2I2LA

X-ray crystal structure of protein yopx from bacillus subtilis. northeast structural genomics consortium target sr411.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
134
structure length
130
Chain Sequence
MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKYDVTAVGWVEYATIEVIGDVYQNPELLEGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YopX protein
publication title Crystal structure of the hypothetical protein yopX from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 13
structure length 130
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.50 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2i2lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2i2lA02
4M7AB 1Y96B 5LJ3d 4C92E 3JCMQ 3FIFA 3FJPA 3BDUA 4M75G 3V7RA 4XTWA 4JUVA 4M77G 3JCMd 5LJ5f 3JB9I 5GMKi 4M7DF 4C8QB 4HT8A 1N9RA 4M75C 3SWNC 4F7UE 3JCMW 2FB7A 5GAN3 4C92G 2QTXA 3FB9A 4M77C 4M75A 3SWNA 5GANh 5GAN8 1I4K1 3JCMc 4M77A 5LJ5g 2YHTA 4JLIA 3HFOA 5GAMd 1HK9A 2YLBA 4C92C 4QVDA 2ZGWA 4PJOD 4PNOA 4RCBA 2RM4A 4C92A 4EMGA 4F7UG 5GAOn 2CGHA 1BIAA 4JRIA 2DTOA 4Y91A 5GANe 4C92B 1X01A 3V8JA 3JB9J 2K57A 2DTIA 4J5YA 3BW1A 4M78F 4V2SA 3RKWA 4XTVA 1WQWA 2EJGA 4F7UA 5GMKh 4PJOF 4M7DD 2DKGA 2DZ9A 3L2ZA 5LJ3f 4XU2A 1B34A 3VU3C 4M7AF 3AHUA 1H641 2VXEA 1YCYA 5LJ5e 5LJ5h 4N0AC 3HFNA 5GMKe 3RUXA 3JCMJ 4N0AA 5LJ3g 2DXTA 2VXFA 5GANd 4C8QF 4XU3A 4M7DE 3V7SA 2VC8A 3M4GA 3JCMg 2FYKA 1M8VA 5I21A 1JBMA 1I81A 2E65A 1HXDA 4J6XA 4M75B 3SB2A 4M78D 3SWNB 5GAMf 4J6YA 1N9SA 5GAOq 2RD1A 2E64A 4M77B 4M7DG 1U1TA 5DY9A 5GAOp 1WQ7A 4HA8A 1WNLA 5GAMg 3GIBA 4M7AD 1LNXA 3JB9F 4M7DC 4A54A 3QSUA 3HSBA 4J6WA 3INZA 1JRIA 5GAMj 2DEQA 4M78E 4A53A 3JCMb 5LJ3h 2EAYA 3RKYA 4M7DA 4PJOE 3RKXA 4C8QD 4F7UB 5LJ5d 4XQ3A 2YLCA 3BFMA 4XTXA 3RESA 1WPYA 2RB6A 3EFRA 1B34B 3JCMf 3RIRA 4M75D 4NOYA 1TH7A 3QUIA 4OP0A 5LJ3e 4PJOG 5GANj 2E41A 2DJZA 1M5Q1 2HNIA 3RERA 4C8QE 4M78C 4X9CA 1D3BA 1MGQA 4M78A 4C92D 5GAOm 5GANg 3JB9D 4PJOC 1I8FA 4M75F 3JCMX 4PJOA 5GAOl 2E10A 2DXUA 3BY7A 5GMKl 5CAIA 5GAN4 4M7AC 4M77F 1KQ2A 2RA2A 3V7CA 4XU0A 4C8QG 4NL2A 2JN0A 4NL3A 4PJOB 1Y96A 4JRKA 5GMKj 3V8LA 5GAN6 4C92F 3QO3A 3JB9H 2Y90A 2EJFA 2EJ9A 2DTHA 4C8QC 4DQ2A 4MMLA 4C8QA 2I2LA 3JCMP 5LJ5j 5GAOr 4M7DB 4XTZA 4F7UF 2E1HA 4XTYA 3JCMh 1LOJA 1LJOA 4M7AE 4WF2A 3JB9G 3PGGA 4M78G 3L1AA 5GANf 1KQ1A 3JCMV 4M77D 5GAN2 1U1SA 4EMHA 2EWNA 5GAMh 3JCMe 5GAN5 4M7AG 4XU1A 4EMKC 5GMKm 4HT9A 2DVEA 5GAN7 4EMKA 4MMKA 1D3BB 4M78B 4QVCA 4M75E 1BIBA 4M77E 4RCCA 3QHSA 3EFSA 4EMKB 1I5LA 4X9DA 2DZCA 4XTUA 5GAMe 4M7AA 5LJ3j 3V8KA
chains in the Genus database with same CATH superfamily
4M7AB 2MK5A 2PNIA 2O31A 1M3CA 4C8QB 1TG0A 3LX7A 3OW2S 1PCXA 5FU7B 2W80A 2YLBA 2PTKA 1WHMA 2DK3A 4DBFA 1TOVA 2K4YA 2QI2A 1WXBA 5GMKh 4A4GA 1MUZA 2LNVA 2K3YA 1X6BA 4FW2A 1AHJB 2KYMA 2JTMA 1N6AA 1OX9A 2EGAA 1VQ8A 4TVRA 3H0IA 4ONTD 4WCIA 4PK4A 4KT0E 1VQ5A 3MEUA 3E2UA 4LUDA 1Q7YR 3C4SA 1PM3A 4XK8E 1G83A 1N9SA 4KH1B 3CCSA 3UDCA 2CDTA 1KQSS 1U1TA 1VQOQ 4X34A 4FYXB 1SG5A 3CMEQ 1BCMA 3O8VA 4M7DA 2XWBF 1ZA1B 2EQKA 1S72Q 2OTLT 2RLPA 4E7JA 1ZUUA 2R5AA 2HAXA 1G3TA 2HDAA 2RJDA 2RF0A 1QVFA 3QKJA 4OGEA 4BE2A 3OA6A 2DL5A 3E1SA 3JCMX 2K9GA 3UPUA 4HCCA 4AT1B 4ATOA 3V7CA 4C8QG 3JAME 2FZKB 4QQGA 2EJFA 4Q5WA 3LH5A 2O2OA 4L6V5 4DEYA 5GAOr 2KXCA 3QWXX 4LUEA 1LOJA 5CCAA 1FMVA 1WJRA 4OMFB 1LCKA 4J7IA 1D1BA 2XKOC 1TS9A 2DRKA 2F5KA 1OPKA 3DB3A 3GOVA 1RAEB 4MZTA 1PG5B 2QQRA 1JXOA 1E6HA 2P4RA 3EFSA 3GF5A 2CZ6B 1BKBA 5IXBA 3PTAA 3CC2A 1VYUA 3OMGA 3DB4A 3H6ZA 4AYEA 3THKA 1JJ2S 1W70A 1SSFA 1OEBA 2A36A 2GFAA 5IXFA 2CH4A 1NYGA 3MPUB 4BI4A 4D8KA 1UGQB 5KYWB 2EQUA 2DTOA 5FW9A 1X01A 2MCZA 3O8EB 1I1JA 3C95A 5GJWB 4ZGJB 3RKWA 3CCVA 3SW0X 2JNGA 3QWYA 4L5GA 2JM9A 2KR3A 3H41A 1Y71A 3BDLA 3UWNA 1FX7A 3EG3A 4F4OC 2ROTA 3CCQA 4GLMA 1SS2A 1YJNA 1M1KC 3V7SA 2W0ZA 1X6GA 3QDFA 3MP1A 3JCMg 1R8OB 1M8VA 5EC7A 3TVTA 4OVAA 3CD6A 1YP5A 4ESRA 5GAOq 1W2BA 1Q82R 2DRMA 4OMMA 5DY9A 5GAOp 4DBRA 1RI9A 3P8HA 3TVJA 1R0BG 2DL3A 2MAMA 2M51A 4FYYB 4K11A 5LJ5d 4IUPA 3BFMA 1U8RA 3VS5A 1Q7YC 3P8BB 5LJ3e 2D9TA 2DNUA 5I0QB 3HKSA 2KE9A 1MGQA 1K0XA 4PJOA 5GMKl 1YJ9T 1KQ2A 1G4FA 1K76A 2A37A 1WHGA 4LNPA 5GAN6 1U5SA 2D0QB 2G7IA 3OYGA 4AG1C 2XK0A 2BKDN 5LJ5j 1UDLA 4M7DB 2E1HA 4F04B 1AZEA 5JPMG 2A0FB 4CRIA 4AFQC 3GBQA 3GNGA 1SEMA 5KCOA 1VQ6A 5KYYB 2O4XB 4OGCA 1FMWA 5IT9E 1P92A 4RKUE 2K2VA 1O9SA 3SEMA 4X9DA 1WXUA 1UOTP 3L89M 2JGWA 2DPPB 2K3BA 2HSEB 4OF1A 3BDUA 1OQKA 2QGFB 2CKKA 2CSQA 4BY6B 3JCMW 3CC7A 1UUEA 1QGBA 2EGCA 5GAMd 2A3LA 3EJHA 4LN2A 2R57A 4C92A 3VS1A 2ZAEA 5I22A 2RK1A 1VQLA 5FLXE 4JHSA 1B34A 1K9MR 1NPPA 1R0CB 4ZGDB 1VQ8Q 1RADB 3Q1JA 2DEUA 1CKLA 4PJLA 4R0KA 3VJPA 5LJ3g 4KRTA 1VQ5Q 5HZPB 1ZBXA 5CKFA 1VQPT 4EDUA 5GAMj 2RLQA 1TUGB 4O6JA 4J6YA 4AFSC 3CCSQ 2P0PA 5KYXA 4PJMA 1SHGA 4M7DG 1PSEA 2OTJA 1WQ7A 3OW2P 4RTWA 3OP8A 2E4HA 3QSUA 1Q81C 2QA4A 5LJ3h 4IIOA 4B6MA 2RHIA 1T0HA 2RQVA 2VGNA 3CCUA 3URGA 2PQWA 3ASKA 1VVCA 1PKTA 2O01E 3M0QA 1WJQA 1D09B 2MYSA 2JMAA 5D7UA 1MNDA 1X6OA 2KEAA 3OY9A 2KVQG 1TUCA 2QEXT 2JT4A 4E7ZA 1G3YA 3JB9H 1YN8A 1KQSP 1OYXA 2M0YA 2DETA 2AZSA 3U23A 3A8LB 1AWJA 5GAN2 1UEBA 2KMTA 1PD1A 2M16A 1VQ7A 1W4SA 2DO3A 3L2UA 4O5VA 1YBYA 1YJWT 2CSIA 4EMKB 2RL0A 1KD1R 2JZ2A 2DZCA 1GPZA 3CC2Q 4ORZA 3OYMA 1IGUA 3ZBDA 1YHQA 4B2RA 1GHQB 4CC2A 4JS4A 2RK2A 3JB9I 2LQNA 2DLPA 1ABOA 4YIZA 3SWNC 1W6XA 2QTXA 2H3EB 2M9UA 3QYGB 4HXJA 4M75A 3WSYA 2JXBA 1BU1A 2LQ8A 5GANe 2QDLA 3A8GB 3OSSC 2RHYA 2GTJA 1E7OA 3MKDA 3NGPA 3NHNA 1KFZA 2DZ9A 3L2ZA 2QG9B 1K73C 3OEDC 2WSCE 1KSWA 3CCQQ 1X27A 5J3BA 1MMGA 1G3WA 3NTHA 3FGRA 1JJ2P 3ERBA 4HKEA 3J80E 4LDXA 2YXYA 1XOVA 3CBMA 1Y57A 3M0TA 2ZPFB 1ZBJA 5CQYA 4C0DC 2PU9B 3VRYA 3CC4A 3EFOB 2NUPA 1E5GA 4RTTA 3CXCA 2KYBA 4XTXA 2AKLA 4IGDA 1MHNA 2HBWA 1B34B 3N5BB 2LP5A 2CS7A 4PJOG 4C8QE 1IB8A 2O9SA 1M90U 4WTOB 3CMAT 4X1VA 2KRIA 4M7AC 2LNHB 5KYXB 4RTXA 4C5EA 2DTHA 2EBPA 4BB7A 4C8QC 2CP5A 1YIJA 2JTFA 5FU7C 3JB9G 2COZA 1WFWA 1D0ZA 2K7AA 1WYXA 1VQ6Q 2K5LA 5CKHA 1SRZA 2KAFA 1NBEB 3I9QA 4MZPA 4M7AA 4XAXB 2GQIA 3R6OA 4J9DA 2DA9A 2MI6A 5J39A 2XWJI 1YITA 1Y7XA 4NS5A 4C92G 3FB9A 5GANh 4FIBA 4FT4A 3CC7Q 2FRWA 2VWFA 3TEEA 4KGZB 3PNWC 2ZGWA 2WSFE 2ZPHB 1BIAA 3JB9J 2LCLA 5KYNA 1PSFA 1VQLQ 2X3WD 4J7FA 2QXFA 1GL5A 5LJ3f 2CG7A 2HQHA 2X4WA 2NWMA 4PFOA 1Q3XA 3X20B 4MUCA 4KGVB 3PFSA 2RJEA 4J6XA 4MZMA 4M75B 2ZPIB 4PO7A 1XQHA 4OB2B 3OBYA 1H04P 5A2QE 2OTJQ 3VKIA 1GRIA 3NFCA 4A54A 2EYZA 2KT1A 2HCKA 2QA4Q 4APLA 2GNCA 2WSEE 3CCUQ 1GBRA 3GP8A 4LOSA 2RB6A 1PD0A 4R56A 2F2WA 4RG8A 3L2WA 1QWFA 2JRAA 3IQLA 1B7TA 4IIMA 5IHKA 4CC7A 2OTLA 1RACB 3LWHA 1B3QA 1TSFA 3BE3A 4AMCA 2RNAA 1Y96A 1UHFA 4AG2C 2DYBA 5GMKj 3T5OA 2D0NA 2MMPA 3ZD1A 2HEQA 3QO3A 1OJWA 3VS3A 5I2SA 2AKKA 3CQTA 2VASA 2YRAA 2H3JA 2CZ7B 2NUPB 1LJOA 1UE9A 3GPLA 3TQ7P 3WVDB 3F70A 3OYHA 4E7KA 2L0AA 2YDLA 1ZJKA 2KSSA 1D0YA 1RL2A 3WSXA 3MQLA 2QY0A 2EYWA 3REAB 4HT9A 1VQMQ 1RABB 2ROLA 3EAEA 3L2VA 3C94A 4XTUA 3GOXA 1FBRA 2NLUA 1YWPA 1UJ0A 3FIFA 4M75G 4DA4A 4IUTA 2K3XA 1YHQQ 2JOYA 1H3ZA 4F17A 1VQOT 1OPLA 2BE9B 3UF4A 4HT8A 1M9SA 5EG2A 2L3QA 1FWZA 2YUNA 4RTZA 2YHTA 4Z89A 4PJOD 1AVZC 1BK2A 2YT6A 2CGHA 4KBMB 