2I2LA

X-ray crystal structure of protein yopx from bacillus subtilis. northeast structural genomics consortium target sr411.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
134
structure length
130
Chain Sequence
MNTAYRVWDGEQMHYWDDEGLSLIIKSNGDWTLKRLYTDVLVPVVDSTNRNAALMWGAKVRGKFIYDRSIVKITSDDKESSDVCEVKFSDGVFQVDVSKYDVTAVGWVEYATIEVIGDVYQNPELLEGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical protein yopX from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords YopX protein
total genus 13
structure length 130
sequence length 134
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09643 YopX YopX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.50 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2i2lA01
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2i2lA02
4F7UB 5LJ5f 5LJ5g 3RERA 3HFNA 4WF2A 1N9SA 1Y96B 2DJZA 4C8QC 1BIBA 5GAN4 4EMKA 3JCMc 5GAN8 3RKXA 3V8JA 5GAN6 3FB9A 4PJOB 4XQ3A 5LJ5h 2E1HA 3FIFA 4M77B 4A53A 1N9RA 1I4K1 4EMHA 2E65A 4HA8A 3JCMJ 3RKYA 4PJOA 4XU3A 5LJ3d 4N0AA 3V7SA 5LJ3h 3QSUA 2CGHA 4X9DA 4M77E 4M78F 4MMKA 4NL2A 4RCBA 4M77C 1TH7A 4F7UE 5GANj 5GAMd 2EAYA 4M75A 4JUVA 3SB2A 1X01A 4J6WA 1M5Q1 1U1TA 2FB7A 4XU1A 4A54A 4OP0A 4C92D 4M77G 3JB9D 4M7AF 4M75B 5LJ3f 1D3BB 1JRIA 3VU3C 4MMLA 1H641 5GANd 2QTXA 3JCMQ 2DXUA 2K57A 5GAOr 1D3BA 1BIAA 4J6YA 5GAOn 4M7DE 2FYKA 5LJ3j 1I5LA 4V2SA 2DEQA 4C8QD 2DVEA 3FJPA 4F7UA 4HT8A 4M77F 4M78E 4F7UF 5LJ5d 5GAMh 3M4GA 3EFSA 2DTHA 4M77D 5GAN5 5GMKm 4M7AA 2DTIA 4M75E 2EJ9A 5GAN7 1LNXA 4M7AD 3EFRA 5GMKl 5GANg 3SWNB 5GAOm 4RCCA 1KQ2A 4M78B 3RIRA 4XU0A 4PNOA 4M75G 5GAOl 1LJOA 4M7DB 1WNLA 3AHUA 1MGQA 5LJ3g 2RA2A 4XTVA 4M75C 5I21A 1B34B 4C8QF 3QUIA 4M7DD 2YLBA 4PJOD 1WQWA 4JLIA 3SWNA 2Y90A 5GMKj 5GAN2 4C92A 3JCMd 5LJ3e 2E41A 4N0AC 1I81A 5CAIA 5LJ5j 4M75F 4XTZA 3JCMX 2YLCA 4QVCA 4M77A 3BDUA 4Y91A 4EMKC 4F7UG 5GAOq 3INZA 4X9CA 4JRKA 2E64A 4C92F 4EMGA 3GIBA 3JB9F 1HXDA 5GAN3 4C8QA 5GANf 3QHSA 4M78C 4XTWA 4NL3A 4XTUA 4M7AC 2DKGA 3V8KA 1I8FA 2HNIA 3L2ZA 4XTXA 3JB9H 5GANe 4PJOF 4M7DF 2VC8A 3HSBA 3JCMV 4NOYA 3RKWA 4M7DA 4XTYA 4M7AG 5GANh 5GAMj 3JB9I 2DZCA 3QO3A 5GAMe 1B34A 2DXTA 2EJGA 3SWNC 3BFMA 4C8QB 2RM4A 3PGGA 1YCYA 1M8VA 1HK9A 4M75D 3V7RA 1WPYA 2EWNA 3BW1A 4M7AE 4M78G 4M7DC 3V7CA 3JCMh 4C92E 4PJOC 1LOJA 5DY9A 5GAMf 2DZ9A 2EJFA 5GAMg 3JCMW 4DQ2A 3JCMP 3V8LA 1JBMA 2VXFA 2DTOA 4M7DG 4PJOG 2VXEA 4M7AB 4C92G 4EMKB 3L1AA 3HFOA 3JB9G 4C92B 1U1SA 5GAOp 3BY7A 3JCMg 2I2LA 3JCMf 5GMKh 1WQ7A 4J5YA 3JCMb 4C92C 1Y96A 5GMKi 4M78A 4XU2A 2JN0A 4C8QE 2E10A 4PJOE 5LJ5e 5GMKe 2YHTA 4HT9A 2RB6A 3RUXA 4M78D 2RD1A 3JCMe 4J6XA 3JB9J 2ZGWA 1KQ1A 3RESA 4C8QG 4JRIA 4QVDA
chains in the Genus database with same CATH superfamily
2DD5A 3WVDB 3OYDA 1QVGP 3M9QA 5CIUA 3JCMc 2CUBA 2D8JA 2F5KA 4B2RA 3NGPA 3ZEHA 1KC8U 4N0AA 4B2SA 2EGCA 1YJ9A 4MMKA 4LDVA 4M75A 1MD8A 1WHHA 2DXBA 3JB9D 1D3BB 2JT4A 1SSFA 4WCIA 2DF6A 3JRZA 1M27C 1OX8A 1QCNA 5GAOr 4E47A 4ZTJA 1G83A 3LWHA 3OP8A 3JV3A 3CMEA 2K7AA 2YRCA 3KXTA 4J9IA 4M77D 2E3HA 2LX7A 4PJNA 4M78B 1UFFA 1BI0A 4PNOA 4JS4A 3PT9A 3QXEB 1NYGA 4OMQA 5LJ3g 4XTVA 2CZ0B 2YLBA 5L23A 5GMKj 2RF0A 1U3OA 1M3BA 2RQVA 4A4EA 5LJ3e 1CSKA 1Z92B 3EG9A 5FU6C 1HFIA 3U23A 1ELVA 1X6OA 3AT1B 1K8AU 1AVZC 4LNPA 2OX7A 2L3SA 2FZKB 2RH2A 2KROA 2OJ2A 5FO8C 2KK4A 4M7DF 3QYGB 4M7DA 2K3YA 4XTYA 5IHIA 1PSFA 5GAOn 3MJXA 4MDXA 1YCYA 3JB9G 3MCAB 1UGQB 3G71A 2E6NA 4DEYA 5GMKi 1VQMQ 3HHTB 3CMAT 2KXDA 2C0OA 2CUDA 4HT9A 3KFVA 1Q81C 3LW5E 2MI6A 3OEDC 1Q7YR 2PVDB 2WSEE 4OB3B 5GAN8 2HMAA 4DOVA 4A53A 2KAFA 2GCXA 3MQLA 3CCMQ 1PD0A 3V7SA 2KE9A 2GGRA 3BDLA 3QDFA 2DMOA 1Q86C 5GANj 1YITQ 3DB3A 1JJ2A 1X01A 4J6WA 2KVQG 2EBPA 2BE9B 4IUPA 2EKOA 3UA6A 1OYXA 4AFQC 3ZBDA 3A8OB 2DEQA 1M1FA 4GLKA 2NLUA 5LJ5d 2MWOA 3VS5A 2A28A 2KRNA 4QQ6A 4BI4A 5GMKl 2V8EA 2CP3A 3RIRA 1JXOA 5C6SA 2WSFE 3ZFJA 1LY2A 3LH5A 4J7IA 5CVIA 1BI2A 3M54A 1YJWT 3LH0A 3P8HA 1RLQC 4JLIA 1HJDA 4RTUA 1VQOQ 4PK4A 2LRQA 1W6XA 1OK1A 3NTIA 3CPFA 3MEWA 3ZLDA 3INZA 3CD6Q 3EHRA 2E64A 2DJQA 3A8GB 3TQ7P 1EX4A 2A36A 2JS2A 1E6HA 1Q82U 1G3WA 4IIMA 1JO8A 1JXMA 5HYPA 1NM7A 3G71T 2NYSA 4C8QB 1M8VA 1H04P 1CKAA 3OBYA 1SHGA 3BW1A 4M7AE 1VQ9Q 2PUOB 1JBMA 4APLA 4M7AB 4C92B 3TREA 4DBQA 3C0CA 2DNUA 1WX6A 4EDUA 1Y7XA 4LOTA 1FYNA 2H3JA 3G1JA 3OYFA 3OYKA 3C4SA 3C95A 3J7AF 4E7JA 4C5IA 4PJMA 3G6EQ 4A5WB 3D7SB 2E5QA 4JHSA 5LJ5g 3FGRA 4WF2A 2EC3A 2EIFA 3RERA 3IX0A 2X4XA 4HXJA 2COZA 2FZGB 3ZLEA 1OK9A 1M4ZA 1ZA1B 3LLRA 4MZTA 1LVKA 5KE2A 4FW1A 3JAME 1ZLMA 2LDMA 1TS9A 5CQYA 3SFMA 1TPMA 4RTTA 4MUCA 1ZX6A 3RMQA 5CR2A 2LJ0A 4RCBA 1BI3A 2X4WA 4FT2A 4XK8E 1VQNT 5LJ3f 4RTZA 2CG6A 3EG3A 2EGEA 2DVJA 3R6OA 1I5LA 1ZBJA 4KUDK 2CH4A 4J9FA 1LPLA 4F7UA 4M78E 3EFSA 2RJDA 2ZPEB 1MUZA 2PVGB 3OS1A 2JM9A 1VOMA 2G7IA 1S72T 1J3TA 4B6MA 5IHKA 2RQWA 4ELZC 3RBBB 3I55Q 3WSYA 2M9UA 2LNHB 2EYZA 2OI3A 4F17A 4JJCA 3HRUA 1JJ2S 1K73R 1VUBA 3OYGA 1XOVA 2EYXA 1RI9A 5CAIA 5KYUB 2RHIA 2ED0A 1ZHIA 4QVCA 3BDUA 3OYEA 1I07A 4C92F 2V1RA 2H8HA 1BK2A 1PCXA 5GAN3 4C5EA 2W80A 2BZ8A 4A4GA 2ZPFB 1K8AC 4J9EA 3L2ZA 2FL7A 5AT1B 2MCZA 2VYTA 1WFWA 1Y07A 1WHGA 2DK3A 4F04B 3CMAQ 2QA4T 2EW3A 1QQJA 2DXTA 4FT4A 3A5ZB 