 E;  1VQN T;  3M59 A;  3HKS A;  2F5T X;  2KVQ G;  3P8D A;  3OS2 A;  1UGR B;  5GAN 7;  2F69 A;  2XDB A;  3OYG A;  3CPF A;  3PT9 A;  2X4Y A;  1BI0 A;  4YTL A;  3VU3 C;  3ASK A;  3G7Z A;  5FU6 B;  2E64 A;  3X28 B;  3FEO A;  1HK9 A;  1G3S A;  1I4K 1;  3ME9 A;  3OB9 A;  4X9D A;  5IN1 A;  2VGN A;  1M4Z A;  1X01 A;  5GAM j;  5A2Q E;  1ZQ1 A;  4M78 B;  3OYM A;  1VQ6 T;  2EWN A;  1VQ5 T;  1NPP A;  4N4H A;  4O5V A;  5C0M A;  2OAU A;  3A8H B;  5CKD A;  2DAQ A;  4EPC A;  4C92 B;  2M9U A;  4OGE A;  2GF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...