5FU6B 1SRMA 5ECAA 4PZ5A 3EG2A 2EW3A 2Y8RA 1J3TA 1UHCA 1GBQA 3I56Q 2DXTA 1E88A 1M90C 4M7DE 4KULA 2XICA 4LDUA 5DN5A 4FL6A 1M1KR 2RD1A 4AYDA 2XQWC 2CP0A 3CCLT 2DL7A 2E3IA 4M7DC 3HSBA 1JRIA 3TSWA 5HYTB 3CC4Q 2YUQA 8AT1B 2LQWA 1W2BS 4R55A 3RERA 4EIKA 1H2PP 3E19A 1NPRA 4N7EA 4C92D 4CC4B 2KI7A 3CPWP 2DXUA 2X9HA 3OS0A 3VS0A 4JRKA 2X4JA 1Z9QA 4BY6C 2X51A 4LDWA 1KG1A 5HYPA 2JMCA 4E2FB 1YIJQ 1RLHA 1YJ9A 5AYFA 2BIVA 3A98A 3PGGA 4PL6A 4VUBA 5GANf 2KNBB 5KYYA 2O4XA 2C0IA 3JCMe 5GAN5 2Y8SA 4M7AG 1EX4A 3ZRZA 3LH0A 2X4XA 3EHQA 1QP3A 3J81E 2SEMA 3EH2A 4BWCA 1UB4A 1TXQA 2QASA 4OMPA 1EIFA 2XU8A 1Y96B 3JCMQ 1TWBA 2KY9A 4FCYA 2AT1B 1Q81U 1YITQ 2CT4A 3ZLEA 4C5HA 2QGGA 2CP7A 3ZFJA 1RLPC 1OULA 2HSPA 2QQSA 4PFPA 4QVDA 2COWA 5CR2A 2E6ZA 3LGFA 3T9NA 1RLQC 5HKCA 2J6KA 3M54A 4RTYA 1JQQA 4B2SA 3LYIA 1NJIU 1V76A 1SPKA 3NTKA 1WIEA 5CO7A 1QCNA 3JCMJ 3MP8A 2AIRB 2IVWA 4JZ4A 2ZZDA 1HXDA 3VRZA 5HY6A 2ENMA 3H0HA 1VQNT 3NTIA 6AT1B 4JDSA 4QT7A 4J6WA 3INZA 2OI3A 2EYYA 3PIPA 4A53A 2EKHA 1VQPA 4PJOE 4ZN1A 2RJCA 3MJXA 4DBQA 1Q81R 3RESA 1WPYA 3AT1B 1UGRB 4M75D 2BZ8A 2DXBA 3QXEB 2E41A 4JJNK 3OS2A 4BI3A 5CIUA 5FWBA 1D3BA 4M78A 4PJOC 2OTLQ 2RQWA 1MD8A 2YSQA 3OW2A 3JV3A 2BZMA 2RA2A 3CCJT 4A4EA 1N27A 1UJYA 2LCSA 1NJIR 1WHLA 2ZCFB 2DMOA 2KBTA 2RI3A 2NUZA 3JCMh 3QZ9B 2DBKA 2YRVA 2QEXA 2R58A 3ZL7C 1K73U 3OYBA 3S6WA 4OB3B 2DF6A 3I55T 1YI2T 1ZA2B 1T0JA 2GFUA 4Y28E 4ELYC 4IUUA 5GMKm 2L89A 4HCKA 3UT1A 3PVLA 4EMKA 2MOXA 4BD3A 8ATCB 3CALA 3VV0A 3QPHA 1F1BB 3M53A 1KQSA 1D1CA 5CKDA 2VYTA 4AFUC 5HK0A 5LJ3j 3V8KA 4C92E 2C0TA 2XD0A 2BZYA 3PE0A 2V8JA 2DD5A 2RN8A 2EIFA 3G7ZA 3QJYA 2K5IA 4DOVA 2FB7A 4FU6A 2AZVA 1MMNA 3FC3A 5KCHA 4M77A 1QVFP 4C92C 1OK3A 2CP6A 2XDPA 1TPNA 3BW1A 4F7UA 1OOTA 1QVPA 2H8HA 1S1NA 4FSXA 3CEYA 4M7AF 3AHUA 1Q86U 2EC3A 2VXEA 2M02A 3UA6A 1NLOC 2ED0A 1JB0E 2FZGB 3RMQA 4PLIA 4C8QF 4C5GA 1K73R 4D8DA 3M4GA 3LGLA 1ARKA 1ELVA 1I81A 2QQAA 4Z88A 1K0SA 2EQJA 3A8OB 1WNLA 2HKNA 4M7AD 2YBYA 1PWTA 3EFOA 4HVVA 2PVOB 2HMAA 3A8MB 4C8QD 1HFHA 5CKEA 2ERJA 2IZ4A 3OB9A 2DJZA 1M5Q1 5FRMA 4J9EA 1JJ2A 2DXCA 2L2PA 1SF9A 1I8FA 1WZOA 3X26B 1H3HA 2YUOA 4A5WB 3C12A 1VQKT 3L2QA 4JRQA 4D6WA 3TU4K 3CXCS 7AT1B 1UGPB 1OU9A 2FZCB 3CMAA 1X43A 1JXMA 3QBYA 2MCNA 4XTYA 1YJ9Q 5L23A 1MNEA 3CCVT 1QVGA 4RTVA 2XG8D 4XU1A 1G2BA 2RHUA 1W2BP 1D3BB 4M78B 1YJNT 4M75E 2ATCB 3GXEA 2J7IA 4Z8AA 2F2VA 1NJIC 3ZD2A 4RCCA 2RKZA 3CD6T 1G8XA 1KHIA 4J9IA 3V7RA 2LX9A 3S3MA 4M75C 1PNJA 4MDWA 1I4K1 3I5SA 5I11A 2CP2A 2IIMA 2IG0A 4RCBA 3TREA 4B9WA 2FPDA 3IU3I 1VQMA 4LXCA 3META 2DJQA 4YTLA 5FO8C 5DN4A 1GKGA 2JTEA 2YWWA 1TUDA 3WXMB 4N4HA 1IHWA 2EHFA 5KYUA 1EZZB 1YFNA 2PUKB 2XI9A 5C0MA 5GANd 4E7SA 2FYKA 2JS0A 3RNJA 1GFDA 5CAIA 2V8IA 1BI2A 3QJ6A 5J26A 3OYAA 1E6GA 1MV3A 1ZLMA 4ZH1D 4M77B 3HP9A 1VQ4A 1WJSA 2DE0X 1RI0A 2PZ1A 5GAMg 4LD6A 4PFZA 3GIBA 1FXXA 3M0SA 3JRZA 1TTHB 1UGVA 3RKYA 1VQPQ 5IAYA 3G71T 3CCRT 1M4ZA 4F7UB 1OK1A 1NEGA 4ZN3A 3JCMf 1VQ9T 1NE8A 3I56A 5GANj 3QUIA 1IGQA 1BI1A 3CPWS 2DAQA 2HNIA 2CP3A 4DOWA 1U5MA 4F16A 4ZTJA 1MMAA 4PLLA 4XU0A 2JN0A 1OK9A 4IKFA 3ZEHA 1Q95G 1ZUKA 3MEAA 2F1LA 4MMLA 4K12A 1VVDA 4M7AE 1BI3A 4WF2A 4J38B 3HPWA 2A55A 2QEXQ 2RI5A 4WJG2 1KQ1A 2KQWA 5FU6C 2MF2A 4EMHA 1RAFB 4RG2A 4J9FA 3VYHB 2DYIA 4OMLA 1M3BA 1QKWA 1OV3A 1Q86C 3G6ET 3PMIA 1OZ2A 2X2ZA 2LC4A 4M77G 2KK4A 1K9AA 1FYNA 1YJWQ 4M7DF 3G4SA 4OMNA 2CUBA 3SDZA 1QQJA 2J05A 2JJ9A 4ZTFA 3MEWA 2ESWA 3CCET 1VIEA 1IXDA 3H0FA 2QK0A 4J9HA 4F7UG 1TPMA 2HL5C 4GBQA 1H8KA 2IPOB 2ZPGB 2LJ3A 1ZSZA 2E5QA 4EPCA 4M7DD 2M1HA 2D1XA 1YCYA 3L42A 1VOMA 2R5MA 2DIGA 1HCCA 3MEVA 3NPFA 1YWOA 2JVVA 4CI0C 3HRUA 3NFPI 1Y0MA 2K5FA 1WGSA 1G3SA 4ELZC 1M90R 1CKAA 1CKBA 4LD9K 4FYVB 3X25B 1AWOA 3OQ5A 2KRNA 1VQ7T 1FMKA 2AK5A 1ZSGA 4OMQA 3RKXA 4XQ3A 3OXUD 2P4TA 1O9AA 5D6WA 3KUFA 1BBZA 4HCZA 2QQ9A 3FDRA 3CCLA 1TH7A 5KYUB 1AEYA 2XRDA 4CSYA 1E8BA 2E10A 1Z9ZA 1N8RU 1WX6A 3CCMT 2RQRA 3SFMA 2EJ9A 2ZPBB 4J9BA 3CMAQ 1NG2A 1W1FA 2RH2A 1PHTA 3VS2A 2HQXA 2PVGB 5KH6A 1GCQA 1IO6A 2HQEA 3NMZC 3RDVA 1WHJA 1MD7A 4CC3A 3C0CA 3OYIA 2ZYCA 2EVRA 1BIBA 3M0PA 1I5LA 2ABLA 3REBB 1RAAB 3FLGA 3M56A 1KC8C 2G3RA 3FJPA 3OYKA 3CXCP 2LCCA 2BZXA 1SSHA 2WACA 3M9QA 5A0DA 2EGEA 2D6FA 1QVFS 1Z92B 5FROA 2VV5A 2LT4A 1PKSA 1QLYA 3JCMc 3CBPA 1M2VA 2CT3A 4F14A 2OJ2A 2C0OA 3VUZA 2GTOA 4Y91A 1N8RR 1WA7A 4J5YA 2EJGA 4PJOF 2J06A 3OMCA 3M7PA 3IX0A 1XTDA 4N0AA 1HD3A 2V1RA 3CMET 2CKUA 5I21A 2E65A 1S72T 2NYSA 3CI0J 1D0XA 2MWOA 5GAMf 5DM7R 2B8AA 5CQXA 1VQ4Q 4KH0B 1HSQA 1NLPC 1N5ZA 2GGRA 1XNIA 3JB9F 3EG0A 1M8MA 3VS6A 1ZSZB 1VQNA 1OI1A 3PIOA 4JLGA 2OAUA 3FRNA 1IREB 2NUTB 2LDMA 4IUQA 2DILA 2ECZA 1H92A 2V26A 4JJDA 3JB9D 2Y4XA 2JUFA 5IN1A 4NL2A 4FSSA 3MHXA 1BYMA 3EH1A 2QAZA 4C92F 4JZ3A 1YCSB 4YNXA 4DQ2A 3OYEA 1RAHB 3CCJA 2LRQA 1QCFA 1WLPB 2FVUA 1OX8A 4JJCA 1ZUYA 3PMTA 2AHJB 1PRMC 4ANJA 5M9OA 4FM4B 5IH2A 3I55A 2LOJA 1YI2A 4FXGG 3EG9B 3JCMd 2KRSA 5DLOA 1B07A 3G4SQ 2FPEA 5HK3A 3DLMA 2B5ID 4FW1A 3HFOA 1I0CA 4DJZA 4PNOA 4EMGA 4BI8B 2RMOA 2K57A 2XMFA 3KXTA 2X3XD 1WXTA 1C0MA 1AOJA 4A4KA 2HZYA 2RO0A 4XU3A 1IRXA 4QVZA 1KJWA 3QZ5B 2VC8A 2KMSA 4A4HA 1TU0B 2RHZA 1M2VB 2E64A 2VGMA 1N8RC 1PPQA 3OSVA 2LVMA 2XDDA 2L3RA 3ME9A 2QTVA 2KGTA 1UFFA 3M59A 4LOTA 1UGSB 3OBWA 3M57A 4M78E 2EKOA 2EAYA 2FHDA 3ULRB 2CYZB 3EFRA 4PJJA 3CCLQ 1HJDA 2W10A 3SHWA 1UECA 4M78C 5IHNA 3INBC 1QMCA 3VS4A 2E6NA 1Q82U 2BUDA 4M75F 2UWNA 3RBBB 2FPFA 3DKMA 2PUOB 3RJ3D 1T3SA 2W81A 4C0GA 5FRNA 2Y8TA 4BE1A 3P8DA 2C06A 1VQKA 1AD5A 2CUDA 2DX1A 3L1AA 1NYFA 3KXVA 2RQTA 2XRBA 1R77A 2CZ0B 3OYCA 2E5KA 3GNFB 4QQDA 3SD4A 4E7HA 3M5AA 4ZNXA 4EMKC 3M0RA 2DVEA 5GAN7 2RHXA 3CBOA 4QVCA 1M27C 4M77E 1GKNA 1BB9A 2LZ6B 1G4GA 2KT8A 5LJ3d 2KRMA 4JJBA 3X24B 2OAWA 2GF7A 4LDVA 2YRCA 1QVGS 2FO0A 1X69A 3I5RA 3S3NA 2I0NA 1N9RA 2L5QA 4F7UE 3WVEB 4M77C 2DBMA 3GLXA 4BDYA 1NWVA 3OYYA 1HK9A 2DIQA 3OS5A 1T3LA 2RM4A 3MP6A 4ME7A 1VQ8T 4QKUA 2EPDA 2DTIA 3EGUA 1VQ5T 4XTVA 1PRLC 1SRLA 2DL4A 2EFIA 4XU2A 1WHHA 3CCST 1BI0A 3HFNA 1YJWA 2A7YA 4L59A 4E6RA 1KIKA 5LJ5e 3VUBA 2QQBA 1M1FA 1XJWB 1DJ7B 4E7LA 1LNXA 2FL7A 2DEQA 2PVDB 4E7IA 1K9MU 2EQIA 2O39C 4N4GA 1VQNQ 3EGXA 2YLCA 2X35A 2DM1A 3RIRA 1MMDA 4OP0A 4C16A 2XDBA 3G71A 3CCRA 1TPGA 3BY7A 3O5ZA 4JRPA 5LL6S 3KFVA 1VQ9A 1QP2A 2RPNA 1V29B 2Y90A 1GCPA 1D1AA 5D6YA 4OB1B 1NEBA 2I2LA 4BDZA 1G5VA 2EYXA 3HTRA 2L8DA 3S3OA 3CCJQ 2DL8A 3K3TA 3CC2T 1C6VX 1WI7A 1U1SA 5DLQE 2DERA 4BACA 1M30A 2QDYB 4MMKA 1EFNA 5D6XA 1CSKA 1X2QA 5GAMe 2MCYA 5KE3A 3I55Q 2WIIC 1YI2Q 2MWPA 1Q86R 2BE7D 2IZ3A 4JPBW 1I5OB 5CKBA 5LJ5g 3G6EA 4JLIA 2BTTA 3MCAB 3CCQT 1HYOA 2O88A 1KD1U 4N4IA 2GQVA 4V2SA 1GXIE 2RI2A 1U06A 3A1PA 1QO6A 3CCEA 3QG1A 4P5NA 2LTOA 3VU3C 1H641 2RKYA 5LJ5h 2FRYA 4LDYA 3E9GA 3LWIA 3RUXA 1LY2A 1VA7A 3HRSA 5FWCA 2KXDA 2KDSA 1Q82C 3EGDA 1JBMA 3VWOA 4OB0B 3OYNA 3VYGA 3F6KA 2LMJA 1AZGB 4GY5A 1UTIA 3J7AF 3ZLDA 1KC8U 2LJ1A 4HCBA 4NOYA 3R62A 4X9CA 3OYFA 3RMSA 4AYIA 5GAOm 5HCKA 2LQKA 2X4YA 3LLRA 5GAOl 4B9XA 2L3SA 1PC0A 2A28A 4NL3A 1JU5C 4PJOB 9ATCB 2KROA 3V8LA 1Y07A 4C5IA 1BCOA 1VQ6T 5CVIA 1NM7A 4XTZA 1M1GA 1VQKQ 1OU8A 2V1QA 3G1JA 2OX7A 1IHVA 3EGXB 4M78G 3CCMA 2JM8A 2D8JA 2EWNA 5GAMh 3A5ZB 1OK2A 1X2KA 3NJAA 