2RKZA 5DLQE 1MMAA 1AWJA 2AHJB 2VXFA 3HRTA 4M7DG 3OYYA 3HFOA 3MP6A 4JJBA 4C0FA 4ELYC 3CPWS 1VQ6T 2LQNA 2EQKA 2CKKA 4C8QE 1GCQC 4AG1C 4DBHA 3SD4A 1VQ5T 4RG2A 3OW2A 1BCOA 4QQGA 3OQ5A 2HKQB 3H0HA 5CCAA 2V8IA 2K4YA 2HD0A 1OPKA 2DJZA 3J80E 3DB4A 4C0DC 2RQTA 2YRDA 1IZ6A 2EKHA 4NS5A 2L2PA 1M2VB 4HA8A 4XU3A 1GHQB 5LJ3h 3META 1ABQA 2FPEA 1PKTA 3UA7A 3NPFA 4LD9K 1VQ6A 2FB7A 4GLMA 1M90C 1H641 3OB9A 2FYKA 5LJ3j 2CT4A 1VQNQ 2X3XD 4II1A 2KGTA 1QO6A 1Z9QA 4OGCA 3OW2P 2QY0A 1VQKT 2P0KA 5GAOm 1H3HA 2VGNA 2JOYA 1WA7A 3CXCA 1TWBA 4RTXA 3G4ST 3CCVQ 2XICA 3M0TA 4OMFB 1MHNA 4M7DD 2GFAA 2LCSA 1B7TA 3JCMd 2BZYA 4HKEA 1EIFA 2OTLQ 4FYYB 3OW2S 1VQLA 1QGBA 1CKBA 1KIKA 1G2BA 5FW9A 5KH6A 1RLPC 5FRMA 5I0QB 2VUBA 2JRAA 2LZ6B 3EH2A 3V8KA 4R55A 2J06A 2O9VA 3M57A 2FRYA 1N5ZA 3S3MA 1E5GA 2RK2A 1U8RA 2MK5A 2V8JA 2CP6A 2ATCB 2CZ1B 2C0IA 1VQ8A 4PO7A 2FPFA 2MIOA 1Q81U 2EPDA 3CC4T 1V29B 1NJIR 4BE2A 2RLQA 2I2LA 1IXDA 1WQ7A 4FSSA 1Q95G 3EGXB 1UGRB 3EJHA 2XU8A 1IRXA 4EMKA 2LT1A 4QVDA 1GCQA 3PMIA 5CK9A 1TTHB 5GAN4 4MZPA 1YBYA 2E12A 4AFZC 5LJ5h 1W2BS 2XMFA 1GKNA 1XJWB 4CRIA 4IUQA 3NMZC 4QKUA 4X9DA 5HK3A 1S72Q 2DAQA 3M59A 5GAMd 2BIVA 1TG0A 1RAEB 3P8DA 1MMNA 2EYYA 3SDZA 3OYHA 2Y8TA 2LJ1A 2EFIA 3CCUA 2V8KA 3QDRB 3I56T 1QW1A 2O4XB 4RG8A 3RDVA 1QP2A 1VYTA 5CO7A 3E2UA 2DETA 3OXUD 1LNXA 4TVRA 1AEYA 5CKEA 5HYTB 1SRLA 2LTOA 4J8OA 4OB1B 1TUDA 2E5KA 5I21A 1YIJT 2OAUA 1ZSZC 3QUIA 2RKYA 3I35A 1WQWA 1WJSA 1HCCA 3H8ZA 4BACA 3PFSA 4A4KA 3G71Q 3GIBA 3WSXA 1PG5B 2FPDA 2MF2A 1W2BA 1TOVA 1OOTA 2DL5A 2XK0A 1I5OB 2J6FA 4Z89A 1VQ4Q 1N8RR 1QLYA 1UE9A 2KEAA 1H92A 2X3WD 2QASA 3H0FA 5GANh 2CYZB 1PNJA 2DZCA 2QTVA 3JB9I 3OYMA 1S1NA 3BFMA 4KULA 1XQHA 3EAEA 1T3SA 1JU5C 3JCMW 4L6V5 2VXEA 1MNEA 2J7IA 3TEEA 1Q7YU 2LCCA 2NUPA 3R6NA 4C92C 3M53A 1PRLC 2CP5A 2K5FA 3KBGA 5D6YA 4ZGJB 1OX9A 1PD1A 4KGXB 2KRMA 1M90U 2CSIA 1E8BA 3IU3I 1NJIC 1Y96B 5KYYA 1ZQ1A 1K1ZA 4BY6B 3CCSA 3ULRB 3RKXA 1YHQT 3EFOA 2MWPA 5KYWA 4PJOB 1RUWA 4M4ZA 2YUOA 4M77B 1N9RA 2E65A 9ATCB 4C0ZA 1Q7YC 4IGDA 2DEUA 4M78F 3CCQT 3J81E 1TUCA 2DLPA 2YUPA 1U1TA 1MMGA 3GPLA 4BE0A 1VQ9T 4E7ZA 2DXUA 2LOJA 1G4GA 1O75A 3GXEA 4KH0B 1PSEA 2JUFA 1M1GA 2XRDA 3CBOA 4CC4B 1D0ZA 5DN5A 2PNIA 3DKMA 1AHJB 3CEYA 1H2QP 3RMSA 1WNLA 3OYNA 3UPUA 2EVRA 2CP0A 1FMVA 2K2MA 3CCLA 2ED1A 5LL6S 2K79A 3VS7A 3E1SA 2RI3A 1NEGA 4M77A 4OVAA 4M7AC 2HQXA 1E6GA 4K11A 1M30A 1GKGA 1HXDA 2IIMA 3OY9A 4DJZA 4CC2A 2QEXQ 3OSVA 2X35A 1QKXA 3UT1A 3M56A 2CP2A 3QJ6A 1UTIA 1OK2A 1HFHA 1EZZB 1I1JA 2K3XA 4NOYA 4J9HA 3HSBA 2OTJA 2KNBB 3UDCA 1Y71A 3EGUA 1K0SA 2RJCA 3CC4Q 3RJ3D 1BB9A 2P4TA 3VS1A 4E7LA 2MCYA 1SSHA 1QVGS 1IHWA 4ZNXA 3G6EA 4C92G 2JTMA 4J9BA 4O5VA 1YI2Q 3MEAA 1K4US 3EG1A 3UWNA 1Q86R 3NFPI 4EMGA 2ZPHB 4PJJA 4F7UB 4LDUA 3EGDB 3GNGA 1VQ9A 1ZUKA 2F1LA 4B9XA 3M55A 3M7PA 4FYWB 3A8HB 2E6ZA 1PPQA 5C0MA 1UDLA 1YJNQ 1M5Q1 4Y28E 2CG7A 4CSYA 4BWCA 4B9WA 1D1CA 1TPNA 3E9FA 2PVOB 2K57A 2JZ2A 1OK3A 4QW2A 3EGDA 1I0CA 1M2OA 5I2SA 2COWA 1OQKA 2O39C 4O6JA 4F7UF 2R58A 1WDXA 2G3RA 1Y57A 2BZXA 3CC2A 1GXIE 3CCVA 4AT1B 5EG2A 2KYMA 2PU9B 3CCQA 2M16A 4FXGG 3CCSQ 4Z88A 4KBMB 1GBRA 1B34B 5FU7B 1UJ0A 4BY6C 3QWYA 2DIQA 2Y90A 4LE9A 1E7OA 2IPOB 4RUGA 2YUNA 1N27A 2ROLA 2FEIA 5GAOq 3LWIA 3TVTA 4D6WA 4XTUA 1WHMA 1NLOC 3G4SQ 3CCVT 2HNIA 1VQKA 1M2VA 4QQDA 1B34A 2HSEB 4OF1A 1VQKQ 3H6ZA 1OJWA 2NWMA 3VS6A 1HK9A 3CCLT 1WPYA 4AG2C 4M7DC 5FROA 1VQ4A 2C06A 2QQ9A 3PMTA 2K3BA 4HCZA 2VWFA 1QVGA 3SHWA 2JTFA 4OMNA 4J5YA 1Y96A 4YIZA 2AKKA 1QCFA 1QP3A 5ECAA 3G6ET 4PZ5A 4AYIA 2QA4Q 1VQMA 4C5HA 3REBB 2P0PA 2SEMA 2MOXA 4L59A 3NJAA 1GCPA 1WHLA 2QAZA 3KZJA 3HTRA 5JPMG 1Q86U 1AT1B 2GFUA 3VS4A 2DO3A 2NUTA 3GOXA 3CC2Q 4WJG2 4J9DA 3OA6A 3ZRZA 3HL8A 2QQRA 1HYOA 3CCUQ 1SEMA 2EQIA 4KT0E 2EQMA 1BBZA 4PLIA 2VASA 4M77G 4QT7A 2HBWA 1C1AA 2MPXC 2QTXA 5IHNA 1KD1R 2YXYA 3MEVA 1D3BA 3F70A 3L42A 4FCYA 5FU6B 1S72A 3OMGA 5DM7R 1FMKA 4EIKA 4QVZA 4VUBA 3CI0J 2YRAA 3MP8A 4ZGEB 1T0HA 2FO0A 4J9GA 2HL5C 5IT9E 1UUEA 3I9QA 1G5VA 4CC7A 1YP5A 2VB6A 2YWWA 1K8AR 4RTWA 3ZL7C 2DYIA 2QYZA 4LD6A 3QYHB 2E41A 3L2VA 1VQ7A 3SW0X 5I22A 2EGAA 4AFSC 2QG9B 2KMSA 2NUTB 1WI7A 3C94A 4X9CA 3JB9F 1LCKA 4E7SA 4OB2B 1MD7A 1VYUA 2RI5A 3EG0A 3CPWA 2AKLA 1VQ5A 3VYHB 3CC2T 3CC4A 1U5SA 2HQEA 1YFNA 2X51A 3Q1JA 2A55A 2VC8A 4JDSA 5AYFA 3WVEB 1YITT 5GAMe 4IUVA 3SWNC 1B3QA 3PGGA 1YNZA 1X2QA 2RJEA 1BYMA 3V7RA 5HZPB 2D6FA 4KKDA 3V7CA 2ZPBB 3X26B 5GAMg 1H2PP 1BCMA 4PJOG 2JS0A 2HDAA 2DL3A 3JCMb 2CZ7B 4M78A 2YRVA 2E10A 2QQSA 1GFCA 4P5NA 2KR3A 3PE0A 3CCLQ 3CXCP 1D1BA 5KYNA 2ROTA 3CQTA 5CKBA 1X43A 2OAWA 1G3TA 4N4IA 3TU4K 4KGVB 3FDRA 2FRWA 4XQ3A 1KQSA 1YJNT 3KUFA 1NJIU 1K76A 1OU9A 5KYXB 1M3CA 2DM1A 3PIOA 3F6KA 4D8KA 5FWCA 4ANJA 3CCJA 2K2VA 4M7AF 1SKUB 1VQPQ 1D0YA 4DEXA 5CKFA 4EPCA 1PWTA 1YIJA 1VQ7Q 1VQ6Q 1YN8A 2GNCA 2ERJA 4ORZA 3L89M 1C6VX 3M4GA 4JS5A 4HVVA 1IO6A 4PFOA 2Y8SA 5GJVB 2B8AA 4PLLA 2DILA 2L3QA 1AWXA 2DPPB 2GTJA 4DBFA 2A0FB 4MDWA 4JLGA 4MSLA 4PJOD 3SWNA 1NLPC 1OEBA 1YJWA 2RHYA 2M51A 1QUBA 3ME9A 1Y0MA 3OS2A 1RACB 2LNVA 3MO8A 2DERA 4FU6A 2P84A 4M78C 4NL3A 1TXQA 3TCJA 4OMMA 3VRZA 2J05A 1PRMC 2GQVA 1UGSB 4N4GA 2M0OA 3A98A 3CCMA 4E7IA 1T3LA 3QZ5B 1WXTA 3OYIA 2YT6A 4PJOC 3OYJA 2DZ9A 