1SKUB 3RR6A 4MDXA 3FEOA 4UC4A 4OMOA 3CCVQ 3CC7T 1RUWA 5GJVB 1QUBA 4QW2A 3PT9A 1OJYA 3E9FA 3EG1A 4JUVA 5GMKi 1K8AU 1YJNQ 1KC8R 2JW4A 5GAN3 3SWNA 5I2MA 1VQLT 4BUGA 1VYTA 3FGTA 3CD6Q 1H2QP 1O75A 2A08A 3H9NA 2DFUA 2FG0A 2HBPA 4A63B 4C92B 3V8JA 1ZSZC 1HFIA 1K9MC 4PJNA 5C6SA 2FEIA 2DKGA 2ED1A 4KUIA 2XIDA 4M4ZA 2GBQA 2E3HA 2OTJT 2JGXA 2VXFA 1KHCA 1QVGP 4RTUA 1KK7A 2QA4T 4J9GA 3SB2A 1K4US 4Z02A 3CCUT 2MPXC 2EQMA 2DD4A 1ACMB 4J9CA 4DEXA 1VQOA 4HA8A 2QYZA 3CMEA 4IUVA 4MSLA 3JCMb 1S72A 3LW5E 3HRTA 2YUPA 1V1CA 4E47A 2RQUA 1K8AR 3H8ZA 5IHIA 2VUBA 2NUTA 3M58A 3QYHB 2K2MA 4AYMA 1AWWA 3G71Q 3CCRQ 2V8KA 5GANg 3R6NA 4C0ZA 2VB6A 3EGDB 4Y92A 5GAN4 1ZQ1A 1VQ9Q 2HKQB 3TSZA 4PKCC 1ZHIA 2F69A 2LT1A 4BE0A 4C8QA 3VS7A 4J83A 4FYWB 1GCQC 1VQMT 2M0OA 1AT1B 2F2XA 3OYJA 2K79A 2HL3A 3TCJA 5L8RE 2JS2A 2MIOA 1LVKA 2CZ1B 1YHQT 1KD1C 2O9VA 3I35A 2B86A 2COYA 1QWEA 1A0NB 3QHSA 3PVQA 3EG9A 5AT1B 5KE2A 3L2RA 2XHCA 4XTWA 1VQ4T 3FJ5A 5LJ5f 2LX7A 4II1A 4GLKA 5GAN8 3M4YA 3OYDA 1AWXA 3G6EQ 1VIFA 5A0GA 4RUGA 1SHFA 1RAGB 3CPWA 5GAOn 3X28B 1VUBA 4JRIA 3KZJA 1OZ3A 1JO8A 2E70A 3UATA 3I56T 1C1ZA 2CH4W 2Z0WA 5HYUB 4LE9A 4M78F 5A0LA 1M3AA 1WQWA 4AFZC 3A8HB 1VYVA 4C0FA 3CCEQ 2GCXA 1U3OA 2P0KA 3EHRA 4N0AC 1ZX6A 3DLLA 5GMKe 1MV0B 2VVKA 4KUDK 2Y4YA 3ER0A 3QIIA 2P84A 2D8HA 2V8EA 3CC4T 3JSCA 4FT2A 4KGXB 2LJ0A 3SWNB 4M78D 2E12A 1IZ6A 1WHKA 1QW1A 4ZGEB 1QKXA 2YRDA 1RAIB 3M0UA 4DBHA 2CG6A 4A4FA 1GFCA 3KBGA 3HL8A 1K1ZA 5CK9A 2G6FX 1ABQA 1UG1A 2EYQA 4J8OA 1JEGA 2HD0A 3D7SB 1VQ7Q 1X75C 2VKNA 1M1KU 1LPLA 2CREA 1NZ9A 1YIJT 4QQ6A 2K6DA 1QCOA 3G4ST 4M77F 4HVUA 1OJVA 3UA7A 2SRCA 1YNZA 4JS5A 1M2OA 2J6OA 3M55A 1K8AC 3JCMP 4C0DB 4F7UF 4IURA 4RMOA 2ZPEB 2J6FA 1C1AA 2F5TX 2L3PA 2P0QA 3QDRB 3CCMQ 1Q7YU 3JCMV 4M77D 1H03P 5KYWA 3MO8A 3OYLA 2DVJA 4KKDA 3HHTB 1YITT 4HVWA 3OS1A 2RJFA 1WDXA 3CPFA 1I07A
chains in the Genus database with same CATH topology
4M7AB 5LJ3d 3X24B 2MI6A 1KHIA 5J39A 2GF7A 3V7RA 4LDVA 1QVGS 1YITA 2LX9A 1Y7XA 3S3MA 4C8QB 3S3NA 1N9RA 2L5QA 4M75C 4F7UE 4NS5A 4C92G 3FB9A 3WVEB 4M77C 4FIBA 3GLXA 4FT4A 4MDWA 1I4K1 5GANh 4BDYA 3LX7A 3OYYA 3TEEA 3OW2S 5FU7B 3PNWC 1HK9A 2YLBA 2DIQA 2ZGWA 2DK3A 2IG0A 3OS5A 2WSFE 2RM4A 4RCBA 3MP6A 3TREA 2ZPHB 4ME7A 4B9WA 1VQ8T 1BIAA 1VQMA 3JB9J 2LCLA 2K4YA 2DTIA 2QI2A 1VQ5T 1PSFA 3META 4XTVA 5GMKh 4A4GA 2LNVA 4J7FA 2K3YA 2QXFA 1AHJB 2EFIA 2JTMA 5LJ3f 4XU2A 1N6AA 4YTLA 3CCST 3WXMB 1BI0A 4N4HA 1VQ8A 4TVRA 2X4WA 3HFNA 2PUKB 2XI9A 5C0MA 1YJWA 2A7YA 5GANd 4KT0E 3X20B 1VQ5A 3MEUA 4L59A 3PFSA 2FYKA 2RJEA 5LJ5e 3C4SA 4J6XA 5CAIA 2V8IA 4M75B 1BI2A 4MZMA 2ZPIB 3QJ6A 4XK8E 1N9SA 5J26A 3VUBA 3OYAA 4PO7A 4M77B 3UDCA 2QQBA 1XQHA 3HP9A 3CCSA 1KQSS 1VQ4A 1U1TA 1M1FA 4OB2B 1WJSA 3OBYA 5A2QE 3VKIA 1RI0A 4X34A 5GAMg 1DJ7B 4LD6A 4E7LA 3GIBA 1LNXA 1FXXA 3JRZA 3NFCA 4A54A 3O8VA 2FL7A 4M7DA 2DEQA 2PVDB 4E7IA 4APLA 3RKYA 2EQKA 1K9MU 2WSEE 5IAYA 3G71T 3CCRT 1M4ZA 4F7UB 2OTLT 4N4GA 4E7JA 2YLCA 2R5AA 2X35A 4ZN3A 3GP8A 2RB6A 3JCMf 2HAXA 1G3TA 1VQ9T 1NE8A 3RIRA 3I56A 4R56A 3QUIA 4OP0A 5GANj 1BI1A 2RJDA 3CPWS 2DAQA 2HNIA 4RG8A 3L2WA 1QVFA 3QKJA 4DOWA 2XDBA 3G71A 3CCRA 4OGEA 2OTLA 4BE2A 3LWHA 3OA6A 3E1SA 3JCMX 3UPUA 4ZTJA 4HCCA 3BY7A 4PLLA 4JRPA 4ATOA 3V7CA 4XU0A 4C8QG 5LL6S 2JN0A 3JAME 4QQGA 1Y96A 1VQ9A 1QP2A 5GMKj 3ZEHA 4IKFA 1V29B 2MMPA 3QO3A 2EJFA 2Y90A 3MEAA 5I2SA 4Q5WA 5D6YA 4MMLA 4OB1B 2I2LA 4L6V5 4BDZA 5GAOr 1G5VA 2H3JA 2L8DA 2CZ7B 1LOJA 3S3OA 1LJOA 5CCAA 1BI3A 4WF2A 3GPLA 4M7AE 3HPWA 3WVDB 1WJRA 3F70A 2RI5A 1KQ1A 4OMFB 2KQWA 3OYHA 4E7KA 3CC2T 4J7IA 5FU6C 2XKOC 1U1SA 2MF2A 5DLQE 4EMHA 2KSSA 4BACA 2F5KA 4RG2A 1RL2A 3DB3A 3WSXA 2QDYB 4MZTA 3VYHB 2QQRA 4HT9A 4MMKA 5D6XA 3EAEA 3L2VA 3C94A 3EFSA 3GF5A 4XTUA 5GAMe 2CZ6B 1BKBA 2NLUA 3PTAA 5KE3A 3G6ET 3GOXA 3PMIA 1Q86C 3CC2A 1OZ2A 3FIFA 4M75G 2X2ZA 2MWPA 2K3XA 2LC4A 2JOYA 3OMGA 4IUTA 4DA4A 1H3ZA 4M77G 2KK4A 1VQOT 4M7DF 3G4SA 3DB4A 3H6ZA 3SDZA 4HT8A 1M9SA 5EG2A 1JJ2S 1FWZA 4ZTFA 3MEWA 5CKBA 1SSFA 5LJ5g 2GFAA 2YHTA 3G6EA 4JLIA 3CCET 1VIEA 4BI4A 4PJOD 4F7UG 1UGQB 2CGHA 4KBMB 2EQUA 2DTOA 3MCAB 3CCQT 5FU6B 1X01A 1KD1U 4N4IA 2GQVA 3C95A 4ZGJB 4V2SA 1GXIE 2ZPGB 3RKWA 4EPCA 2JNGA 2E5QA 3CCVA 4L5GA 2RI2A 4M7DD 3CCEA 3QG1A 4P5NA 1Y71A 2M1HA 2LTOA 3VU3C 3BDLA 2Y8RA 1H641 3UWNA 1FX7A 1YCYA 5LJ5h 3L42A 4LDYA 3E9GA 2R5MA 3LWIA 2DIGA 3RUXA 3CCQA 3MEVA 2DXTA 1YJNA 4CI0C 2JVVA 1M1KC 1M90C 4M7DE 3HRSA 3V7SA 3HRUA 4KULA 2XICA 2KDSA 3MP1A 3JCMg 1R8OB 1Q82C 1M8VA 4LDUA 2K5FA 1JBMA 1WGSA 4OVAA 4FL6A 1G3SA 3CD6A 4ELZC 5GAOq 4OB0B 2RD1A 3OYNA 1W2BA 4LD9K 5DY9A 5GAOp 3VYGA 3CCLT 3F6KA 4M7DC 3X25B 3P8HA 3HSBA 1JRIA 3OQ5A 1VQ7T 3RKXA 2MAMA 5LJ5d 4GY5A 2P4TA 4IUPA 3BFMA 4XQ3A 5D6WA 1U8RA 3KUFA 3ZLDA 3J7AF 4HCZA 1Q7YC 1KC8U 2QQ9A 3FDRA 3P8BB 3CCLA 4HCBA 4NOYA 1TH7A 5LJ3e 2D9TA 1W2BS 4R55A 3RERA 3E19A 3HKSA 4X9CA 3OYFA 3RMSA 1NPRA 4N7EA 1MGQA 4C92D 5GAOm 2LQKA 2X4YA 3LLRA 5GAOl 2E10A 2DXUA 5GMKl 1YJ9T 4B9XA 4PJOA 3OS0A 1KQ2A 4NL3A 4PJOB 1N8RU 4JRKA 3V8LA 5GAN6 3CCMT 1Y07A 2X4JA 2D0QB 3SFMA 4C5IA 4BY6C 2EJ9A 2ZPBB 4LDWA 3OYGA 1KG1A 2XK0A 1VQ6T 2BKDN 5CVIA 5LJ5j 4M7DB 4XTZA 1M1GA 2E1HA 1YJ9A 2RH2A 5AYFA 2BIVA 2HQXA 2PVGB 3PGGA 4CRIA 4M78G 4PL6A 2HQEA 4VUBA 5KH6A 3CCMA 5GANf 2O4XA 3GNGA 2EWNA 5GAMh 3A5ZB 3JCMe 2Y8SA 5KCOA 5GAN5 3NJAA 1VQ6A 4M7AG 3OYIA 2O4XB 3LH0A 4OGCA 2X4XA 5IT9E 3FEOA 1QP3A 1P92A 4UC4A 4RKUE 3J81E 4MDXA 4BWCA 1UB4A 1BIBA 2K2VA 1O9SA 1I5LA 3CC7T 4X9DA 1EIFA 2XU8A 3FLGA 3M56A 1Y96B 2DPPB 4QW2A 3JCMQ 1KC8C 2G3RA 4OF1A 2KY9A 3FJPA 3BDUA 3OYKA 3PT9A 2LCCA 4JUVA 2CKKA 3E9FA 1Q81U 3ZLEA 2WACA 3M9QA 4BY6B 4C5HA 5A0DA 5GMKi 1K8AU 1QVFS 2D6FA 5FROA 2VV5A 3JCMW 5GAN3 2LT4A 3SWNA 5I2MA 3CC7A 4BUGA 1VQLT 3JCMc 3CBPA 3ZFJA 3FGTA 5GAMd 2QQSA 2A3LA 4QVDA 1O75A 2R57A 4C92A 5CR2A 2HBPA 3VUZA 2E6ZA 3LGFA 3T9NA 4Y91A 5HKCA 4C92B 2RK1A 3V8JA 3M54A 4J5YA 1K9MC 1VQLA 5C6SA 2EJGA 5FLXE 3LYIA 4PJOF 3OMCA 2DKGA 4KUIA 1NJIU 2XIDA 1B34A 3NTKA 1NPPA 4ZGDB 5CO7A 1XTDA 3Q1JA 2OTJT 3VJPA 3JCMJ 4N0AA 5LJ3g 3MP8A 2VXFA 3CMET 2IVWA 1KHCA 1ZBXA 2ZZDA 2QA4T 5I21A 5CKFA 2E65A 4EDUA 5GAMj 1HXDA 2MWOA 3SB2A 5GAMf 1VQPT 5HY6A 4O6JA 4J6YA 1S72T 2P0PA 4Z02A 1VQNT 3CCUT 5DM7R 2B8AA 3NTIA 1PSEA 2DD4A 2EQMA 5CQXA 4M7DG 2OTJA 1WQ7A 4HA8A 1VQOA 1XNIA 4JDSA 3JB9F 3CMEA 3QSUA 4IUVA 4MSLA 3INZA 4J6WA 1Q81C 3JCMb 3PIPA 4A53A 2QA4A 5LJ3h 1VQPA 1S72A 4PJOE 3LW5E 4ZN1A 2RJCA 2RHIA 1VQNA 2VGNA 1OI1A 3HRTA 3CCUA 3URGA 3PIOA 3RESA 1WPYA 2PQWA 3ASKA 4JLGA 4E47A 1UGRB 2OAUA 2VUBA 3H8ZA 2O01E 3M58A 3QYHB 4M75D 2DXBA 3QXEB 4JJNK 2E41A 3FRNA 3OS2A 1IREB 4BI3A 2LDMA 4IUQA 1WJQA 5CIUA 1D3BA 4M78A 4PJOC 2V8KA 5GANg 3JB9D 2Y4XA 4C0ZA 2JUFA 3OW2A 1X6OA 5IN1A 5GAN4 2RA2A 3OY9A 1ZQ1A 2KVQG 4NL2A 3CCJT 3MHXA 2QEXT 4A4EA 1BYMA 1G3YA 4C92F 1N27A 3JB9H 4PKCC 4DQ2A 1ZHIA 3OYEA 2F69A 2LT1A 4BE0A 4C8QA 1OYXA 4J83A 2ZCFB 2RI3A 3JCMh 3QZ9B 1VQMT 3CCJA 2YRVA 2M0OA 2R58A 3A8LB 2QEXA 1K73U 3OYBA 3OYJA 3S6WA 4OB3B 3I55T 5GAN2 1UEBA 2LRQA 2KMTA 2M16A 3TCJA 5L8RE 1VQ7A 1YI2T 1W4SA 2GFUA 2DO3A 2CZ1B 1YHQT 4Y28E 4ELYC 1KD1C 4IUUA 5GMKm 3L2UA 2L89A 2FVUA 4O5VA 3UT1A 1YBYA 4EMKA 1YJWT 4BD3A 3PMTA 3VV0A 4EMKB 3QHSA 2AHJB 3M53A 3QPHA 2JZ2A 2DZCA 5CKDA 1KQSA 2VYTA 5M9OA 4FM4B 5HK0A 3OYMA 5LJ3j 3I55A 3V8KA 4C92E 1YI2A 3ZBDA 2XD0A 5KE2A 3L2RA 1YHQA 2XHCA 4XTWA 1VQ4T 4JS4A 3JCMd 2RK2A 2V8JA 2DD5A 5LJ5f 2EIFA 3G7ZA 3QJYA 3JB9I 5DLOA 4YIZA 2K5IA 4II1A 3SWNC 4DOVA 2FB7A 5HK3A 4FU6A 2QTXA 4GLKA 2M9UA 3M4YA 3QYGB 4M75A 5GAN8 3OYDA 3FC3A 3WSYA 5KCHA 4M77A 3DLMA 1VIFA 5A0GA 2LQ8A 3HFOA 4C92C 3CPWA 4PNOA 5GAOn 4EMGA 3X28B 1VUBA 4BI8B 4JRIA 5GANe 1OZ3A 3A8GB 2E70A 2XDPA 3OSSC 2RHYA 3I56T 2K57A 4M78F 3BW1A 3KXTA 5A0LA 1WQWA 4F7UA 3A8HB 1QVPA 4C0FA 2DZ9A 3L2ZA 2GCXA 4FSXA 3CEYA 4M7AF 3AHUA 1Q86U 2VXEA 1K73C 2P0KA 4A4KA 4N0AC 2WSCE 1JB0E 5GMKe 3DLLA 3RMQA 4PLIA 2RO0A 4KUDK 4C8QF 4C5GA 2Y4YA 3ER0A 3QIIA 4QVZA 4XU3A 3QZ5B 2VC8A 3M4GA 5J3BA 1G3WA 3LGLA 3CC4T 3JSCA 4FT2A 3NTHA 4A4HA 3FGRA 1I81A 2QQAA 3SWNB 4M78D 2E12A 1IZ6A 1QW1A 4ZGEB 2RHZA 4HKEA 2E64A 2VGMA 1N8RC 3J80E 4LDXA 2EQJA 2LVMA 3OSVA 2XDDA 2L3RA 3A8OB 1WNLA 4A4FA 3KBGA 1XOVA 3ME9A 3CBMA 4M7AD 3M59A 2ZPFB 3HL8A 5CQYA 4C0DC 1UGSB 2PVOB 3OBWA 2PU9B 3A8MB 3M57A 4M78E 2EKOA 3CC4A 2EAYA 2FHDA 5CK9A 4C8QD 3CXCA 4XTXA 5CKEA 2CYZB 1MHNA 3EFRA 1B34B 3N5BB 2CS7A 2EYQA 3OB9A 4PJOG 2DJZA 1M5Q1 4J8OA 2HD0A 4C8QE 4M78C 5FRMA 1X75C 1M1KU 1NZ9A 1M90U 1JJ2A 2DXCA 2E6NA 1YIJT 4QQ6A 1Q82U 1I8FA 2BUDA 4M75F 3X26B 3CMAT 3C12A 1VQKT 3DKMA 3G4ST 3L2QA 4M77F 4M7AC 4JRQA 2PUOB 4D6WA 3TU4K 3CXCS 4C5EA 2DTHA 4BB7A 4C8QC 4JS5A 1UGPB 3M55A 1K8AC 4C0GA 3JCMP 5FRNA 1YIJA 3CMAA 2JTFA 2Y8TA 4C0DB 4F7UF 3QBYA 3P8DA 4IURA 2ZPEB 4XTYA 5FU7C 4RMOA 4BE1A 2F5TX 2C06A 1VQKA 3JB9G 3CCVT 2P0QA 3QDRB 3L1AA 1Q7YU 1QVGA 3JCMV 4M77D 2CZ0B 3OYCA 3MO8A 3OYLA 3GNFB 4QQDA 2XG8D 4XU1A 3SD4A 4E7HA 3M5AA 4EMKC 2K5LA 3HHTB 5CKHA 2RHUA 1YITT 2DVEA 5GAN7 3OS1A 1D3BB 2KAFA 2RHXA 3CBOA 4M75E 4M78B 4QVCA 2RJFA 1YJNT 4MZPA 1NJIC 4M77E 4RCCA 4XAXB 4M7AA 3CPFA 3R6OA 3CD6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  1Y96 B;  5LJ3 d;  4C92 E;  3JCM Q;  3FIF A;  3FJP A;  3BDU A;  4M75 G;  3V7R A;  4XTW A;  4JUV A;  4M77 G;  3JCM d;  5LJ5 f;  3JB9 I;  5GMK i;  4M7D F;  4C8Q B;  4HT8 A;  1N9R A;  4M75 C;  3SWN C;  4F7U E;  3JCM W;  2FB7 A;  5GAN 3;  4C92 G;  2QTX A;  3FB9 A;  4M77 C;  4M75 A;  3SWN A;  5GAN h;  5GAN 8;  1I4K 1;  3JCM c;  4M77 A;  5LJ5 g;  2YHT A;  4JLI A;  3HFO A;  5GAM d;  1HK9 A;  2YLB A;  4C92 C;  4QVD A;  2ZGW A;  4PJO D;  4PNO A;  4RCB A;  2RM4 A;  4C92 A;  4EMG A;  4F7U G;  5GAO n;  2CGH A;  1BIA A;  4JRI A;  2DTO A;  4Y91 A;  5GAN e;  4C92 B;  1X01 A;  3V8J A;  3JB9 J;  2K57 A;  2DTI A;  4J5Y A;  3BW1 A;  4M78 F;  4V2S A;  3RKW A;  4XTV A;  1WQW A;  2EJG A;  4F7U A;  5GMK h;  4PJO F;  4M7D D;  2DKG A;  2DZ9 A;  3L2Z A;  5LJ3 f;  4XU2 A;  1B34 A;  3VU3 C;  4M7A F;  3AHU A;  1H64 1;  2VXE A;  1YCY A;  5LJ5 e;  5LJ5 h;  4N0A C;  3HFN A;  5GMK e;  3RUX A;  3JCM J;  4N0A A;  5LJ3 g;  2DXT A;  2VXF A;  5GAN d;  4C8Q F;  4XU3 A;  4M7D E;  3V7S A;  2VC8 A;  3M4G A;  3JCM g;  2FYK A;  1M8V A;  5I21 A;  1JBM A;  1I81 A;  2E65 A;  1HXD A;  4J6X A;  4M75 B;  3SB2 A;  4M78 D;  3SWN B;  5GAM f;  4J6Y A;  1N9S A;  5GAO q;  2RD1 A;  2E64 A;  4M77 B;  4M7D G;  1U1T A;  5DY9 A;  5GAO p;  1WQ7 A;  4HA8 A;  1WNL A;  5GAM g;  3GIB A;  4M7A D;  1LNX A;  3JB9 F;  4M7D C;  4A54 A;  3QSU A;  3HSB A;  4J6W A;  3INZ A;  1JRI A;  5GAM j;  2DEQ A;  4M78 E;  4A53 A;  3JCM b;  5LJ3 h;  2EAY A;  3RKY A;  4M7D A;  4PJO E;  3RKX A;  4C8Q D;  4F7U B;  5LJ5 d;  4XQ3 A;  2YLC A;  3BFM A;  4XTX A;  3RES A;  1WPY A;  2RB6 A;  3EFR A;  1B34 B;  3JCM f;  3RIR A;  4M75 D;  4NOY A;  1TH7 A;  3QUI A;  4OP0 A;  5LJ3 e;  4PJO G;  5GAN j;  2E41 A;  2DJZ A;  1M5Q 1;  2HNI A;  3RER A;  4C8Q E;  4M78 C;  4X9C A;  1D3B A;  1MGQ A;  4M78 A;  4C92 D;  5GAO m;  5GAN g;  3JB9 D;  4PJO C;  1I8F A;  4M75 F;  3JCM X;  4PJO A;  5GAO l;  2E10 A;  2DXU A;  3BY7 A;  5GMK l;  5CAI A;  5GAN 4;  4M7A C;  4M77 F;  1KQ2 A;  2RA2 A;  3V7C A;  4XU0 A;  4C8Q G;  4NL2 A;  2JN0 A;  4NL3 A;  4PJO B;  1Y96 A;  4JRK A;  5GMK j;  3V8L A;  5GAN 6;  4C92 F;  3QO3 A;  3JB9 H;  2Y90 A;  2EJF A;  2EJ9 A;  2DTH A;  4C8Q C;  4DQ2 A;  4MML A;  4C8Q A;  2I2L A;  3JCM P;  5LJ5 j;  5GAO r;  4M7D B;  4XTZ A;  4F7U F;  2E1H A;  4XTY A;  3JCM h;  1LOJ A;  1LJO A;  4M7A E;  4WF2 A;  3JB9 G;  3PGG A;  4M78 G;  3L1A A;  5GAN f;  1KQ1 A;  3JCM V;  4M77 D;  5GAN 2;  1U1S A;  4EMH A;  2EWN A;  5GAM h;  3JCM e;  5GAN 5;  4M7A G;  4XU1 A;  4EMK C;  5GMK m;  4HT9 A;  2DVE A;  5GAN 7;  4EMK A;  4MMK A;  1D3B B;  4M78 B;  4QVC A;  4M75 E;  1BIB A;  4M77 E;  4RCC A;  3QHS A;  3EFS A;  4EMK B;  1I5L A;  4X9D A;  2DZC A;  4XTU A;  5GAM e;  4M7A A;  5LJ3 j;  3V8K A; 
#chains in the Genus database with same CATH topology
 4M7A B;  2MK5 A;  2PNI A;  2O31 A;  1M3C A;  4C8Q B;  1TG0 A;  3LX7 A;  3OW2 S;  1PCX A;  5FU7 B;  2W80 A;  2YLB A;  2PTK A;  1WHM A;  2DK3 A;  4DBF A;  1TOV A;  2K4Y A;  2QI2 A;  1WXB A;  5GMK h;  4A4G A;  1MUZ A;  2LNV A;  2K3Y A;  1X6B A;  4FW2 A;  1AHJ B;  2KYM A;  2JTM A;  1N6A A;  1OX9 A;  2EGA A;  1VQ8 A;  4TVR A;  3H0I A;  4ONT D;  4WCI A;  4PK4 A;  4KT0 E;  1VQ5 A;  3MEU A;  3E2U A;  4LUD A;  1Q7Y R;  3C4S A;  1PM3 A;  4XK8 E;  1G83 A;  1N9S A;  4KH1 B;  3CCS A;  3UDC A;  2CDT A;  1KQS S;  1U1T A;  1VQO Q;  4X34 A;  4FYX B;  1SG5 A;  3CME Q;  1BCM A;  3O8V A;  4M7D A;  2XWB F;  1ZA1 B;  2EQK A;  1S72 Q;  2OTL T;  2RLP A;  4E7J A;  1ZUU A;  2R5A A;  2HAX A;  1G3T A;  2HDA A;  2RJD A;  2RF0 A;  1QVF A;  3QKJ A;  4OGE A;  4BE2 A;  3OA6 A;  2DL5 A;  3E1S A;  3JCM X;  2K9G A;  3UPU A;  4HCC A;  4AT1 B;  4ATO A;  3V7C A;  4C8Q G;  3JAM E;  2FZK B;  4QQG A;  2EJF A;  4Q5W A;  3LH5 A;  2O2O A;  4L6V 5;  4DEY A;  5GAO r;  2KXC A;  3QWX X;  4LUE A;  1LOJ A;  5CCA A;  1FMV A;  1WJR A;  4OMF B;  1LCK A;  4J7I A;  1D1B A;  2XKO C;  1TS9 A;  2DRK A;  2F5K A;  1OPK A;  3DB3 A;  3GOV A;  1RAE B;  4MZT A;  1PG5 B;  2QQR A;  1JXO A;  1E6H A;  2P4R A;  3EFS A;  3GF5 A;  2CZ6 B;  1BKB A;  5IXB A;  3PTA A;  3CC2 A;  1VYU A;  3OMG A;  3DB4 A;  3H6Z A;  4AYE A;  3THK A;  1JJ2 S;  1W70 A;  1SSF A;  1OEB A;  2A36 A;  2GFA A;  5IXF A;  2CH4 A;  1NYG A;  3MPU B;  4BI4 A;  4D8K A;  1UGQ B;  5KYW B;  2EQU A;  2DTO A;  5FW9 A;  1X01 A;  2MCZ A;  3O8E B;  1I1J A;  3C95 A;  5GJW B;  4ZGJ B;  3RKW A;  3CCV A;  3SW0 X;  2JNG A;  3QWY A;  4L5G A;  2JM9 A;  2KR3 A;  3H41 A;  1Y71 A;  3BDL A;  3UWN A;  1FX7 A;  3EG3 A;  4F4O C;  2ROT A;  3CCQ A;  4GLM A;  1SS2 A;  1YJN A;  1M1K C;  3V7S A;  2W0Z A;  1X6G A;  3QDF A;  3MP1 A;  3JCM g;  1R8O B;  1M8V A;  5EC7 A;  3TVT A;  4OVA A;  3CD6 A;  1YP5 A;  4ESR A;  5GAO q;  1W2B A;  1Q82 R;  2DRM A;  4OMM A;  5DY9 A;  5GAO p;  4DBR A;  1RI9 A;  3P8H A;  3TVJ A;  1R0B G;  2DL3 A;  2MAM A;  2M51 A;  4FYY B;  4K11 A;  5LJ5 d;  4IUP A;  3BFM A;  1U8R A;  3VS5 A;  1Q7Y C;  3P8B B;  5LJ3 e;  2D9T A;  2DNU A;  5I0Q B;  3HKS A;  2KE9 A;  1MGQ A;  1K0X A;  4PJO A;  5GMK l;  1YJ9 T;  1KQ2 A;  1G4F A;  1K76 A;  2A37 A;  1WHG A;  4LNP A;  5GAN 6;  1U5S A;  2D0Q B;  2G7I A;  3OYG A;  4AG1 C;  2XK0 A;  2BKD N;  5LJ5 j;  1UDL A;  