2QGGA 2DFUA 2D0QB 4EMKB 1W1FA 2DE0X 4FM4B 3JCMf 4GY5A 1VQOT 1RABB 1C0MA 2XDDA 2DRKA 3O5ZA 2O88A 4ONTD 3I55A 1ZUUA 2LC4A 1XTDA 3CCMT 2EYWA 2GBQA 1R0BG 3CCST 1UOTP 2A7YA 2JGXA 5L8RE 3VV0A 3RKYA 1X27A 2BUDA 2CREA 2R5AA 1KK7A 1VVCA 4X34A 3QSUA 4J38B 1ZJKA 2HL3A 2XDBA 3H9NA 4F7UE 4BDZA 1RI0A 3HP9A 4HVWA 4ZTFA 3C12A 1HD3A 3X28B 2RNAA 3G7ZA 3NFCA 3JCMQ 1NPPA 3E19A 1NEBA 4V2SA 2DVEA 2GQIA 3X24B 2HKNA 2HEQA 2LMJA 3FEOA 3CCQQ 3EH1A 2DYBA 4C5GA 5A0DA 4YTLA 3PTAA 2RK1A 2LP5A 2LQ8A 4M75C 1OV3A 5HK0A 4YNXA 2G6FX 1TU0B 4LUDA 1YWOA 5EC7A 3CMEQ 1AZGB 1VYVA 2LQKA 5KCHA 4XTZA 4A63B 2B86A 3LGLA 5IXFA 3MP1A 2HCKA 2PQWA 1UHCA 3CCET 2X4YA 2D1XA 1YJNA 1M8MA 4A4HA 2YBYA 1YWPA 3JCMV 2DL4A 5GAMj 5A0LA 1WXBA 1N8RC 4M75D 2MCNA 4UC4A 1ABOA 3CC7T 2PZ1A 1WJRA 1QWEA 4J7FA 2E4HA 2LQWA 3VJPA 1K9MR 1VA7A 1GFDA 1E88A 2IZ3A 2E70A 4PL6A 5GAMh 3OMCA 2QK0A 4XU2A 1G3YA 4N4HA 1IGQA 3I56Q 1V76A 2JXBA 3LYIA 5HYUB 3GBQA 2OTLT 4JRIA 4PJLA 4Y92A 8AT1B 1F1BB 2ECZA 3T9NA 1K9AA 3EHQA 4PJOA 2DRMA 1OPLA 2HZYA 2LVMA 2K5IA 3WXMB 2CGHA 1Z9ZA 5I11A 2NUZA 3QG1A 2HSPA 5J3BA 3VUBA 4OP0A 1QWFA 2M1HA 3L2RA 4MMLA 1BIAA 1KJWA 4M7DE 4AYDA 1U5MA 1FBRA 1YITA 2LX9A 1UEBA 2QDLA 1M1KC 4HT8A 3K3TA 2XWJI 3JCMJ 4C0GA 3URGA 1W4SA 1WLPB 2JVVA 2A37A 5A0GA 4M7AD 2ESWA 4PKCC 1TSFA 4M75G 1LJOA 1TPGA 1UG1A 5IXBA 4ME7A 3BE3A 2RA2A 2QDYB 4JJNK 4XAXB 2KT1A 3RR6A 4RTYA 1MMDA 3CCRQ 2X9HA 1I81A 5IN1A 1ZSZB 2YLCA 2YSQA 2XD0A 2P4RA 2F2VA 1CKLA 1K73C 2DIGA 4ZH1D 2RO0A 2HAXA 4OMOA 1I8FA 2RQRA 3VRYA 2MAMA 1QMCA 1KD1C 1AOJA 2EJGA 2KBTA 2RN8A 1ZSGA 2M02A 4J83A 2XDPA 4F14A 3H41A 2CS7A 1OZ3A 3RNJA 1OULA 1A0NB 3OS0A 5DY9A 3EG2A 4DQ2A 3ERBA 2XIDA 2DL8A 2R5MA 4PFPA 1H8KA 2DD4A 1RAAB 3MKDA 1G3SA 1YJWQ 3P8BB 3IQLA 2ABLA 2F2WA 3A8LB 2KSSA 2ZZDA 3EGXA 5J39A 2ZGWA 1X69A 4C8QC 5FRNA 2VKNA 1UJYA 4OMLA 1N8RU 2ZPIB 4EMHA 2XKOC 2Z0WA 2L8DA 2IG0A 3GLXA 4M77C 2KRIA 1TH7A 1G8XA 3CBMA 1VIFA 2ENMA 4C92D 1SF9A 3VU3C 2XRBA 2QEXT 3CCUT 4C0DB 4A4FA 3HPWA 1KFZA 1SHFA 2D0NA 5D6WA 1M9SA 2RQUA 3FJ5A 1YJ9Q 3EFOB 5KYWB 1MV3A 1K9MU 2Y8RA 1WYXA 2DTIA 2FVUA 2KMTA 4CC3A 3M0UA 1QKWA 5GAOl 3OYAA 4Z02A 4M7DB 1MGQA 2KRSA 3GNFB 1O9SA 3GOVA 3QIIA 4HCBA 4C92A 1IB8A 4N0AC 1RAFB 1GPZA 4M75F 4E7KA 2YUQA 3JCMX 2CKUA 2CZ6B 1PC0A 2CT3A 1QVFA 2O9SA 2KT8A 1IHVA 1AWWA 3QHSA 2WSCE 3JB9H 5GANe 1YHQA 1FX7A 3CCRT 3SEMA 4JZ3A 1R0CB 3VWOA 2C0TA 2D9TA 2J6OA 2MYSA 2H3EB 1WZOA 1FXXA 2VGMA 2RL0A 1VQ5Q 2X2ZA 2BZMA 2O4XA 2V26A 5D6XA 5KCOA 3CD6A 1KC8R 1KD1U 3CCEQ 4PJOE 1UB4A 2JN0A 2L3PA 2COYA 5D7UA 4LOSA 3RUXA 2RD1A 2I0NA 1M90R 4BD3A 3CMET 3OS5A 5LJ5f 2FZCB 4AMCA 3QJYA 2AIRB 3L2WA 3TSWA 3ZD2A 1ZSZA 4FIBA 4L5GA 3PIPA 4R56A 2E1HA 2KQWA 1WXUA 1I4K1 2OTJQ 2HBPA 1D1AA 5LJ3d 1RAGB 1UHFA 2XG8D 4JRQA 2JM8A 1KG1A 4NL2A 1M3AA 2EAYA 4HCKA 2NUPB 3VKIA 2ZYCA 3O8EB 4AFUC 1OZ2A 1OU8A 2IVWA 2KY9A 1Q82R 2F5TX 2RJFA 3R62A 4JPBW 1MNDA 4M77F 4DBRA 5GMKm 1R77A 2EJ9A 1ARKA 4ATOA 2KDSA 3L2QA 3SWNB 2K6DA 3UF4A 1VVDA 2E3IA 1BI1A 1D09B 2FHDA 1N6AA 2LT4A 3CC7Q 4C8QF 1C1ZA 2MMPA 1KQSP 3M0PA 1NG2A 3FRNA 1KHCA 1VQNA 3E9GA 4FYVB 1NWVA 4IIOA 2D8HA 2QA4A 1B07A 5LJ5j 1BU1A 2ZAEA 4HVUA 3GP8A 4BE1A 4EMKC 4PFZA 4Y91A 1VQMT 1RADB 2A08A 4C16A 3QPHA 3HRSA 1IGUA 2F69A 3CD6T 2IZ4A 4XTXA 3PNWC 3VUZA 4OMPA 2RHZA 1GL5A 3G4SA 1O9AA 2K5LA 1DJ7B 3LX7A 3VS2A 2DTOA 1NZ9A 1ZA2B 1U1SA 5I2MA 4MZMA 3JCMg 2JNGA 2UWNA 2ZPGB 3REAB 2YDLA 1UGPB 3ZD1A 1W70A 2RB6A 3ASKA 2EHFA 3M0RA 4Q5WA 2CSQA 5KYXA 1KC8C 4R0KA 1WJQA 3I55T 1GBQA 3JSCA 1X6GA 4ZN3A 4HCCA 3S3NA 1WGSA 1RAIB 1HSQA 2RI2A 3CMAA 3QWXX 1MV0B 1SS2A 1K9MC 4ZGDB 1JQQA 4F16A 3QZ9B 1SG5A 2AZVA 1YIJQ 4JUVA 4M75B 4BI8B 1JRIA 1VQ7T 1WIEA 1VQPA 2EQUA 4IUUA 4J6YA 2DBMA 2XWBF 3FLGA 3INBC 3CCJQ 3M5AA 3CCRA 1YCSB 1NBEB 2B5ID 3FJPA 5GAN5 5IH2A 1RLHA 2RLPA 2L89A 1H03P 3UATA 1ACMB 4XU0A 3FGTA 3I5RA 2K9GA 1VQ4T 1PKSA 1Q81R 2X4JA 4J9CA 3DLMA 2JW4A 2P0QA 2CDTA 3N5BB 2RPNA 2RMOA 2Y4YA 2W81A 4FSXA 1YJ9T 4WTOB 3CCJT 3MHXA 1GRIA 2O01E 3MPUB 1H3ZA 3DLLA 2L3RA 4XTWA 2M0YA 3S3OA 4LDWA 5KYUA 1WHJA 4FYXB 1QVFP 2JGWA 5FWBA 3QBYA 3RKWA 4LN2A 4KH1B 2RM4A 1OJVA 1RL2A 3NHNA 1LOJA 1XNIA 3QKJA 4E2FB 2EJFA 2L5QA 6AT1B 2QEXA 1TUGB 3JCMP 1KHIA 2V1QA 1M1KU 3TVJA 4ESRA 4GBQA 5GMKh 1QVFS 1WHKA 5DN4A 4D8DA 5GMKe 4BB7A 1P92A 3CCEA 4J6XA 4BI3A 3FC3A 3JB9J 1VIEA 5KE3A 3L2UA 3H0IA 5IAYA 1N9SA 3X20B 2W0ZA 2DA9A 1BIBA 1Q3XA 3OYLA 1VQ8Q 1VQPT 4OGEA 2BE7D 3NTKA 5GAN6 3FB9A 3VS3A 2BTTA 2QQAA 1R8OB 2EQJA 4N7EA 1YHQQ 1AD5A 5FU7C 1JEGA 5CKDA 4AYEA 3CALA 5HCKA 3CXCS 4LUEA 3SB2A 1UGVA 3M58A 1X6BA 3HKSA 4OB0B 4E6RA 1UECA 5GANd 2KI7A 3M4YA 1OI1A 2PTKA 3OBWA 2OTLA 3VS0A 4C8QD 5GJWB 1VQOA 3THKA 4RKUE 2DTHA 4IKFA 2VVKA 4M75E 2GF7A 4K12A 5GAN7 1U06A 3EFRA 2L0AA 4JJDA 4RCCA 4KGZB 3M0SA 2JTEA 3S6WA 4IUTA 2CP7A 5DLOA 3NTHA 1YI2T 1ZUYA 2AZSA 1EFNA 2WACA 2QXFA 3TSZA 2RHXA 1IREB 3ER0A 4F7UG 3GF5A 2R57A 4JRKA 1SPKA 4C8QA 5GANf 1ZBXA 1W2BP 1PHTA 2AK5A 3CBPA 2GTOA 1FMWA 5HKCA 1KQSS 4PJOF 1V1CA 3I5SA 3M0QA 2FG0A 4KUIA 4LDYA 3QO3A 1NYFA 2EWNA 2OTJT 4AYMA 3JCMh 5CQXA 5GAMf 4CI0C 4Z8AA 2DX1A 4JZ4A 2JJ9A 1Q82C 3BY7A 1RAHB 3X25B 1NPRA 4E7HA 5LJ5e 2LCLA 2BKDN 2YHTA 3OYCA 4LDXA 1K0XA 4M78D 2VV5A 5HY6A 2DL7A 2SRCA 5J26A 4C8QG 3RESA 4M7AA 3CC7A 4JRPA 3PVLA 3HFNA 3V8JA 3FIFA 1M1KR 1JJ2P 2LJ3A 5CKHA 2EYQA 2QGFB 2QQBA 2XQWC 4KRTA 4M77E 1VQLT 3OSSC 4BDYA 4XU1A 4A54A 1PM3A 5FLXE 3PVQA 4X1VA 5M9OA 2CH4W 1SRZA 2HQHA 1AZEA 4RTVA 2RHUA 7AT1B 2O2OA 1SRMA 2J6KA 3LGFA 2ZCFB 1K73U 1NE8A 5GANg 1KQ2A 4FL6A 2XHCA 4LXCA 3CPWP 5A2QE 1FWZA 1JB0E 1X2KA 2JMCA 3O8VA 2QI2A 5GAN2 1QCOA 1BKBA 2W10A 1OJYA 1QVPA 1YI2A 3AHUA 2AT1B 1KSWA 2Y4XA 3EG9B 4ZN1A 3OYBA 4IURA 4DA4A 1AWOA 3A8MB 2DKGA 4RMOA 2KXCA 2DBKA 4M7AG 2PUKB 4BUGA 4F4OC 3MEUA 1VQ8T 4M78G 4C92E 4DOWA 1G4FA 1X75C 1D0XA 4FW2A 3T5OA 3VYGA 2O31A 3V8LA 8ATCB 2A3LA 2WIIC 2DXCA 3L1AA 5GAOp 2XI9A 1VQLQ 3I56A 2JMAA 5KYYB 1T0JA 3KXVA 2KYBA 2F2XA 3JCMe 1KQ1A 3A1PA
chains in the Genus database with same CATH topology
3OS5A 5LJ5f 3PMIA 5CK9A 2DD5A 5CKBA 3WVDB 1G3TA 3OYDA 4N4IA 4EMKA 4MZPA 5GAN4 1YBYA 3M9QA 5CIUA 3FDRA 2E12A 3JCMc 3QJYA 3TU4K 3L2WA 4FIBA 4L5GA 4XQ3A 3PIPA 4R56A 2F5KA 2E1HA 5LJ5h 1W2BS 2KQWA 1I4K1 1KQSA 2HBPA 1YJNT 3KUFA 1NJIU 3ZEHA 5LJ3d 4N0AA 1KC8U 4CRIA 4IUQA 2XG8D 4JRQA 4X9DA 5HK3A 3PIOA 1YJ9A 4MMKA 1KG1A 2DAQA 3F6KA 3M59A 4NL2A 4LDVA 2EAYA 5GAMd 4M75A 3CCJA 2BIVA 2DXBA 3VKIA 2K2VA 3JB9D 3P8DA 4M7AF 1D3BB 1SSFA 3SDZA 3OYHA 1OZ2A 2IVWA 2Y8TA 3JRZA 5CKFA 2KY9A 4EPCA 5GAOr 4E47A 4ZTJA 3LWHA 1YIJA 2F5TX 3CMEA 2EFIA 2RJFA 3CCUA 2V8KA 3JB9J 3QDRB 3I56T 1QW1A 2O4XB 4RG8A 4M77F 3KXTA 1QP2A 3M4GA 4JS5A 4M77D 5CO7A 5GMKm 4M7AA 2Y8SA 2EJ9A 1LNXA 4ATOA 2KDSA 3L2QA 2B8AA 4TVRA 4PLLA 3SWNB 5CKEA 4M78B 1BI0A 4PNOA 4JS4A 2DPPB 3PT9A 1BI1A 4OB1B 2LTOA 3QXEB 4J8OA 2FHDA 5LJ3g 1N6AA 4XTVA 2LT4A 5I21A 4MDWA 1YIJT 2CZ0B 2OAUA 4JLGA 4C8QF 3QUIA 4MSLA 2MMPA 2YLBA 4PJOD 1WQWA 3SWNA 1WJSA 3FRNA 1KHCA 5GMKj 1VQNA 3H8ZA 3E9GA 4A4EA 5LJ3e 4BACA 2QA4A 3PFSA 1YJWA 2RHYA 5LJ5j 5FU6C 4A4KA 3GP8A 3ME9A 3GIBA 4BE1A 3WSXA 4EMKC 4Y91A 3OS2A 2MF2A 2LNVA 1VQMT 1X6OA 3MO8A 1W2BA 1K8AU 4FU6A 3QPHA 3HRSA 2XK0A 4M78C 4NL3A 2RH2A 2F69A 3CD6T 3TCJA 2KK4A 4XTXA 4M7DF 3PNWC 2GQVA 3QYGB 3VUZA 2K3YA 1UGSB 4N4GA 2M0OA 4XTYA 5GANh 1PSFA 2CYZB 2DZCA 5GAOn 3JB9I 3OYMA 3CCMA 2RHZA 3BFMA 4MDXA 1YCYA 4KULA 4E7IA 1XQHA 3QZ5B 3G4SA 3OYIA 2K5LA 3EAEA 1DJ7B 3LX7A 4PJOC 3OYJA 3JCMW 2DZ9A 2DTOA 1NZ9A 4L6V5 2D0QB 2VXEA 4EMKB 3JB9G 1U1SA 5I2MA 4FM4B 3MCAB 3TEEA 4MZMA 3JCMg 1Q7YU 2LCCA 1UGQB 2JNGA 2E6NA 3JCMf 3G71A 4GY5A 4C92C 2ZPGB 3M53A 5GMKi 2K5FA 1VQOT 3HHTB 1UGPB 3KBGA 3CMAT 5D6YA 4ZGJB 4HT9A 2RB6A 1Q81C 3ASKA 3LW5E 2XDDA 1M90U 2MI6A 3I55A 1KC8C 4Q5WA 1Y96B 1NJIC 1ZQ1A 2LC4A 1XTDA 1WJQA 2PVDB 4BY6B 2WSEE 3I55T 3CCMT 3JSCA 4OB3B 5GAN8 4ZN3A 3RKXA 1YHQT 3CCST 2MWPA 4HCCA 4PJOB 3S3NA 4DOVA 1WGSA 4M77B 2A7YA 5L8RE 4A53A 1N9RA 2GCXA 2KAFA 3VV0A 2E65A 2RI2A 3RKYA 2BUDA 3CMAA 2R5AA 4C0ZA 1Q7YC 3V7SA 4X34A 3QSUA 3BDLA 1K9MC 4ZGDB 2XDBA 4M78F 4F7UE 3CCQT 4BDZA 3J81E 1Q86C 5GANj 3QZ9B 1RI0A 3HP9A 4ZTFA 3DB3A 4JUVA 1JJ2A 1X01A 4J6WA 1U1TA 2KVQG 3GPLA 3C12A 4BE0A 4IUPA 3X28B 4M75B 2EKOA 4BI8B 1JRIA 3G7ZA 1VQ7T 2OTLT 1VQ9T 1VQPA 1OYXA 2EQUA 3NFCA 3JCMQ 1NPPA 4IUUA 2DXUA 3ZBDA 4J6YA 3E19A 1O75A 3FLGA 3M5AA 3CCRA 3A8OB 2XD0A 2DEQA 4V2SA 1PSEA 1M1FA 4GLKA 2DVEA 2JUFA 3X24B 3CCSA 3FJPA 1M1GA 3CBOA 2NLUA 5LJ5d 2MWOA 5GAN5 3DKMA 1AHJB 2L89A 4QQ6A 4BI4A 3FEOA 5GMKl 3CEYA 3RIRA 4XU0A 4C5GA 5C6SA 5A0DA 2WSFE 4YTLA 3FGTA 2RK1A 3RMSA 3ZFJA 3PTAA 1WNLA 2LQ8A 4J7IA 5CVIA 3OYNA 1VQ4T 1BI2A 3UPUA 4M75C 3M54A 5HK0A 1YJWT 2X4JA 3CCLA 3LH0A 3P8HA 4JLIA 3DLMA 5LL6S 2LRQA 2P0QA 3NTIA 3N5BB 3CPFA 3E1SA 2LQKA 2Y4YA 5KCHA 2RI3A 4XTZA 3LGLA 3MEWA 4FSXA 1YJ9T 3ZLDA 3MP1A 4M77A 2HQXA 4OVAA 3MHXA 3INZA 3CCJT 4M7AC 2E64A 3A8GB 2O01E 2PQWA 1H3ZA 3DLLA 2L3RA 1HXDA 3CCET 1Q82U 2X4YA 3OY9A 1G3WA 3OSVA 4XTWA 2X35A 1YJNA 3S3OA 4LDWA 3UT1A 3M56A 3QJ6A 3G71T 4A4HA 2K3XA 3HSBA 3JCMV 4NOYA 3QBYA 3RKWA 5GAMj 5A0LA 2OTJA 1N8RC 3UDCA 4C8QB 1M8VA 2RM4A 3OBYA 1Y71A 4M75D 4UC4A 3BW1A 1RL2A 2RJCA 3CC7T 4M7AE 1WJRA 1LOJA 1XNIA 2PUOB 3QKJA 2EJFA 2L5QA 3JCMP 2P4TA 4J7FA 3VJPA 2QEXA 1JBMA 4E7LA 1QVGS 4APLA 1KHIA 4M7AB 3G6EA 4C92G 1M1KU 4C92B 2JTMA 3TREA 2E70A 4O5VA 5GMKh 3MEAA 4PL6A 3OMCA 5GAMh 1QVFS 4XU2A 3UWNA 1G3YA 4N4HA 4EDUA 3J7AF 5GMKe 1Y7XA 4BB7A 1P92A 3CCEA 3LYIA 2H3JA 4J6XA 4BI3A 3OYFA 3C4SA 3C95A 3OYKA 4EMGA 1VIEA 2ZPHB 4JRIA 4C5IA 3FC3A 5KE3A 4F7UB 3L2UA 4E7JA 4LDUA 2E5QA 5IAYA 5LJ5g 3FGRA 4WF2A 2EIFA 3RERA 1N9SA 2X4XA 3X20B 1BIBA 3OYLA 3GNGA 1VQPT 4OGEA 1VQ9A 3NTKA 3ZLEA 5GAN6 1M4ZA 3FB9A 3LLRA 3M55A 4MZTA 3T9NA 4B9XA 5KE2A 3JAME 2LDMA 2QQAA 1R8OB 2EQJA 5CQYA 3SFMA 4PJOA 4N7EA 3A8HB 2LVMA 2E6ZA 5FU7C 2K5IA 3RMQA 3WXMB 5CR2A 2CGHA 5CKDA 4RCBA 5C0MA 1BI3A 2X4WA 3QG1A 3CXCS 4FT2A 5J3BA 3SB2A 4M7DA 1M5Q1 4XK8E 4Y28E 3M58A 4OB0B 3HKSA 4OP0A 3VUBA 1VQNT 2M1HA 5LJ3f 3L2RA 4BWCA 4MMLA 4B9WA 5GANd 3E9FA 3M4YA 2PVOB 1OI1A 2K57A 3R6OA 1BIAA 2JZ2A 3OBWA 4M7DE 4QW2A 2OTLA 1YITA 1I5LA 2LX9A 5I2SA 1UEBA 4C8QD 4KUDK 1VQOA 1M1KC 4F7UA 4HT8A 4O6JA 4M78E 4RKUE 4F7UF 2R58A 3JCMJ 3EFSA 2DTHA 2G3RA 2RJDA 1W4SA 2ZPEB 3URGA 4C0GA 4M75E 2GF7A 2JVVA 3CC2A 5A0GA 1GXIE 5GAN7 4M7AD 2PVGB 3EFRA 3OS1A 3CCVA 4RCCA 4PKCC 1S72T 5EG2A 4M75G 2PU9B 3CCQA 1LJOA 2M16A 4KBMB 4ELZC 4ME7A 3S6WA 3WSYA 2M9UA 4IUTA 2RA2A 1B34B 2QDYB 5FU7B 