4M7D B;  2E1H A;  4F04 B;  1AZE A;  5JPM G;  2A0F B;  4CRI A;  4AFQ C;  3GBQ A;  3GNG A;  1SEM A;  5KCO A;  1VQ6 A;  5KYY B;  2O4X B;  4OGC A;  1FMW A;  5IT9 E;  1P92 A;  4RKU E;  2K2V A;  1O9S A;  3SEM A;  4X9D A;  1WXU A;  1UOT P;  3L89 M;  2JGW A;  2DPP B;  2K3B A;  2HSE B;  4OF1 A;  3BDU A;  1OQK A;  2QGF B;  2CKK A;  2CSQ A;  4BY6 B;  3JCM W;  3CC7 A;  1UUE A;  1QGB A;  2EGC A;  5GAM d;  2A3L A;  3EJH A;  4LN2 A;  2R57 A;  4C92 A;  3VS1 A;  2ZAE A;  5I22 A;  2RK1 A;  1VQL A;  5FLX E;  4JHS A;  1B34 A;  1K9M R;  1NPP A;  1R0C B;  4ZGD B;  1VQ8 Q;  1RAD B;  3Q1J A;  2DEU A;  1CKL A;  4PJL A;  4R0K A;  3VJP A;  5LJ3 g;  4KRT A;  1VQ5 Q;  5HZP B;  1ZBX A;  5CKF A;  1VQP T;  4EDU A;  5GAM j;  2RLQ A;  1TUG B;  4O6J A;  4J6Y A;  4AFS C;  3CCS Q;  2P0P A;  5KYX A;  4PJM A;  1SHG A;  4M7D G;  1PSE A;  2OTJ A;  1WQ7 A;  3OW2 P;  4RTW A;  3OP8 A;  2E4H A;  3QSU A;  1Q81 C;  2QA4 A;  5LJ3 h;  4IIO A;  4B6M A;  2RHI A;  1T0H A;  2RQV A;  2VGN A;  3CCU A;  3URG A;  2PQW A;  3ASK A;  1VVC A;  1PKT A;  2O01 E;  3M0Q A;  1WJQ A;  1D09 B;  2MYS A;  2JMA A;  5D7U A;  1MND A;  1X6O A;  2KEA A;  3OY9 A;  2KVQ G;  1TUC A;  2QEX T;  2JT4 A;  4E7Z A;  1G3Y A;  3JB9 H;  1YN8 A;  1KQS P;  1OYX A;  2M0Y A;  2DET A;  2AZS A;  3U23 A;  3A8L B;  1AWJ A;  5GAN 2;  1UEB A;  2KMT A;  1PD1 A;  2M16 A;  1VQ7 A;  1W4S A;  2DO3 A;  3L2U A;  4O5V A;  1YBY A;  1YJW T;  2CSI A;  4EMK B;  2RL0 A;  1KD1 R;  2JZ2 A;  2DZC A;  1GPZ A;  3CC2 Q;  4ORZ A;  3OYM A;  1IGU A;  3ZBD A;  1YHQ A;  4B2R A;  1GHQ B;  4CC2 A;  4JS4 A;  2RK2 A;  3JB9 I;  2LQN A;  2DLP A;  1ABO A;  4YIZ A;  3SWN C;  1W6X A;  2QTX A;  2H3E B;  2M9U A;  3QYG B;  4HXJ A;  4M75 A;  3WSY A;  2JXB A;  1BU1 A;  2LQ8 A;  5GAN e;  2QDL A;  3A8G B;  3OSS C;  2RHY A;  2GTJ A;  1E7O A;  3MKD A;  3NGP A;  3NHN A;  1KFZ A;  2DZ9 A;  3L2Z A;  2QG9 B;  1K73 C;  3OED C;  2WSC E;  1KSW A;  3CCQ Q;  1X27 A;  5J3B A;  1MMG A;  1G3W A;  3NTH A;  3FGR A;  1JJ2 P;  3ERB A;  4HKE A;  3J80 E;  4LDX A;  2YXY A;  1XOV A;  3CBM A;  1Y57 A;  3M0T A;  2ZPF B;  1ZBJ A;  5CQY A;  4C0D C;  2PU9 B;  3VRY A;  3CC4 A;  3EFO B;  2NUP A;  1E5G A;  4RTT A;  3CXC A;  2KYB A;  4XTX A;  2AKL A;  4IGD A;  1MHN A;  2HBW A;  1B34 B;  3N5B B;  2LP5 A;  2CS7 A;  4PJO G;  4C8Q E;  1IB8 A;  2O9S A;  1M90 U;  4WTO B;  3CMA T;  4X1V A;  2KRI A;  4M7A C;  2LNH B;  5KYX B;  4RTX A;  4C5E A;  2DTH A;  2EBP A;  4BB7 A;  4C8Q C;  2CP5 A;  1YIJ A;  2JTF A;  5FU7 C;  3JB9 G;  2COZ A;  1WFW A;  1D0Z A;  2K7A A;  1WYX A;  1VQ6 Q;  2K5L A;  5CKH A;  1SRZ A;  2KAF A;  1NBE B;  3I9Q A;  4MZP A;  4M7A A;  4XAX B;  2GQI A;  3R6O A;  4J9D A;  2DA9 A;  2MI6 A;  5J39 A;  2XWJ I;  1YIT A;  1Y7X A;  4NS5 A;  4C92 G;  3FB9 A;  5GAN h;  4FIB A;  4FT4 A;  3CC7 Q;  2FRW A;  2VWF A;  3TEE A;  4KGZ B;  3PNW C;  2ZGW A;  2WSF E;  2ZPH B;  1BIA A;  3JB9 J;  2LCL A;  5KYN A;  1PSF A;  1VQL Q;  2X3W D;  4J7F A;  2QXF A;  1GL5 A;  5LJ3 f;  2CG7 A;  2HQH A;  2X4W A;  2NWM A;  4PFO A;  1Q3X A;  3X20 B;  4MUC A;  4KGV B;  3PFS A;  2RJE A;  4J6X A;  4MZM A;  4M75 B;  2ZPI B;  4PO7 A;  1XQH A;  4OB2 B;  3OBY A;  1H04 P;  5A2Q E;  2OTJ Q;  3VKI A;  1GRI A;  3NFC A;  4A54 A;  2EYZ A;  2KT1 A;  2HCK A;  2QA4 Q;  4APL A;  2GNC A;  2WSE E;  3CCU Q;  1GBR A;  3GP8 A;  4LOS A;  2RB6 A;  1PD0 A;  4R56 A;  2F2W A;  4RG8 A;  3L2W A;  1QWF A;  2JRA A;  3IQL A;  1B7T A;  4IIM A;  5IHK A;  4CC7 A;  2OTL A;  1RAC B;  3LWH A;  1B3Q A;  1TSF A;  3BE3 A;  4AMC A;  2RNA A;  1Y96 A;  1UHF A;  4AG2 C;  2DYB A;  5GMK j;  3T5O A;  2D0N A;  2MMP A;  3ZD1 A;  2HEQ A;  3QO3 A;  1OJW A;  3VS3 A;  5I2S A;  2AKK A;  3CQT A;  2VAS A;  2YRA A;  2H3J A;  2CZ7 B;  2NUP B;  1LJO A;  1UE9 A;  3GPL A;  3TQ7 P;  3WVD B;  3F70 A;  3OYH A;  4E7K A;  2L0A A;  2YDL A;  1ZJK A;  2KSS A;  1D0Y A;  1RL2 A;  3WSX A;  3MQL A;  2QY0 A;  2EYW A;  3REA B;  4HT9 A;  1VQM Q;  1RAB B;  2ROL A;  3EAE A;  3L2V A;  3C94 A;  4XTU A;  3GOX A;  1FBR A;  2NLU A;  1YWP A;  1UJ0 A;  3FIF A;  4M75 G;  4DA4 A;  4IUT A;  2K3X A;  1YHQ Q;  2JOY A;  1H3Z A;  4F17 A;  1VQO T;  1OPL A;  2BE9 B;  3UF4 A;  4HT8 A;  1M9S A;  5EG2 A;  2L3Q A;  1FWZ A;  2YUN A;  4RTZ A;  2YHT A;  4Z89 A;  4PJO D;  1AVZ C;  1BK2 A;  2YT6 A;  2CGH A;  4KBM B;  5FU6 B;  1SRM A;  5ECA A;  4PZ5 A;  3EG2 A;  2EW3 A;  2Y8R A;  1J3T A;  1UHC A;  1GBQ A;  3I56 Q;  2DXT A;  1E88 A;  1M90 C;  4M7D E;  4KUL A;  2XIC A;  4LDU A;  5DN5 A;  4FL6 A;  1M1K R;  2RD1 A;  4AYD A;  2XQW C;  2CP0 A;  3CCL T;  2DL7 A;  2E3I A;  4M7D C;  3HSB A;  1JRI A;  3TSW A;  5HYT B;  3CC4 Q;  2YUQ A;  8AT1 B;  2LQW A;  1W2B S;  4R55 A;  3RER A;  4EIK A;  1H2P P;  3E19 A;  1NPR A;  4N7E A;  4C92 D;  4CC4 B;  2KI7 A;  3CPW P;  2DXU A;  2X9H A;  3OS0 A;  3VS0 A;  4JRK A;  2X4J A;  1Z9Q A;  4BY6 C;  2X51 A;  4LDW A;  1KG1 A;  5HYP A;  2JMC A;  4E2F B;  1YIJ Q;  1RLH A;  1YJ9 A;  5AYF A;  2BIV A;  3A98 A;  3PGG A;  4PL6 A;  4VUB A;  5GAN f;  2KNB B;  5KYY A;  2O4X A;  2C0I A;  3JCM e;  5GAN 5;  2Y8S A;  4M7A G;  1EX4 A;  3ZRZ A;  3LH0 A;  2X4X A;  3EHQ A;  1QP3 A;  3J81 E;  2SEM A;  3EH2 A;  4BWC A;  1UB4 A;  1TXQ A;  2QAS A;  4OMP A;  1EIF A;  2XU8 A;  1Y96 B;  3JCM Q;  1TWB A;  2KY9 A;  4FCY A;  2AT1 B;  1Q81 U;  1YIT Q;  2CT4 A;  3ZLE A;  4C5H A;  2QGG A;  2CP7 A;  3ZFJ A;  1RLP C;  1OUL A;  2HSP A;  2QQS A;  4PFP A;  4QVD A;  2COW A;  5CR2 A;  2E6Z A;  3LGF A;  3T9N A;  1RLQ C;  5HKC A;  2J6K A;  3M54 A;  4RTY A;  1JQQ A;  4B2S A;  3LYI A;  1NJI U;  1V76 A;  1SPK A;  3NTK A;  1WIE A;  5CO7 A;  1QCN A;  3JCM J;  3MP8 A;  2AIR B;  2IVW A;  4JZ4 A;  2ZZD A;  1HXD A;  3VRZ A;  5HY6 A;  2ENM A;  3H0H A;  1VQN T;  3NTI A;  6AT1 B;  4JDS A;  4QT7 A;  4J6W A;  3INZ A;  2OI3 A;  2EYY A;  3PIP A;  4A53 A;  2EKH A;  1VQP A;  4PJO E;  4ZN1 A;  2RJC A;  3MJX A;  4DBQ A;  1Q81 R;  3RES A;  1WPY A;  3AT1 B;  1UGR B;  4M75 D;  2BZ8 A;  2DXB A;  3QXE B;  2E41 A;  4JJN K;  3OS2 A;  4BI3 A;  5CIU A;  5FWB A;  1D3B A;  4M78 A;  4PJO C;  2OTL Q;  2RQW A;  1MD8 A;  2YSQ A;  3OW2 A;  3JV3 A;  2BZM A;  2RA2 A;  3CCJ T;  4A4E A;  1N27 A;  1UJY A;  2LCS A;  1NJI R;  1WHL A;  2ZCF B;  2DMO A;  2KBT A;  2RI3 A;  2NUZ A;  3JCM h;  3QZ9 B;  2DBK A;  2YRV A;  2QEX A;  2R58 A;  3ZL7 C;  1K73 U;  3OYB A;  3S6W A;  4OB3 B;  2DF6 A;  3I55 T;  1YI2 T;  1ZA2 B;  1T0J A;  2GFU A;  4Y28 E;  4ELY C;  4IUU A;  5GMK m;  2L89 A;  4HCK A;  3UT1 A;  3PVL A;  4EMK A;  2MOX A;  4BD3 A;  8ATC B;  3CAL A;  3VV0 A;  3QPH A;  1F1B B;  3M53 A;  1KQS A;  1D1C A;  5CKD A;  2VYT A;  4AFU C;  5HK0 A;  5LJ3 j;  3V8K A;  4C92 E;  2C0T A;  2XD0 A;  2BZY A;  3PE0 A;  2V8J A;  2DD5 A;  2RN8 A;  2EIF A;  3G7Z A;  3QJY A;  2K5I A;  4DOV A;  2FB7 A;  4FU6 A;  2AZV A;  1MMN A;  3FC3 A;  5KCH A;  4M77 A;  1QVF P;  4C92 C;  1OK3 A;  2CP6 A;  2XDP A;  1TPN A;  3BW1 A;  4F7U A;  1OOT A;  1QVP A;  2H8H A;  1S1N A;  4FSX A;  3CEY A;  4M7A F;  3AHU A;  1Q86 U;  2EC3 A;  2VXE A;  2M02 A;  3UA6 A;  1NLO C;  2ED0 A;  1JB0 E;  2FZG B;  3RMQ A;  4PLI A;  4C8Q F;  