5DLOA 4BY6C 3NTHA 4XAXB 4JJNK 3HRUA 1YI2T 2DIQA 2Y90A 1JJ2S 1VUBA 3OYGA 2WACA 1I81A 1XOVA 2QXFA 5IN1A 5CAIA 1N27A 2RHIA 1ZHIA 2YLCA 2RHXA 4QVCA 3BDUA 1IREB 3ER0A 4F7UG 5GAOq 3GF5A 2R57A 4JRKA 4C92F 3OYEA 3LWIA 1K73C 5GAN3 4C5EA 2DIGA 4C8QA 4D6WA 5GANf 1ZBXA 4A4GA 2RO0A 2ZPFB 4XTUA 2HAXA 3CBPA 1I8FA 3CCVT 1K8AC 2HNIA 3L2ZA 2FL7A 5HKCA 1KQSS 4PJOF 1VQKA 2MAMA 2VYTA 1Y07A 2DK3A 4KUIA 2QA4T 1KD1C 4LDYA 4QQDA 3QO3A 1B34A 2DXTA 2EJGA 4FT4A 4OF1A 3H6ZA 3A5ZB 1HK9A 4J83A 2XDPA 3CCLT 1WPYA 2EWNA 2CS7A 1OZ3A 2OTJT 4M7DC 5DLQE 3JCMh 5FROA 3OS0A 1VQ4A 5DY9A 5CQXA 5GAMf 2C06A 4CI0C 2QQ9A 4DQ2A 2AHJB 2VXFA 3HRTA 3PMTA 4HCZA 4M7DG 3OYYA 2XIDA 3HFOA 3MP6A 3CPWS 4C0FA 2R5MA 3BY7A 2JTFA 4ELYC 1Q82C 1QVGA 1VQ6T 3X25B 2DD4A 2EQKA 1NPRA 4J5YA 1Y96A 4YIZA 2CKKA 1G3SA 4C8QE 4E7HA 1QP3A 3P8BB 3G6ET 5LJ5e 3SD4A 1VQMA 4C5HA 1VQ5T 2LCLA 2BKDN 2YHTA 3OYCA 4LDXA 2P0PA 3A8LB 4M78D 4RG2A 3OW2A 2KSSA 2VV5A 2ZZDA 3OQ5A 4QQGA 2ZGWA 5HY6A 5J26A 2V8IA 3RESA 4C8QG 5CCAA 5J39A 4L59A 3NJAA 3CC7A 2K4YA 2HD0A 4JRPA 3HFNA 2DJZA 4C8QC 3J80E 5FRNA 1Q86U 3DB4A 4C0DC 2GFUA 1IZ6A 1N8RU 3V8JA 4NS5A 2ZPIB 2DO3A 3FIFA 3GOXA 4EMHA 2XKOC 4HA8A 2L8DA 4XU3A 2IG0A 5CKHA 3GLXA 2EYQA 5LJ3h 2QQBA 3OA6A 3META 3HL8A 2QQRA 4M77E 1VQLT 4M77C 1TH7A 4LD9K 1VQ6A 4KT0E 3OSSC 2EQMA 4BDYA 4PLIA 2FB7A 4XU1A 3CBMA 1VIFA 4A54A 4C92D 4M77G 1M90C 3VU3C 1H641 3OB9A 2QTXA 5FLXE 3MEVA 1D3BA 2QEXT 5M9OA 3CCUT 3F70A 4C0DB 3L42A 4A4FA 2FYKA 3HPWA 5LJ3j 5FU6B 5D6WA 1M9SA 1S72A 3OMGA 4II1A 5DM7R 2RHUA 4QVZA 4VUBA 4OGCA 1K9MU 2Y8RA 2DTIA 1VQKT 2FVUA 2KMTA 3LGFA 2ZCFB 1K73U 1NE8A 2P0KA 3MP8A 5GANg 4FL6A 5GAOm 1KQ2A 4ZGEB 2XHCA 2VGNA 2JOYA 3CXCA 5GAOl 3OYAA 4Z02A 3G4ST 4M7DB 5IT9E 1G5VA 2XICA 5A2QE 1FWZA 1MGQA 1JB0E 3GNFB 1O9SA 3O8VA 4OMFB 1MHNA 2QI2A 3QIIA 4M7DD 4HCBA 4LD6A 2GFAA 5GAN2 4C92A 1BKBA 3JCMd 3QYHB 2E41A 4HKEA 4N0AC 1EIFA 3L2VA 1VQ7A 3OW2S 1QVPA 4E7KA 4M75F 1YI2A 1VQLA 3JCMX 3AHUA 2CZ6B 2Y4XA 3C94A 4X9CA 3JB9F 1QVFA 4ZN1A 4OB2B 5KH6A 2RI5A 3OYBA 5FRMA 4IURA 3CPWA 2VUBA 3QHSA 4DA4A 1VQ5A 3VYHB 3CC2T 3A8MB 2DKGA 4RMOA 3V8KA 3CC4A 2WSCE 4R55A 2HQEA 3JB9H 5GANe 3Q1JA 2VC8A 4JDSA 1YHQA 5AYFA 3M57A 1FX7A 4M7AG 2PUKB 3CCRT 3WVEB 1YITT 3S3MA 5GAMe 4BUGA 4IUVA 3SWNC 2RK2A 3PGGA 1U8RA 2RJEA 2D9TA 3MEUA 1BYMA 3V7RA 1VQ8T 2V8JA 3CMET 2CZ1B 4M78G 2D6FA 3V7CA 4C92E 4DOWA 1FXXA 1X75C 2VGMA 1VQ8A 2ZPBB 3VYGA 3X26B 5GAMg 4IKFA 3V8LA 2X2ZA 2O4XA 2A3LA 4PO7A 4PJOG 1Q81U 2DXCA 5D6XA 3L1AA 5KCOA 3CC4T 3CD6A 5GAOp 2XI9A 1V29B 4BE2A 1KD1U 2I2LA 1WQ7A 3JCMb 3I56A 4PJOE 1UB4A 2CZ7B 2YRVA 2JN0A 4M78A 2E10A 2QQSA 1UGRB 4P5NA 3RUXA 2RD1A 3JCMe 2XU8A 1KQ1A 4BD3A 2LT1A 4QVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U B;  5LJ5 f;  5LJ5 g;  3RER A;  3HFN A;  4WF2 A;  1N9S A;  1Y96 B;  2DJZ A;  4C8Q C;  1BIB A;  5GAN 4;  4EMK A;  3JCM c;  5GAN 8;  3RKX A;  3V8J A;  5GAN 6;  3FB9 A;  4PJO B;  4XQ3 A;  5LJ5 h;  2E1H A;  3FIF A;  4M77 B;  4A53 A;  1N9R A;  1I4K 1;  4EMH A;  2E65 A;  4HA8 A;  3JCM J;  3RKY A;  4PJO A;  4XU3 A;  5LJ3 d;  4N0A A;  3V7S A;  5LJ3 h;  3QSU A;  2CGH A;  4X9D A;  4M77 E;  4M78 F;  4MMK A;  4NL2 A;  4RCB A;  4M77 C;  1TH7 A;  4F7U E;  5GAN j;  5GAM d;  2EAY A;  4M75 A;  4JUV A;  3SB2 A;  1X01 A;  4J6W A;  1M5Q 1;  1U1T A;  2FB7 A;  4XU1 A;  4A54 A;  4OP0 A;  4C92 D;  4M77 G;  3JB9 D;  4M7A F;  4M75 B;  5LJ3 f;  1D3B B;  1JRI A;  3VU3 C;  4MML A;  1H64 1;  5GAN d;  2QTX A;  3JCM Q;  2DXU A;  2K57 A;  5GAO r;  1D3B A;  1BIA A;  4J6Y A;  5GAO n;  4M7D E;  2FYK A;  5LJ3 j;  1I5L A;  4V2S A;  2DEQ A;  4C8Q D;  2DVE A;  3FJP A;  4F7U A;  4HT8 A;  4M77 F;  4M78 E;  4F7U F;  5LJ5 d;  5GAM h;  3M4G A;  3EFS A;  2DTH A;  4M77 D;  5GAN 5;  5GMK m;  4M7A A;  2DTI A;  4M75 E;  2EJ9 A;  5GAN 7;  1LNX A;  4M7A D;  3EFR A;  5GMK l;  5GAN g;  3SWN B;  5GAO m;  4RCC A;  1KQ2 A;  4M78 B;  3RIR A;  4XU0 A;  4PNO A;  4M75 G;  5GAO l;  1LJO A;  4M7D B;  1WNL A;  3AHU A;  1MGQ A;  5LJ3 g;  2RA2 A;  4XTV A;  4M75 C;  5I21 A;  1B34 B;  4C8Q F;  3QUI A;  4M7D D;  2YLB A;  4PJO D;  1WQW A;  4JLI A;  3SWN A;  2Y90 A;  5GMK j;  5GAN 2;  4C92 A;  3JCM d;  5LJ3 e;  2E41 A;  4N0A C;  1I81 A;  5CAI A;  5LJ5 j;  4M75 F;  4XTZ A;  3JCM X;  2YLC A;  4QVC A;  4M77 A;  3BDU A;  4Y91 A;  4EMK C;  4F7U G;  5GAO q;  3INZ A;  4X9C A;  4JRK A;  2E64 A;  4C92 F;  4EMG A;  3GIB A;  3JB9 F;  1HXD A;  5GAN 3;  4C8Q A;  5GAN f;  3QHS A;  4M78 C;  4XTW A;  4NL3 A;  4XTU A;  4M7A C;  2DKG A;  3V8K A;  1I8F A;  2HNI A;  3L2Z A;  4XTX A;  3JB9 H;  5GAN e;  4PJO F;  4M7D F;  2VC8 A;  3HSB A;  3JCM V;  4NOY A;  3RKW A;  4M7D A;  4XTY A;  4M7A G;  5GAN h;  5GAM j;  3JB9 I;  2DZC A;  3QO3 A;  5GAM e;  1B34 A;  2DXT A;  2EJG A;  3SWN C;  3BFM A;  4C8Q B;  2RM4 A;  3PGG A;  1YCY A;  1M8V A;  1HK9 A;  4M75 D;  3V7R A;  1WPY A;  2EWN A;  3BW1 A;  4M7A E;  4M78 G;  4M7D C;  3V7C A;  3JCM h;  4C92 E;  4PJO C;  1LOJ A;  5DY9 A;  5GAM f;  2DZ9 A;  2EJF A;  5GAM g;  3JCM W;  4DQ2 A;  3JCM P;  3V8L A;  1JBM A;  2VXF A;  2DTO A;  4M7D G;  4PJO G;  2VXE A;  4M7A B;  4C92 G;  4EMK B;  3L1A A;  3HFO A;  3JB9 G;  4C92 B;  1U1S A;  5GAO p;  3BY7 A;  3JCM g;  2I2L A;  3JCM f;  5GMK h;  1WQ7 A;  4J5Y A;  3JCM b;  4C92 C;  1Y96 A;  5GMK i;  4M78 A;  4XU2 A;  2JN0 A;  4C8Q E;  2E10 A;  4PJO E;  5LJ5 e;  5GMK e;  2YHT A;  4HT9 A;  2RB6 A;  3RUX A;  4M78 D;  2RD1 A;  3JCM e;  4J6X A;  3JB9 J;  2ZGW A;  1KQ1 A;  3RES A;  4C8Q G;  4JRI A;  4QVD A; 
#chains in the Genus database with same CATH topology
 2DD5 A;  3WVD B;  3OYD A;  1QVG P;  3M9Q A;  5CIU A;  3JCM c;  2CUB A;  2D8J A;  2F5K A;  4B2R A;  3NGP A;  3ZEH A;  1KC8 U;  4N0A A;  4B2S A;  2EGC A;  1YJ9 A;  4MMK A;  4LDV A;  4M75 A;  1MD8 A;  1WHH A;  2DXB A;  3JB9 D;  1D3B B;  2JT4 A;  1SSF A;  4WCI A;  2DF6 A;  3JRZ A;  1M27 C;  1OX8 A;  1QCN A;  5GAO r;  4E47 A;  4ZTJ A;  1G83 A;  3LWH A;  3OP8 A;  3JV3 A;  3CME A;  2K7A A;  2YRC A;  3KXT A;  4J9I A;  4M77 D;  2E3H A;  2LX7 A;  4PJN A;  4M78 B;  1UFF A;  1BI0 A;  4PNO A;  4JS4 A;  3PT9 A;  3QXE B;  1NYG A;  4OMQ A;  5LJ3 g;  4XTV A;  2CZ0 B;  2YLB A;  5L23 A;  5GMK j;  2RF0 A;  1U3O A;  1M3B A;  2RQV A;  4A4E A;  5LJ3 e;  1CSK A;  1Z92 B;  3EG9 A;  5FU6 C;  1HFI A;  3U23 A;  1ELV A;  1X6O A;  3AT1 B;  1K8A U;  1AVZ C;  4LNP A;  2OX7 A;  2L3S A;  2FZK B;  2RH2 A;  2KRO A;  2OJ2 A;  5FO8 C;  2KK4 A;  4M7D F;  3QYG B;  4M7D A;  2K3Y A;  4XTY A;  5IHI A;  1PSF A;  5GAO n;  3MJX A;  4MDX A;  1YCY A;  3JB9 G;  3MCA B;  1UGQ B;  3G71 A;  2E6N A;  4DEY A;  5GMK i;  1VQM Q;  3HHT B;  3CMA T;  2KXD A;  2C0O A;  2CUD A;  4HT9 A;  3KFV A;  1Q81 C;  3LW5 E;  2MI6 A;  3OED C;  1Q7Y R;  2PVD B;  2WSE E;  4OB3 B;  5GAN 8;  2HMA A;  4DOV A;  4A53 A;  2KAF A;  2GCX A;  3MQL A;  3CCM Q;  1PD0 A;  3V7S A;  2KE9 A;  2GGR A;  3BDL A;  3QDF A;  2DMO A;  1Q86 C;  5GAN j;  1YIT Q;  3DB3 A;  1JJ2 A;  1X01 A;  4J6W A;  2KVQ G;  2EBP A;  2BE9 B;  4IUP A;  2EKO A;  3UA6 A;  1OYX A;  4AFQ C;  3ZBD A;  3A8O B;  2DEQ A;  1M1F A;  4GLK A;  2NLU A;  5LJ5 d;  2MWO A;  3VS5 A;  2A28 A;  2KRN A;  4QQ6 A;  4BI4 A;  5GMK l;  2V8E A;  2CP3 A;  3RIR A;  1JXO A;  5C6S A;  2WSF E;  3ZFJ A;  1LY2 A;  3LH5 A;  4J7I A;  5CVI A;  1BI2 A;  3M54 A;  1YJW T;  3LH0 A;  3P8H A;  1RLQ C;  4JLI A;  1HJD A;  4RTU A;  1VQO Q;  4PK4 A;  2LRQ A;  1W6X A;  1OK1 A;  3NTI A;  3CPF A;  3MEW A;  3ZLD A;  3INZ A;  3CD6 Q;  3EHR A;  2E64 A;  2DJQ A;  3A8G B;  3TQ7 P;  1EX4 A;  2A36 A;  2JS2 A;  1E6H A;  1Q82 U;  1G3W A;  4IIM A;  1JO8 A;  1JXM A;  5HYP A;  1NM7 A;  3G71 T;  2NYS A;  4C8Q B;  1M8V A;  1H04 P;  1CKA A;  3OBY A;  1SHG A;  3BW1 A;  4M7A E;  1VQ9 Q;  2PUO B;  1JBM A;  4APL A;  4M7A B;  4C92 B;  3TRE A;  4DBQ A;  3C0C A;  2DNU A;  1WX6 A;  4EDU A;  1Y7X A;  4LOT A;  1FYN A;  2H3J A;  3G1J A;  3OYF A;  3OYK A;  3C4S A;  3C95 A;  3J7A F;  4E7J A;  4C5I A;  4PJM A;  3G6E Q;  4A5W B;  3D7S B;  2E5Q A;  4JHS A;  5LJ5 g;  3FGR A;  4WF2 A;  2EC3 A;  2EIF A;  3RER A;  3IX0 A;  2X4X A;  4HXJ A;  2COZ A;  2FZG B;  3ZLE A;  1OK9 A;  1M4Z A;  1ZA1 B;  3LLR A;  4MZT A;  1LVK A;  5KE2 A;  4FW1 A;  3JAM E;  1ZLM A;  2LDM A;  1TS9 A;  5CQY A;  3SFM A;  1TPM A;  4RTT A;  4MUC A;  1ZX6 A;  3RMQ A;  5CR2 A;  2LJ0 A;  4RCB A;  1BI3 A;  2X4W A;  4FT2 A;  4XK8 E;  1VQN T;  5LJ3 f;  4RTZ A;  2CG6 A;  3EG3 A;  2EGE A;  2DVJ A;  3R6O A;  1I5L A;  1ZBJ A;  4KUD K;  2CH4 A;  4J9F A;  1LPL A;  4F7U A;  4M78 E;  3EFS A;  2RJD A;  2ZPE B;  1MUZ A;  2PVG B;  3OS1 A;  2JM9 A;  1VOM A;  2G7I A;  1S72 T;  1J3T A;  4B6M A;  5IHK A;  2RQW A;  4ELZ C;  3RBB B;  3I55 Q;  3WSY A;  2M9U A;  2LNH B;  2EYZ A;  2OI3 A;  4F17 A;  4JJC A;  3HRU A;  1JJ2 S;  1K73 R;  1VUB A;  3OYG A;  1XOV A;  2EYX A;  1RI9 A;  5CAI A;  5KYU B;  2RHI A;  2ED0 A;  1ZHI A;  4QVC A;  3BDU A;  3OYE A;  1I07 A;  4C92 F;  2V1R A;  2H8H A;  1BK2 A;  1PCX A;  5GAN 3;  4C5E A;  2W80 A;  2BZ8 A;  4A4G A;  2ZPF B;  1K8A C;  4J9E A;  3L2Z A;  2FL7 A;  5AT1 B;  2MCZ A;  2VYT A;  1WFW A;  1Y07 A;  1WHG A;  2DK3 A;  4F04 B;  3CMA Q;  2QA4 T;  2EW3 A;  1QQJ A;  2DXT A;  4FT4 A;  3A5Z B;  2RKZ A;  5DLQ E;  1MMA A;  1AWJ A;  2AHJ B;  2VXF A;  3HRT A;  4M7D G;  3OYY A;  3HFO A;  3MP6 A;  4JJB A;  4C0F A;  4ELY C;  3CPW S;  1VQ6 T;  2LQN A;  2EQK A;  2CKK A;  4C8Q E;  1GCQ C;  4AG1 C;  4DBH A;  3SD4 A;  1VQ5 T;  4RG2 A;  3OW2 A;  1BCO A;  4QQG A;  3OQ5 A;  2HKQ B;  3H0H A;  5CCA A;  2V8I A;  2K4Y A;  2HD0 A;  1OPK A;  2DJZ A;  3J80 E;  3DB4 A;  4C0D C;  2RQT A;  2YRD A;  1IZ6 A;  2EKH A;  4NS5 A;  2L2P A;  1M2V B;  4HA8 A;  4XU3 A;  1GHQ B;  5LJ3 h;  3MET A;  1ABQ A;  2FPE A;  1PKT A;  3UA7 A;  3NPF A;  4LD9 K;  1VQ6 A;  2FB7 A;  4GLM A;  1M90 C;  1H64 1;  3OB9 A;  2FYK A;  5LJ3 j;  2CT4 A;  1VQN Q;  2X3X D;  4II1 A;  2KGT A;  1QO6 A;  1Z9Q A;  4OGC A;  3OW2 P;  2QY0 A;  1VQK T;  2P0K A;  5GAO m;  1H3H A;  2VGN A;  2JOY A;  1WA7 A;  3CXC A;  1TWB A;  4RTX A;  3G4S T;  3CCV Q;  2XIC A;  3M0T A;  4OMF B;  1MHN A;  4M7D D;  2GFA A;  2LCS A;  1B7T A;  3JCM d;  2BZY A;  4HKE A;  1EIF A;  2OTL Q;  4FYY B;  3OW2 S;  1VQL A;  1QGB A;  1CKB A;  1KIK A;  1G2B A;  5FW9 A;  5KH6 A;  1RLP C;  5FRM A;  5I0Q B;  2VUB A;  2JRA A;  2LZ6 B;  3EH2 A;  3V8K A;  4R55 A;  2J06 A;  2O9V A;  