4C5G A;  1K73 R;  4D8D A;  3M4G A;  3LGL A;  1ARK A;  1ELV A;  1I81 A;  2QQA A;  4Z88 A;  1K0S A;  2EQJ A;  3A8O B;  1WNL A;  2HKN A;  4M7A D;  2YBY A;  1PWT A;  3EFO A;  4HVV A;  2PVO B;  2HMA A;  3A8M B;  4C8Q D;  1HFH A;  5CKE A;  2ERJ A;  2IZ4 A;  3OB9 A;  2DJZ A;  1M5Q 1;  5FRM A;  4J9E A;  1JJ2 A;  2DXC A;  2L2P A;  1SF9 A;  1I8F A;  1WZO A;  3X26 B;  1H3H A;  2YUO A;  4A5W B;  3C12 A;  1VQK T;  3L2Q A;  4JRQ A;  4D6W A;  3TU4 K;  3CXC S;  7AT1 B;  1UGP B;  1OU9 A;  2FZC B;  3CMA A;  1X43 A;  1JXM A;  3QBY A;  2MCN A;  4XTY A;  1YJ9 Q;  5L23 A;  1MNE A;  3CCV T;  1QVG A;  4RTV A;  2XG8 D;  4XU1 A;  1G2B A;  2RHU A;  1W2B P;  1D3B B;  4M78 B;  1YJN T;  4M75 E;  2ATC B;  3GXE A;  2J7I A;  4Z8A A;  2F2V A;  1NJI C;  3ZD2 A;  4RCC A;  2RKZ A;  3CD6 T;  1G8X A;  1KHI A;  4J9I A;  3V7R A;  2LX9 A;  3S3M A;  4M75 C;  1PNJ A;  4MDW A;  1I4K 1;  3I5S A;  5I11 A;  2CP2 A;  2IIM A;  2IG0 A;  4RCB A;  3TRE A;  4B9W A;  2FPD A;  3IU3 I;  1VQM A;  4LXC A;  3MET A;  2DJQ A;  4YTL A;  5FO8 C;  5DN4 A;  1GKG A;  2JTE A;  2YWW A;  1TUD A;  3WXM B;  4N4H A;  1IHW A;  2EHF A;  5KYU A;  1EZZ B;  1YFN A;  2PUK B;  2XI9 A;  5C0M A;  5GAN d;  4E7S A;  2FYK A;  2JS0 A;  3RNJ A;  1GFD A;  5CAI A;  2V8I A;  1BI2 A;  3QJ6 A;  5J26 A;  3OYA A;  1E6G A;  1MV3 A;  1ZLM A;  4ZH1 D;  4M77 B;  3HP9 A;  1VQ4 A;  1WJS A;  2DE0 X;  1RI0 A;  2PZ1 A;  5GAM g;  4LD6 A;  4PFZ A;  3GIB A;  1FXX A;  3M0S A;  3JRZ A;  1TTH B;  1UGV A;  3RKY A;  1VQP Q;  5IAY A;  3G71 T;  3CCR T;  1M4Z A;  4F7U B;  1OK1 A;  1NEG A;  4ZN3 A;  3JCM f;  1VQ9 T;  1NE8 A;  3I56 A;  5GAN j;  3QUI A;  1IGQ A;  1BI1 A;  3CPW S;  2DAQ A;  2HNI A;  2CP3 A;  4DOW A;  1U5M A;  4F16 A;  4ZTJ A;  1MMA A;  4PLL A;  4XU0 A;  2JN0 A;  1OK9 A;  4IKF A;  3ZEH A;  1Q95 G;  1ZUK A;  3MEA A;  2F1L A;  4MML A;  4K12 A;  1VVD A;  4M7A E;  1BI3 A;  4WF2 A;  4J38 B;  3HPW A;  2A55 A;  2QEX Q;  2RI5 A;  4WJG 2;  1KQ1 A;  2KQW A;  5FU6 C;  2MF2 A;  4EMH A;  1RAF B;  4RG2 A;  4J9F A;  3VYH B;  2DYI A;  4OML A;  1M3B A;  1QKW A;  1OV3 A;  1Q86 C;  3G6E T;  3PMI A;  1OZ2 A;  2X2Z A;  2LC4 A;  4M77 G;  2KK4 A;  1K9A A;  1FYN A;  1YJW Q;  4M7D F;  3G4S A;  4OMN A;  2CUB A;  3SDZ A;  1QQJ A;  2J05 A;  2JJ9 A;  4ZTF A;  3MEW A;  2ESW A;  3CCE T;  1VIE A;  1IXD A;  3H0F A;  2QK0 A;  4J9H A;  4F7U G;  1TPM A;  2HL5 C;  4GBQ A;  1H8K A;  2IPO B;  2ZPG B;  2LJ3 A;  1ZSZ A;  2E5Q A;  4EPC A;  4M7D D;  2M1H A;  2D1X A;  1YCY A;  3L42 A;  1VOM A;  2R5M A;  2DIG A;  1HCC A;  3MEV A;  3NPF A;  1YWO A;  2JVV A;  4CI0 C;  3HRU A;  3NFP I;  1Y0M A;  2K5F A;  1WGS A;  1G3S A;  4ELZ C;  1M90 R;  1CKA A;  1CKB A;  4LD9 K;  4FYV B;  3X25 B;  1AWO A;  3OQ5 A;  2KRN A;  1VQ7 T;  1FMK A;  2AK5 A;  1ZSG A;  4OMQ A;  3RKX A;  4XQ3 A;  3OXU D;  2P4T A;  1O9A A;  5D6W A;  3KUF A;  1BBZ A;  4HCZ A;  2QQ9 A;  3FDR A;  3CCL A;  1TH7 A;  5KYU B;  1AEY A;  2XRD A;  4CSY A;  1E8B A;  2E10 A;  1Z9Z A;  1N8R U;  1WX6 A;  3CCM T;  2RQR A;  3SFM A;  2EJ9 A;  2ZPB B;  4J9B A;  3CMA Q;  1NG2 A;  1W1F A;  2RH2 A;  1PHT A;  3VS2 A;  2HQX A;  2PVG B;  5KH6 A;  1GCQ A;  1IO6 A;  2HQE A;  3NMZ C;  3RDV A;  1WHJ A;  1MD7 A;  4CC3 A;  3C0C A;  3OYI A;  2ZYC A;  2EVR A;  1BIB A;  3M0P A;  1I5L A;  2ABL A;  3REB B;  1RAA B;  3FLG A;  3M56 A;  1KC8 C;  2G3R A;  3FJP A;  3OYK A;  3CXC P;  2LCC A;  2BZX A;  1SSH A;  2WAC A;  3M9Q A;  5A0D A;  2EGE A;  2D6F A;  1QVF S;  1Z92 B;  5FRO A;  2VV5 A;  2LT4 A;  1PKS A;  1QLY A;  3JCM c;  3CBP A;  1M2V A;  2CT3 A;  4F14 A;  2OJ2 A;  2C0O A;  3VUZ A;  2GTO A;  4Y91 A;  1N8R R;  1WA7 A;  4J5Y A;  2EJG A;  4PJO F;  2J06 A;  3OMC A;  3M7P A;  3IX0 A;  1XTD A;  4N0A A;  1HD3 A;  2V1R A;  3CME T;  2CKU A;  5I21 A;  2E65 A;  1S72 T;  2NYS A;  3CI0 J;  1D0X A;  2MWO A;  5GAM f;  5DM7 R;  2B8A A;  5CQX A;  1VQ4 Q;  4KH0 B;  1HSQ A;  1NLP C;  1N5Z A;  2GGR A;  1XNI A;  3JB9 F;  3EG0 A;  1M8M A;  3VS6 A;  1ZSZ B;  1VQN A;  1OI1 A;  3PIO A;  4JLG A;  2OAU A;  3FRN A;  1IRE B;  2NUT B;  2LDM A;  4IUQ A;  2DIL A;  2ECZ A;  1H92 A;  2V26 A;  4JJD A;  3JB9 D;  2Y4X A;  2JUF A;  5IN1 A;  4NL2 A;  4FSS A;  3MHX A;  1BYM A;  3EH1 A;  2QAZ A;  4C92 F;  4JZ3 A;  1YCS B;  4YNX A;  4DQ2 A;  3OYE A;  1RAH B;  3CCJ A;  2LRQ A;  1QCF A;  1WLP B;  2FVU A;  1OX8 A;  4JJC A;  1ZUY A;  3PMT A;  2AHJ B;  1PRM C;  4ANJ A;  5M9O A;  4FM4 B;  5IH2 A;  3I55 A;  2LOJ A;  1YI2 A;  4FXG G;  3EG9 B;  3JCM d;  2KRS A;  5DLO A;  1B07 A;  3G4S Q;  2FPE A;  5HK3 A;  3DLM A;  2B5I D;  4FW1 A;  3HFO A;  1I0C A;  4DJZ A;  4PNO A;  4EMG A;  4BI8 B;  2RMO A;  2K57 A;  2XMF A;  3KXT A;  2X3X D;  1WXT A;  1C0M A;  1AOJ A;  4A4K A;  2HZY A;  2RO0 A;  4XU3 A;  1IRX A;  4QVZ A;  1KJW A;  3QZ5 B;  2VC8 A;  2KMS A;  4A4H A;  1TU0 B;  2RHZ A;  1M2V B;  2E64 A;  2VGM A;  1N8R C;  1PPQ A;  3OSV A;  2LVM A;  2XDD A;  2L3R A;  3ME9 A;  2QTV A;  2KGT A;  1UFF A;  3M59 A;  4LOT A;  1UGS B;  3OBW A;  3M57 A;  4M78 E;  2EKO A;  2EAY A;  2FHD A;  3ULR B;  2CYZ B;  3EFR A;  4PJJ A;  3CCL Q;  1HJD A;  2W10 A;  3SHW A;  1UEC A;  4M78 C;  5IHN A;  3INB C;  1QMC A;  3VS4 A;  2E6N A;  1Q82 U;  2BUD A;  4M75 F;  2UWN A;  3RBB B;  2FPF A;  3DKM A;  2PUO B;  3RJ3 D;  1T3S A;  2W81 A;  4C0G A;  5FRN A;  2Y8T A;  4BE1 A;  3P8D A;  2C06 A;  1VQK A;  1AD5 A;  2CUD A;  2DX1 A;  3L1A A;  1NYF A;  3KXV A;  2RQT A;  2XRB A;  1R77 A;  2CZ0 B;  3OYC A;  2E5K A;  3GNF B;  4QQD A;  3SD4 A;  4E7H A;  3M5A A;  4ZNX A;  4EMK C;  3M0R A;  2DVE A;  5GAN 7;  2RHX A;  3CBO A;  4QVC A;  1M27 C;  4M77 E;  1GKN A;  1BB9 A;  2LZ6 B;  1G4G A;  2KT8 A;  5LJ3 d;  2KRM A;  4JJB A;  3X24 B;  2OAW A;  2GF7 A;  4LDV A;  2YRC A;  1QVG S;  2FO0 A;  1X69 A;  3I5R A;  3S3N A;  2I0N A;  1N9R A;  2L5Q A;  4F7U E;  3WVE B;  4M77 C;  2DBM A;  3GLX A;  4BDY A;  1NWV A;  3OYY A;  1HK9 A;  2DIQ A;  3OS5 A;  1T3L A;  2RM4 A;  3MP6 A;  4ME7 A;  1VQ8 T;  4QKU A;  2EPD A;  2DTI A;  3EGU A;  1VQ5 T;  4XTV A;  1PRL C;  1SRL A;  2DL4 A;  2EFI A;  4XU2 A;  1WHH A;  3CCS T;  1BI0 A;  3HFN A;  1YJW A;  2A7Y A;  4L59 A;  4E6R A;  1KIK A;  5LJ5 e;  3VUB A;  2QQB A;  1M1F A;  1XJW B;  1DJ7 B;  4E7L A;  1LNX A;  2FL7 A;  2DEQ A;  2PVD B;  4E7I A;  1K9M U;  2EQI A;  2O39 C;  4N4G A;  1VQN Q;  3EGX A;  2YLC A;  2X35 A;  2DM1 A;  3RIR A;  1MMD A;  4OP0 A;  4C16 A;  2XDB A;  3G71 A;  3CCR A;  1TPG A;  3BY7 A;  3O5Z A;  4JRP A;  5LL6 S;  3KFV A;  1VQ9 A;  1QP2 A;  2RPN A;  1V29 B;  2Y90 A;  1GCP A;  1D1A A;  5D6Y A;  4OB1 B;  1NEB A;  2I2L A;  4BDZ A;  1G5V A;  2EYX A;  3HTR A;  2L8D A;  3S3O A;  3CCJ Q;  2DL8 A;  3K3T A;  3CC2 T;  1C6V X;  1WI7 A;  1U1S A;  5DLQ E;  2DER A;  4BAC A;  1M30 A;  2QDY B;  4MMK A;  1EFN A;  5D6X A;  1CSK A;  1X2Q A;  5GAM e;  2MCY A;  5KE3 A;  3I55 Q;  2WII C;  1YI2 Q;  2MWP A;  1Q86 R;  2BE7 D;  2IZ3 A;  4JPB W;  1I5O B;  5CKB A;  5LJ5 g;  3G6E A;  4JLI A;  2BTT A;  3MCA B;  3CCQ T;  1HYO A;  2O88 A;  1KD1 U;  4N4I A;  2GQV A;  4V2S A;  1GXI E;  2RI2 A;  1U06 A;  3A1P A;  1QO6 A;  3CCE A;  3QG1 A;  4P5N A;  2LTO A;  3VU3 C;  1H64 1;  2RKY A;  5LJ5 h;  2FRY A;  4LDY A;  3E9G A;  3LWI A;  3RUX A;  1LY2 A;  1VA7 A;  3HRS A;  5FWC A;  2KXD A;  2KDS A;  1Q82 C;  3EGD A;  1JBM A;  3VWO A;  4OB0 B;  3OYN A;  3VYG A;  3F6K A;  2LMJ A;  1AZG B;  4GY5 A;  1UTI A;  3J7A F;  3ZLD A;  1KC8 U;  2LJ1 A;  4HCB A;  4NOY A;  3R62 A;  4X9C A;  3OYF A;  3RMS A;  4AYI A;  5GAO m;  5HCK A;  2LQK A;  2X4Y A;  3LLR A;  5GAO l;  4B9X A;  2L3S A;  1PC0 A;  2A28 A;  4NL3 A;  1JU5 C;  4PJO B;  9ATC B;  2KRO A;  3V8L A;  1Y07 A;  4C5I A;  1BCO A;  1VQ6 T;  5CVI A;  1NM7 A;  4XTZ A;  1M1G A;  1VQK Q;  1OU8 A;  2V1Q A;  3G1J A;  2OX7 A;  1IHV A;  3EGX B;  4M78 G;  3CCM A;  2JM8 A;  2D8J A;  2EWN A;  5GAM h;  3A5Z B;  1OK2 A;  1X2K A;  3NJA A;  1SKU B;  3RR6 A;  4MDX A;  3FEO A;  4UC4 A;  4OMO A;  3CCV Q;  3CC7 T;  1RUW A;  5GJV B;  1QUB A;  4QW2 A;  3PT9 A;  1OJY A;  3E9F A;  3EG1 A;  4JUV A;  5GMK i;  1K8A U;  1YJN Q;  1KC8 R;  2JW4 A;  5GAN 3;  3SWN A;  5I2M A;  1VQL T;  4BUG A;  1VYT A;  3FGT A;  3CD6 Q;  1H2Q P;  1O75 A;  2A08 A;  3H9N A;  2DFU A;  2FG0 A;  2HBP A;  4A63 B;  4C92 B;  3V8J A;  1ZSZ C;  1HFI A;  1K9M C;  4PJN A;  5C6S A;  2FEI A;  2DKG A;  2ED1 A;  4KUI A;  2XID A;  4M4Z A;  2GBQ A;  2E3H A;  2OTJ T;  2JGX A;  2VXF A;  1KHC A;  1QVG P;  4RTU A;  1KK7 A;  2QA4 T;  4J9G A;  3SB2 A;  1K4U S;  4Z02 A;  3CCU T;  2MPX C;  2EQM A;  2DD4 A;  1ACM B;  4J9C A;  4DEX A;  1VQO A;  4HA8 A;  2QYZ A;  3CME A;  4IUV A;  4MSL A;  3JCM b;  1S72 A;  3LW5 E;  3HRT A;  2YUP A;  1V1C A;  4E47 A;  2RQU A;  1K8A R;  3H8Z A;  5IHI A;  2VUB A;  2NUT A;  3M58 A;  3QYH B;  2K2M A;  4AYM A;  1AWW A;  3G71 Q;  3CCR Q;  2V8K A;  5GAN g;  3R6N A;  4C0Z A;  2VB6 A;  3EGD B;  4Y92 A;  5GAN 4;  1ZQ1 A;  1VQ9 Q;  2HKQ B;  3TSZ A;  4PKC C;  1ZHI A;  2F69 A;  2LT1 A;  4BE0 A;  4C8Q A;  3VS7 A;  4J83 A;  4FYW B;  1GCQ C;  1VQM T;  2M0O A;  1AT1 B;  2F2X A;  3OYJ A;  2K79 A;  2HL3 A;  3TCJ A;  5L8R E;  2JS2 A;  2MIO A;  1LVK A;  2CZ1 B;  1YHQ T;  1KD1 C;  2O9V A;  3I35 A;  2B86 A;  2COY A;  1QWE A;  1A0N B;  3QHS A;  3PVQ A;  3EG9 A;  5AT1 B;  5KE2 A;  3L2R A;  2XHC A;  4XTW A;  1VQ4 T;  3FJ5 A;  5LJ5 f;  2LX7 A;  4II1 A;  4GLK A;  5GAN 8;  3M4Y A;  3OYD A;  1AWX A;  3G6E Q;  1VIF A;  5A0G A;  4RUG A;  1SHF A;  1RAG B;  3CPW A;  5GAO n;  3X28 B;  1VUB A;  4JRI A;  3KZJ A;  1OZ3 A;  1JO8 A;  2E70 A;  3UAT A;  3I56 T;  1C1Z A;  2CH4 W;  2Z0W A;  5HYU B;  4LE9 A;  4M78 F;  5A0L A;  1M3A A;  1WQW A;  4AFZ C;  3A8H B;  1VYV A;  4C0F A;  3CCE Q;  2GCX A;  1U3O A;  2P0K A;  3EHR A;  4N0A C;  1ZX6 A;  3DLL A;  5GMK e;  1MV0 B;  2VVK A;  4KUD K;  2Y4Y A;  3ER0 A;  3QII A;  2P84 A;  2D8H A;  2V8E A;  3CC4 T;  3JSC A;  4FT2 A;  4KGX B;  2LJ0 A;  3SWN B;  4M78 D;  2E12 A;  1IZ6 A;  1WHK A;  1QW1 A;  4ZGE B;  1QKX A;  2YRD A;  1RAI B;  3M0U A;  4DBH A;  2CG6 A;  4A4F A;  1GFC A;  3KBG A;  3HL8 A;  1K1Z A;  5CK9 A;  2G6F X;  1ABQ A;  1UG1 A;  2EYQ A;  4J8O A;  1JEG A;  2HD0 A;  3D7S B;  1VQ7 Q;  1X75 C;  2VKN A;  1M1K U;  1LPL A;  2CRE A;  1NZ9 A;  1YIJ T;  4QQ6 A;  2K6D A;  1QCO A;  3G4S T;  4M77 F;  4HVU A;  1OJV A;  3UA7 A;  2SRC A;  1YNZ A;  4JS5 A;  1M2O A;  2J6O A;  3M55 A;  1K8A C;  3JCM P;  4C0D B;  4F7U F;  4IUR A;  4RMO A;  2ZPE B;  2J6F A;  1C1A A;  2F5T X;  2L3P A;  2P0Q A;  3QDR B;  3CCM Q;  1Q7Y U;  3JCM V;  4M77 D;  1H03 P;  5KYW A;  3MO8 A;  3OYL A;  2DVJ A;  4KKD A;  3HHT B;  1YIT T;  4HVW A;  3OS1 A;  2RJF A;  1WDX A;  3CPF A;  1I07 A; 
#chains in the Genus database with same CATH homology
 4M7A B;  5LJ3 d;  3X24 B;  2MI6 A;  1KHI A;  5J39 A;  2GF7 A;  3V7R A;  4LDV A;  1QVG S;  1YIT A;  2LX9 A;  1Y7X A;  3S3M A;  4C8Q B;  3S3N A;  1N9R A;  2L5Q A;  4M75 C;  4F7U E;  4NS5 A;  4C92 G;  3FB9 A;  3WVE B;  4M77 C;  4FIB A;  3GLX A;  4FT4 A;  4MDW A;  1I4K 1;  5GAN h;  4BDY A;  3LX7 A;  3OYY A;  3TEE A;  3OW2 S;  5FU7 B;  3PNW C;  1HK9 A;  2YLB A;  2DIQ A;  2ZGW A;  2DK3 A;  2IG0 A;  3OS5 A;  2WSF E;  2RM4 A;  4RCB A;  3MP6 A;  3TRE A;  2ZPH B;  4ME7 A;  4B9W A;  1VQ8 T;  1BIA A;  1VQM A;  3JB9 J;  2LCL A;  2K4Y A;  2DTI A;  2QI2 A;  1VQ5 T;  1PSF A;  3MET A;  4XTV A;  5GMK h;  4A4G A;  2LNV A;  4J7F A;  2K3Y A;  2QXF A;  1AHJ B;  2EFI A;  2JTM A;  5LJ3 f;  4XU2 A;  1N6A A;  4YTL A;  3CCS T;  3WXM B;  1BI0 A;  4N4H A;  1VQ8 A;  4TVR A;  2X4W A;  3HFN A;  2PUK B;  2XI9 A;  5C0M A;  1YJW A;  2A7Y A;  5GAN d;  4KT0 E;  3X20 B;  1VQ5 A;  3MEU A;  4L59 A;  3PFS A;  2FYK A;  2RJE A;  5LJ5 e;  3C4S A;  4J6X A;  5CAI A;  2V8I A;  4M75 B;  1BI2 A;  4MZM A;  2ZPI B;  3QJ6 A;  4XK8 E;  1N9S A;  5J26 A;  3VUB A;  3OYA A;  4PO7 A;  4M77 B;  3UDC A;  2QQB A;  1XQH A;  3HP9 A;  3CCS A;  1KQS S;  1VQ4 A;  1U1T A;  1M1F A;  4OB2 B;  1WJS A;  3OBY A;  5A2Q E;  3VKI A;  1RI0 A;  4X34 A;  5GAM g;  1DJ7 B;  4LD6 A;  4E7L A;  3GIB A;  1LNX A;  1FXX A;  3JRZ A;  3NFC A;  4A54 A;  3O8V A;  2FL7 A;  4M7D A;  2DEQ A;  2PVD B;  4E7I A;  4APL A;  3RKY A;  2EQK A;  1K9M U;  2WSE E;  5IAY A;  3G71 T;  3CCR T;  1M4Z A;  4F7U B;  2OTL T;  4N4G A;  4E7J A;  2YLC A;  2R5A A;  2X35 A;  4ZN3 A;  3GP8 A;  2RB6 A;  3JCM f;  2HAX A;  1G3T A;  1VQ9 T;  1NE8 A;  3RIR A;  3I56 A;  4R56 A;  3QUI A;  4OP0 A;  5GAN j;  1BI1 A;  2RJD A;  3CPW S;  2DAQ A;  2HNI A;  4RG8 A;  3L2W A;  1QVF A;  3QKJ A;  4DOW A;  2XDB A;  3G71 A;  3CCR A;  4OGE A;  2OTL A;  4BE2 A;  3LWH A;  3OA6 A;  3E1S A;  3JCM X;  3UPU A;  4ZTJ A;  4HCC A;  3BY7 A;  4PLL A;  4JRP A;  4ATO A;  3V7C A;  4XU0 A;  4C8Q G;  5LL6 S;  2JN0 A;  3JAM E;  4QQG A;  1Y96 A;  1VQ9 A;  1QP2 A;  5GMK j;  3ZEH A;  4IKF A;  1V29 B;  2MMP A;  3QO3 A;  2EJF A;  2Y90 A;  3MEA A;  5I2S A;  4Q5W A;  5D6Y A;  4MML A;  4OB1 B;  2I2L A;  4L6V 5;  4BDZ A;  5GAO r;  1G5V A;  2H3J A;  2L8D A;  2CZ7 B;  1LOJ A;  3S3O A;  1LJO A;  5CCA A;  1BI3 A;  4WF2 A;  3GPL A;  4M7A E;  3HPW A;  3WVD B;  1WJR A;  3F70 A;  2RI5 A;  1KQ1 A;  4OMF B;  2KQW A;  3OYH A;  4E7K A;  3CC2 T;  4J7I A;  5FU6 C;  2XKO C;  1U1S A;  2MF2 A;  5DLQ E;  4EMH A;  2KSS A;  4BAC A;  2F5K A;  4RG2 A;  1RL2 A;  3DB3 A;  3WSX A;  2QDY B;  4MZT A;  3VYH B;  2QQR A;  4HT9 A;  4MMK A;  5D6X A;  3EAE A;  3L2V A;  3C94 A;  3EFS A;  3GF5 A;  4XTU A;  5GAM e;  2CZ6 B;  1BKB A;  2NLU A;  3PTA A;  5KE3 A;  3G6E T;  3GOX A;  3PMI A;  1Q86 C;  3CC2 A;  1OZ2 A;  3FIF A;  4M75 G;  2X2Z A;  2MWP A;  2K3X A;  2LC4 A;  2JOY A;  3OMG A;  4IUT A;  4DA4 A;  1H3Z A;  4M77 G;  2KK4 A;  1VQO T;  4M7D F;  3G4S A;  3DB4 A;  3H6Z A;  3SDZ A;  4HT8 A;  1M9S A;  5EG2 A;  1JJ2 S;  1FWZ A;  4ZTF A;  3MEW A;  5CKB A;  1SSF A;  5LJ5 g;  2GFA A;  2YHT A;  3G6E A;  4JLI A;  3CCE T;  1VIE A;  4BI4 A;  4PJO D;  4F7U G;  1UGQ B;  2CGH A;  4KBM B;  2EQU A;  2DTO A;  3MCA B;  3CCQ T;  5FU6 B;  1X01 A;  1KD1 U;  4N4I A;  2GQV A;  3C95 A;  4ZGJ B;  4V2S A;  1GXI E;  2ZPG B;  3RKW A;  4EPC A;  2JNG A;  2E5Q A;  3CCV A;  4L5G A;  2RI2 A;  4M7D D;  3CCE A;  3QG1 A;  4P5N A;  1Y71 A;  2M1H A;  2LTO A;  3VU3 C;  3BDL A;  2Y8R A;  1H64 1;  3UWN A;  1FX7 A;  1YCY