3M57 A;  2FRY A;  1N5Z A;  3S3M A;  1E5G A;  2RK2 A;  1U8R A;  2MK5 A;  2V8J A;  2CP6 A;  2ATC B;  2CZ1 B;  2C0I A;  1VQ8 A;  4PO7 A;  2FPF A;  2MIO A;  1Q81 U;  2EPD A;  3CC4 T;  1V29 B;  1NJI R;  4BE2 A;  2RLQ A;  2I2L A;  1IXD A;  1WQ7 A;  4FSS A;  1Q95 G;  3EGX B;  1UGR B;  3EJH A;  2XU8 A;  1IRX A;  4EMK A;  2LT1 A;  4QVD A;  1GCQ A;  3PMI A;  5CK9 A;  1TTH B;  5GAN 4;  4MZP A;  1YBY A;  2E12 A;  4AFZ C;  5LJ5 h;  1W2B S;  2XMF A;  1GKN A;  1XJW B;  4CRI A;  4IUQ A;  3NMZ C;  4QKU A;  4X9D A;  5HK3 A;  1S72 Q;  2DAQ A;  3M59 A;  5GAM d;  2BIV A;  1TG0 A;  1RAE B;  3P8D A;  1MMN A;  2EYY A;  3SDZ A;  3OYH A;  2Y8T A;  2LJ1 A;  2EFI A;  3CCU A;  2V8K A;  3QDR B;  3I56 T;  1QW1 A;  2O4X B;  4RG8 A;  3RDV A;  1QP2 A;  1VYT A;  5CO7 A;  3E2U A;  2DET A;  3OXU D;  1LNX A;  4TVR A;  1AEY A;  5CKE A;  5HYT B;  1SRL A;  2LTO A;  4J8O A;  4OB1 B;  1TUD A;  2E5K A;  5I21 A;  1YIJ T;  2OAU A;  1ZSZ C;  3QUI A;  2RKY A;  3I35 A;  1WQW A;  1WJS A;  1HCC A;  3H8Z A;  4BAC A;  3PFS A;  4A4K A;  3G71 Q;  3GIB A;  3WSX A;  1PG5 B;  2FPD A;  2MF2 A;  1W2B A;  1TOV A;  1OOT A;  2DL5 A;  2XK0 A;  1I5O B;  2J6F A;  4Z89 A;  1VQ4 Q;  1N8R R;  1QLY A;  1UE9 A;  2KEA A;  1H92 A;  2X3W D;  2QAS A;  3H0F A;  5GAN h;  2CYZ B;  1PNJ A;  2DZC A;  2QTV A;  3JB9 I;  3OYM A;  1S1N A;  3BFM A;  4KUL A;  1XQH A;  3EAE A;  1T3S A;  1JU5 C;  3JCM W;  4L6V 5;  2VXE A;  1MNE A;  2J7I A;  3TEE A;  1Q7Y U;  2LCC A;  2NUP A;  3R6N A;  4C92 C;  3M53 A;  1PRL C;  2CP5 A;  2K5F A;  3KBG A;  5D6Y A;  4ZGJ B;  1OX9 A;  1PD1 A;  4KGX B;  2KRM A;  1M90 U;  2CSI A;  1E8B A;  3IU3 I;  1NJI C;  1Y96 B;  5KYY A;  1ZQ1 A;  1K1Z A;  4BY6 B;  3CCS A;  3ULR B;  3RKX A;  1YHQ T;  3EFO A;  2MWP A;  5KYW A;  4PJO B;  1RUW A;  4M4Z A;  2YUO A;  4M77 B;  1N9R A;  2E65 A;  9ATC B;  4C0Z A;  1Q7Y C;  4IGD A;  2DEU A;  4M78 F;  3CCQ T;  3J81 E;  1TUC A;  2DLP A;  2YUP A;  1U1T A;  1MMG A;  3GPL A;  4BE0 A;  1VQ9 T;  4E7Z A;  2DXU A;  2LOJ A;  1G4G A;  1O75 A;  3GXE A;  4KH0 B;  1PSE A;  2JUF A;  1M1G A;  2XRD A;  3CBO A;  4CC4 B;  1D0Z A;  5DN5 A;  2PNI A;  3DKM A;  1AHJ B;  3CEY A;  1H2Q P;  3RMS A;  1WNL A;  3OYN A;  3UPU A;  2EVR A;  2CP0 A;  1FMV A;  2K2M A;  3CCL A;  2ED1 A;  5LL6 S;  2K79 A;  3VS7 A;  3E1S A;  2RI3 A;  1NEG A;  4M77 A;  4OVA A;  4M7A C;  2HQX A;  1E6G A;  4K11 A;  1M30 A;  1GKG A;  1HXD A;  2IIM A;  3OY9 A;  4DJZ A;  4CC2 A;  2QEX Q;  3OSV A;  2X35 A;  1QKX A;  3UT1 A;  3M56 A;  2CP2 A;  3QJ6 A;  1UTI A;  1OK2 A;  1HFH A;  1EZZ B;  1I1J A;  2K3X A;  4NOY A;  4J9H A;  3HSB A;  2OTJ A;  2KNB B;  3UDC A;  1Y71 A;  3EGU A;  1K0S A;  2RJC A;  3CC4 Q;  3RJ3 D;  1BB9 A;  2P4T A;  3VS1 A;  4E7L A;  2MCY A;  1SSH A;  1QVG S;  1IHW A;  4ZNX A;  3G6E A;  4C92 G;  2JTM A;  4J9B A;  4O5V A;  1YI2 Q;  3MEA A;  1K4U S;  3EG1 A;  3UWN A;  1Q86 R;  3NFP I;  4EMG A;  2ZPH B;  4PJJ A;  4F7U B;  4LDU A;  3EGD B;  3GNG A;  1VQ9 A;  1ZUK A;  2F1L A;  4B9X A;  3M55 A;  3M7P A;  4FYW B;  3A8H B;  2E6Z A;  1PPQ A;  5C0M A;  1UDL A;  1YJN Q;  1M5Q 1;  4Y28 E;  2CG7 A;  4CSY A;  4BWC A;  4B9W A;  1D1C A;  1TPN A;  3E9F A;  2PVO B;  2K57 A;  2JZ2 A;  1OK3 A;  4QW2 A;  3EGD A;  1I0C A;  1M2O A;  5I2S A;  2COW A;  1OQK A;  2O39 C;  4O6J A;  4F7U F;  2R58 A;  1WDX A;  2G3R A;  1Y57 A;  2BZX A;  3CC2 A;  1GXI E;  3CCV A;  4AT1 B;  5EG2 A;  2KYM A;  2PU9 B;  3CCQ A;  2M16 A;  4FXG G;  3CCS Q;  4Z88 A;  4KBM B;  1GBR A;  1B34 B;  5FU7 B;  1UJ0 A;  4BY6 C;  3QWY A;  2DIQ A;  2Y90 A;  4LE9 A;  1E7O A;  2IPO B;  4RUG A;  2YUN A;  1N27 A;  2ROL A;  2FEI A;  5GAO q;  3LWI A;  3TVT A;  4D6W A;  4XTU A;  1WHM A;  1NLO C;  3G4S Q;  3CCV T;  2HNI A;  1VQK A;  1M2V A;  4QQD A;  1B34 A;  2HSE B;  4OF1 A;  1VQK Q;  3H6Z A;  1OJW A;  2NWM A;  3VS6 A;  1HK9 A;  3CCL T;  1WPY A;  4AG2 C;  4M7D C;  5FRO A;  1VQ4 A;  2C06 A;  2QQ9 A;  3PMT A;  2K3B A;  4HCZ A;  2VWF A;  1QVG A;  3SHW A;  2JTF A;  4OMN A;  4J5Y A;  1Y96 A;  4YIZ A;  2AKK A;  1QCF A;  1QP3 A;  5ECA A;  3G6E T;  4PZ5 A;  4AYI A;  2QA4 Q;  1VQM A;  4C5H A;  3REB B;  2P0P A;  2SEM A;  2MOX A;  4L59 A;  3NJA A;  1GCP A;  1WHL A;  2QAZ A;  3KZJ A;  3HTR A;  5JPM G;  1Q86 U;  1AT1 B;  2GFU A;  3VS4 A;  2DO3 A;  2NUT A;  3GOX A;  3CC2 Q;  4WJG 2;  4J9D A;  3OA6 A;  3ZRZ A;  3HL8 A;  2QQR A;  1HYO A;  3CCU Q;  1SEM A;  2EQI A;  4KT0 E;  2EQM A;  1BBZ A;  4PLI A;  2VAS A;  4M77 G;  4QT7 A;  2HBW A;  1C1A A;  2MPX C;  2QTX A;  5IHN A;  1KD1 R;  2YXY A;  3MEV A;  1D3B A;  3F70 A;  3L42 A;  4FCY A;  5FU6 B;  1S72 A;  3OMG A;  5DM7 R;  1FMK A;  4EIK A;  4QVZ A;  4VUB A;  3CI0 J;  2YRA A;  3MP8 A;  4ZGE B;  1T0H A;  2FO0 A;  4J9G A;  2HL5 C;  5IT9 E;  1UUE A;  3I9Q A;  1G5V A;  4CC7 A;  1YP5 A;  2VB6 A;  2YWW A;  1K8A R;  4RTW A;  3ZL7 C;  2DYI A;  2QYZ A;  4LD6 A;  3QYH B;  2E41 A;  3L2V A;  1VQ7 A;  3SW0 X;  5I22 A;  2EGA A;  4AFS C;  2QG9 B;  2KMS A;  2NUT B;  1WI7 A;  3C94 A;  4X9C A;  3JB9 F;  1LCK A;  4E7S A;  4OB2 B;  1MD7 A;  1VYU A;  2RI5 A;  3EG0 A;  3CPW A;  2AKL A;  1VQ5 A;  3VYH B;  3CC2 T;  3CC4 A;  1U5S A;  2HQE A;  1YFN