A;  5LJ5 h;  3L42 A;  4LDY A;  3E9G A;  2R5M A;  3LWI A;  2DIG A;  3RUX A;  3CCQ A;  3MEV A;  2DXT A;  1YJN A;  4CI0 C;  2JVV A;  1M1K C;  1M90 C;  4M7D E;  3HRS A;  3V7S A;  3HRU A;  4KUL A;  2XIC A;  2KDS A;  3MP1 A;  3JCM g;  1R8O B;  1Q82 C;  1M8V A;  4LDU A;  2K5F A;  1JBM A;  1WGS A;  4OVA A;  4FL6 A;  1G3S A;  3CD6 A;  4ELZ C;  5GAO q;  4OB0 B;  2RD1 A;  3OYN A;  1W2B A;  4LD9 K;  5DY9 A;  5GAO p;  3VYG A;  3CCL T;  3F6K A;  4M7D C;  3X25 B;  3P8H A;  3HSB A;  1JRI A;  3OQ5 A;  1VQ7 T;  3RKX A;  2MAM A;  5LJ5 d;  4GY5 A;  2P4T A;  4IUP A;  3BFM A;  4XQ3 A;  5D6W A;  1U8R A;  3KUF A;  3ZLD A;  3J7A F;  4HCZ A;  1Q7Y C;  1KC8 U;  2QQ9 A;  3FDR A;  3P8B B;  3CCL A;  4HCB A;  4NOY A;  1TH7 A;  5LJ3 e;  2D9T A;  1W2B S;  4R55 A;  3RER A;  3E19 A;  3HKS A;  4X9C A;  3OYF A;  3RMS A;  1NPR A;  4N7E A;  1MGQ A;  4C92 D;  5GAO m;  2LQK A;  2X4Y A;  3LLR A;  5GAO l;  2E10 A;  2DXU A;  5GMK l;  1YJ9 T;  4B9X A;  4PJO A;  3OS0 A;  1KQ2 A;  4NL3 A;  4PJO B;  1N8R U;  4JRK A;  3V8L A;  5GAN 6;  3CCM T;  1Y07 A;  2X4J A;  2D0Q B;  3SFM A;  4C5I A;  4BY6 C;  2EJ9 A;  2ZPB B;  4LDW A;  3OYG A;  1KG1 A;  2XK0 A;  1VQ6 T;  2BKD N;  5CVI A;  5LJ5 j;  4M7D B;  4XTZ A;  1M1G A;  2E1H A;  1YJ9 A;  2RH2 A;  5AYF A;  2BIV A;  2HQX A;  2PVG B;  3PGG A;  4CRI A;  4M78 G;  4PL6 A;  2HQE A;  4VUB A;  5KH6 A;  3CCM A;  5GAN f;  2O4X A;  3GNG A;  2EWN A;  5GAM h;  3A5Z B;  3JCM e;  2Y8S A;  5KCO A;  5GAN 5;  3NJA A;  1VQ6 A;  4M7A G;  3OYI A;  2O4X B;  3LH0 A;  4OGC A;  2X4X A;  5IT9 E;  3FEO A;  1QP3 A;  1P92 A;  4UC4 A;  4RKU E;  3J81 E;  4MDX A;  4BWC A;  1UB4 A;  1BIB A;  2K2V A;  1O9S A;  1I5L A;  3CC7 T;  4X9D A;  1EIF A;  2XU8 A;  3FLG A;  3M56 A;  1Y96 B;  2DPP B;  4QW2 A;  3JCM Q;  1KC8 C;  2G3R A;  4OF1 A;  2KY9 A;  3FJP A;  3BDU A;  3OYK A;  3PT9 A;  2LCC A;  4JUV A;  2CKK A;  3E9F A;  1Q81 U;  3ZLE A;  2WAC A;  3M9Q A;  4BY6 B;  4C5H A;  5A0D A;  5GMK i;  1K8A U;  1QVF S;  2D6F A;  5FRO A;  2VV5 A;  3JCM W;  5GAN 3;  2LT4 A;  3SWN A;  5I2M A;  3CC7 A;  4BUG A;  1VQL T;  3JCM c;  3CBP A;  3ZFJ A;  3FGT A;  5GAM d;  2QQS A;  2A3L A;  4QVD A;  1O75 A;  2R57 A;  4C92 A;  5CR2 A;  2HBP A;  3VUZ A;  2E6Z A;  3LGF A;  3T9N A;  4Y91 A;  5HKC A;  4C92 B;  2RK1 A;  3V8J A;  3M54 A;  4J5Y A;  1K9M C;  1VQL A;  5C6S A;  2EJG A;  5FLX E;  3LYI A;  4PJO F;  3OMC A;  2DKG A;  4KUI A;  1NJI U;  2XID A;  1B34 A;  3NTK A;  1NPP A;  4ZGD B;  5CO7 A;  1XTD A;  3Q1J A;  2OTJ T;  3VJP A;  3JCM J;  4N0A A;  5LJ3 g;  3MP8 A;  2VXF A;  3CME T;  2IVW A;  1KHC A;  1ZBX A;  2ZZD A;  2QA4 T;  5I21 A;  5CKF A;  2E65 A;  4EDU A;  5GAM j;  1HXD A;  2MWO A;  3SB2 A;  5GAM f;  1VQP T;  5HY6 A;  4O6J A;  4J6Y A;  1S72 T;  2P0P A;  4Z02 A;  1VQN T;  3CCU T;  5DM7 R;  2B8A A;  3NTI A;  1PSE A;  2DD4 A;  2EQM A;  5CQX A;  4M7D G;  2OTJ A;  1WQ7 A;  4HA8 A;  1VQO A;  1XNI A;  4JDS A;  3JB9 F;  3CME A;  3QSU A;  4IUV A;  4MSL A;  3INZ A;  4J6W A;  1Q81 C;  3JCM b;  3PIP A;  4A53 A;  2QA4 A;  5LJ3 h;  1VQP A;  1S72 A;  4PJO E;  3LW5 E;  4ZN1 A;  2RJC A;  2RHI A;  1VQN A;  2VGN A;  1OI1 A;  3HRT A;  3CCU A;  3URG A;  3PIO A;  3RES A;  1WPY A;  2PQW A;  3ASK A;  4JLG A;  4E47 A;  1UGR B;  2OAU A;  2VUB A;  3H8Z A;  2O01 E;  3M58 A;  3QYH B;  4M75 D;  2DXB A;  3QXE B;  4JJN K;  2E41 A;  3FRN A;  3OS2 A;  1IRE B;  4BI3 A;  2LDM A;  4IUQ A;  1WJQ A;  5CIU A;  1D3B A;  4M78 A;  4PJO C;  2V8K A;  5GAN g;  3JB9 D;  2Y4X A;  4C0Z A;  2JUF A;  3OW2 A;  1X6O A;  5IN1 A;  5GAN 4;  2RA2 A;  3OY9 A;  1ZQ1 A;  2KVQ G;  4NL2 A;  3CCJ T;  3MHX A;  2QEX T;  4A4E A;  1BYM A;  1G3Y A;  4C92 F;  1N27 A;  3JB9 H;  4PKC C;  4DQ2 A;  1ZHI A;  3OYE A;  2F69 A;  2LT1 A;  4BE0 A;  4C8Q A;  1OYX A;  4J83 A;  2ZCF B;  2RI3 A;  3JCM h;  3QZ9 B;  1VQM T;  3CCJ A;  2YRV A;  2M0O A;  2R58 A;  3A8L B;  2QEX A;  1K73 U;  3OYB A;  3OYJ A;  3S6W A;  4OB3 B;  3I55 T;  5GAN 2;  1UEB A;  2LRQ A;  2KMT A;  2M16 A;  3TCJ A;  5L8R E;  1VQ7 A;  1YI2 T;  1W4S A;  2GFU A;  2DO3 A;  2CZ1 B;  1YHQ T;  4Y28 E;  4ELY C;  1KD1 C;  4IUU A;  5GMK m;  3L2U A;  2L89 A;  2FVU A;  4O5V A;  3UT1 A;  1YBY A;  4EMK A;  1YJW T;  4BD3 A;  3PMT A;  3VV0 A;  4EMK B;  3QHS A;  2AHJ B;  3M53 A;  3QPH A;  2JZ2 A;  2DZC A;  5CKD A;  1KQS A;  2VYT A;  5M9O A;  4FM4 B;  5HK0 A;  3OYM A;  5LJ3 j;  3I55 A;  3V8K A;  4C92 E;  1YI2 A;  3ZBD A;  2XD0 A;  5KE2 A;  3L2R A;  1YHQ A;  2XHC A;  4XTW A;  1VQ4 T;  4JS4 A;  3JCM d;  2RK2 A;  2V8J A;  2DD5 A;  5LJ5 f;  2EIF A;  3G7Z A;  3QJY A;  3JB9 I;  5DLO A;  4YIZ A;  2K5I A;  4II1 A;  3SWN C;  4DOV A;  2FB7 A;  5HK3 A;  4FU6 A;  2QTX A;  4GLK A;  2M9U A;  3M4Y A;  3QYG B;  4M75 A;  5GAN 8;  3OYD A;  3FC3 A;  3WSY A;  5KCH A;  4M77 A;  3DLM A;  1VIF A;  5A0G A;  2LQ8 A;  3HFO A;  4C92 C;  3CPW A;  4PNO A;  5GAO n;  4EMG A;  3X28 B;  1VUB A;  4BI8 B;  4JRI A;  5GAN e;  1OZ3 A;  3A8G B;  2E70 A;  2XDP A;  3OSS C;  2RHY A;  3I56 T;  2K57 A;  4M78 F;  3BW1 A;  3KXT A;  5A0L A;  1WQW A;  4F7U A;  3A8H B;  1QVP A;  4C0F A;  2DZ9 A;  3L2Z A;  2GCX A;  4FSX A;  3CEY A;  4M7A F;  3AHU A;  1Q86 U;  2VXE A;  1K73 C;  2P0K A;  4A4K A;  4N0A C;  2WSC E;  1JB0 E;  5GMK e;  3DLL A;  3RMQ A;  4PLI A;  2RO0 A;  4KUD K;  4C8Q F;  4C5G A;  2Y4Y A;  3ER0 A;  3QII A;  4QVZ A;  4XU3 A;  3QZ5 B;  2VC8 A;  3M4G A;  5J3B A;  1G3W A;  3LGL A;  3CC4 T;  3JSC A;  4FT2 A;  3NTH A;  4A4H A;  3FGR A;  1I81 A;  2QQA A;  3SWN B;  4M78 D;  2E12 A;  1IZ6 A;  1QW1 A;  4ZGE B;  2RHZ A;  4HKE A;  2E64 A;  2VGM A;  1N8R C;  3J80 E;  4LDX A;  2EQJ A;  2LVM A;  3OSV A;  2XDD A;  2L3R A;  3A8O B;  1WNL A;  4A4F A;  3KBG A;  1XOV A;  3ME9 A;  3CBM A;  4M7A D;  3M59 A;  2ZPF B;  3HL8 A;  5CQY A;  4C0D C;  1UGS B;  2PVO B;  3OBW A;  2PU9 B;  3A8M B;  3M57 A;  4M78 E;  2EKO A;  3CC4 A;  2EAY A;  2FHD A;  5CK9 A;  4C8Q D;  3CXC A;  4XTX A;  5CKE A;  2CYZ B;  1MHN A;  3EFR A;  1B34 B;  3N5B B;  2CS7 A;  2EYQ A;  3OB9 A;  4PJO G;  2DJZ A;  1M5Q 1;  4J8O A;  2HD0 A;  4C8Q E;  4M78 C;  5FRM A;  1X75 C;  1M1K U;  1NZ9 A;  1M90 U;  1JJ2 A;  2DXC A;  2E6N A;  1YIJ T;  4QQ6 A;  1Q82 U;  1I8F A;  2BUD A;  4M75 F;  3X26 B;  3CMA T;  3C12 A;  1VQK T;  3DKM A;  3G4S T;  3L2Q A;  4M77 F;  4M7A C;  4JRQ A;  2PUO B;  4D6W A;  3TU4 K;  3CXC S;  4C5E A;  2DTH A;  4BB7 A;  4C8Q C;  4JS5 A;  1UGP B;  3M55 A;  1K8A C;  4C0G A;  3JCM P;  5FRN A;  1YIJ A;  3CMA A;  2JTF A;  2Y8T A;  4C0D B;  4F7U F;  3QBY A;  3P8D A;  4IUR A;  2ZPE B;  4XTY A;  5FU7 C;  4RMO A;  4BE1 A;  2F5T X;  2C06 A;  1VQK A;  3JB9 G;  3CCV T;  2P0Q A;  3QDR B;  3L1A A;  1Q7Y U;  1QVG A;  3JCM V;  4M77 D;  2CZ0 B;  3OYC A;  3MO8 A;  3OYL A;  3GNF B;  4QQD A;  2XG8 D;  4XU1 A;  3SD4 A;  4E7H A;  3M5A A;  4EMK C;  2K5L A;  3HHT B;  5CKH A;  2RHU A;  1YIT T;  2DVE A;  5GAN 7;  3OS1 A;  1D3B B;  2KAF A;  2RHX A;  3CBO A;  4M75 E;  4M78 B;  4QVC A;  2RJF A;  1YJN T;  4MZP A;  1NJI C;  4M77 E;  4RCC A;  4XAX B;  4M7A A;  3CPF A;  3R6O A;  3CD6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...