A;  2X51 A;  3Q1J A;  2A55 A;  2VC8 A;  4JDS A;  5AYF A;  3WVE B;  1YIT T;  5GAM e;  4IUV A;  3SWN C;  1B3Q A;  3PGG A;  1YNZ A;  1X2Q A;  2RJE A;  1BYM A;  3V7R A;  5HZP B;  2D6F A;  4KKD A;  3V7C A;  2ZPB B;  3X26 B;  5GAM g;  1H2P P;  1BCM A;  4PJO G;  2JS0 A;  2HDA A;  2DL3 A;  3JCM b;  2CZ7 B;  4M78 A;  2YRV A;  2E10 A;  2QQS A;  1GFC A;  4P5N A;  2KR3 A;  3PE0 A;  3CCL Q;  3CXC P;  1D1B A;  5KYN A;  2ROT A;  3CQT A;  5CKB A;  1X43 A;  2OAW A;  1G3T A;  4N4I A;  3TU4 K;  4KGV B;  3FDR A;  2FRW A;  4XQ3 A;  1KQS A;  1YJN T;  3KUF A;  1NJI U;  1K76 A;  1OU9 A;  5KYX B;  1M3C A;  2DM1 A;  3PIO A;  3F6K A;  4D8K A;  5FWC A;  4ANJ A;  3CCJ A;  2K2V A;  4M7A F;  1SKU B;  1VQP Q;  1D0Y A;  4DEX A;  5CKF A;  4EPC A;  1PWT A;  1YIJ A;  1VQ7 Q;  1VQ6 Q;  1YN8 A;  2GNC A;  2ERJ A;  4ORZ A;  3L89 M;  1C6V X;  3M4G A;  4JS5 A;  4HVV A;  1IO6 A;  4PFO A;  2Y8S A;  5GJV B;  2B8A A;  4PLL A;  2DIL A;  2L3Q A;  1AWX A;  2DPP B;  2GTJ A;  4DBF A;  2A0F B;  4MDW A;  4JLG A;  4MSL A;  4PJO D;  3SWN A;  1NLP C;  1OEB A;  1YJW A;  2RHY A;  2M51 A;  1QUB A;  3ME9 A;  1Y0M A;  3OS2 A;  1RAC B;  2LNV A;  3MO8 A;  2DER A;  4FU6 A;  2P84 A;  4M78 C;  4NL3 A;  1TXQ A;  3TCJ A;  4OMM A;  3VRZ A;  2J05 A;  1PRM C;  2GQV A;  1UGS B;  4N4G A;  2M0O A;  3A98 A;  3CCM A;  4E7I A;  1T3L A;  3QZ5 B;  1WXT A;  3OYI A;  2YT6 A;  4PJO C;  3OYJ A;  2DZ9 A;  2QGG A;  2DFU A;  2D0Q B;  4EMK B;  1W1F A;  2DE0 X;  4FM4 B;  3JCM f;  4GY5 A;  1VQO T;  1RAB B;  1C0M A;  2XDD A;  2DRK A;  3O5Z A;  2O88 A;  4ONT D;  3I55 A;  1ZUU A;  2LC4 A;  1XTD A;  3CCM T;  2EYW A;  2GBQ A;  1R0B G;  3CCS T;  1UOT P;  2A7Y A;  2JGX A;  5L8R E;  3VV0 A;  3RKY A;  1X27 A;  2BUD A;  2CRE A;  2R5A A;  1KK7 A;  1VVC A;  4X34 A;  3QSU A;  4J38 B;  1ZJK A;  2HL3 A;  2XDB A;  3H9N A;  4F7U E;  4BDZ A;  1RI0 A;  3HP9 A;  4HVW A;  4ZTF A;  3C12 A;  1HD3 A;  3X28 B;  2RNA A;  3G7Z A;  3NFC A;  3JCM Q;  1NPP A;  3E19 A;  1NEB A;  4V2S A;  2DVE A;  2GQI A;  3X24 B;  2HKN A;  2HEQ A;  2LMJ A;  3FEO A;  3CCQ Q;  3EH1 A;  2DYB A;  4C5G A;  5A0D A;  4YTL A;  3PTA A;  2RK1 A;  2LP5 A;  2LQ8 A;  4M75 C;  1OV3 A;  5HK0 A;  4YNX A;  2G6F X;  1TU0 B;  4LUD A;  1YWO A;  5EC7 A;  3CME Q;  1AZG B;  1VYV A;  2LQK A;  5KCH A;  4XTZ A;  4A63 B;  2B86 A;  3LGL A;  5IXF A;  3MP1 A;  2HCK A;  2PQW A;  1UHC A;  3CCE T;  2X4Y A;  2D1X A;  1YJN A;  1M8M A;  4A4H A;  2YBY A;  1YWP A;  3JCM V;  2DL4 A;  5GAM j;  5A0L A;  1WXB A;  1N8R C;  4M75 D;  2MCN A;  4UC4 A;  1ABO A;  3CC7 T;  2PZ1 A;  1WJR A;  1QWE A;  4J7F A;  2E4H A;  2LQW A;  3VJP A;  1K9M R;  1VA7 A;  1GFD A;  1E88 A;  2IZ3 A;  2E70 A;  4PL6 A;  5GAM h;  3OMC A;  2QK0 A;  4XU2 A;  1G3Y A;  4N4H A;  1IGQ A;  3I56 Q;  1V76 A;  2JXB A;  3LYI A;  5HYU B;  3GBQ A;  2OTL T;  4JRI A;  4PJL A;  4Y92 A;  8AT1 B;  1F1B B;  2ECZ A;  3T9N A;  1K9A A;  3EHQ A;  4PJO A;  2DRM A;  1OPL A;  2HZY A;  2LVM A;  2K5I A;  3WXM B;  2CGH A;  1Z9Z A;  5I11 A;  2NUZ A;  3QG1 A;  2HSP A;  5J3B A;  3VUB A;  4OP0 A;  1QWF A;  2M1H A;  3L2R A;  4MML A;  1BIA A;  1KJW A;  4M7D E;  4AYD A;  1U5M A;  1FBR A;  1YIT A;  2LX9 A;  1UEB A;  2QDL A;  1M1K C;  4HT8 A;  3K3T A;  2XWJ I;  3JCM J;  4C0G A;  3URG A;  1W4S A;  1WLP B;  2JVV A;  2A37 A;  5A0G A;  4M7A D;  2ESW A;  4PKC C;  1TSF A;  4M75 G;  1LJO A;  1TPG A;  1UG1 A;  5IXB A;  4ME7 A;  3BE3 A;  2RA2 A;  2QDY B;  4JJN K;  4XAX B;  2KT1 A;  3RR6 A;  4RTY A;  1MMD A;  3CCR Q;  2X9H A;  1I81 A;  5IN1 A;  1ZSZ B;  2YLC A;  2YSQ A;  2XD0 A;  2P4R A;  2F2V A;  1CKL A;  1K73 C;  2DIG A;  4ZH1 D;  2RO0 A;  2HAX A;  4OMO A;  1I8F A;  2RQR A;  3VRY A;  2MAM A;  1QMC A;  1KD1 C;  1AOJ A;  2EJG A;  2KBT A;  2RN8 A;  1ZSG A;  2M02 A;  4J83 A;  2XDP A;  4F14 A;  3H41 A;  2CS7 A;  1OZ3 A;  3RNJ A;  1OUL A;  1A0N B;  3OS0 A;  5DY9 A;  3EG2 A;  4DQ2 A;  3ERB A;  2XID A;  2DL8 A;  2R5M A;  4PFP A;  1H8K A;  2DD4 A;  1RAA B;  3MKD A;  1G3S A;  1YJW Q;  3P8B B;  3IQL A;  2ABL A;  2F2W A;  3A8L B;  2KSS A;  2ZZD A;  3EGX A;  5J39 A;  2ZGW A;  1X69 A;  4C8Q C;  5FRN A;  2VKN A;  1UJY A;  4OML A;  1N8R U;  2ZPI B;  4EMH A;  2XKO C;  2Z0W A;  2L8D A;  2IG0 A;  3GLX A;  4M77 C;  2KRI A;  1TH7 A;  1G8X A;  3CBM A;  1VIF A;  2ENM A;  4C92 D;  1SF9 A;  3VU3 C;  2XRB A;  2QEX T;  3CCU T;  4C0D B;  4A4F A;  3HPW A;  1KFZ A;  1SHF A;  2D0N A;  5D6W A;  1M9S A;  2RQU A;  3FJ5 A;  1YJ9 Q;  3EFO B;  5KYW B;  1MV3 A;  1K9M U;  2Y8R A;  1WYX A;  2DTI A;  2FVU A;  2KMT A;  4CC3 A;  3M0U A;  1QKW A;  5GAO l;  3OYA A;  4Z02 A;  4M7D B;  1MGQ A;  2KRS A;  3GNF B;  1O9S A;  3GOV A;  3QII A;  4HCB A;  4C92 A;  1IB8 A;  4N0A C;  1RAF B;  1GPZ A;  4M75 F;  4E7K A;  2YUQ A;  3JCM X;  2CKU A;  2CZ6 B;  1PC0 A;  2CT3 A;  1QVF A;  2O9S A;  2KT8 A;  1IHV A;  1AWW A;  3QHS A;  2WSC E;  3JB9 H;  5GAN e;  1YHQ A;  1FX7 A;  3CCR T;  3SEM A;  4JZ3 A;  1R0C B;  3VWO A;  2C0T A;  2D9T A;  2J6O A;  2MYS A;  2H3E B;  1WZO A;  1FXX A;  2VGM A;  2RL0 A;  1VQ5 Q;  2X2Z A;  2BZM A;  2O4X A;  2V26 A;  5D6X A;  5KCO A;  3CD6 A;  1KC8 R;  1KD1 U;  3CCE Q;  4PJO E;  1UB4 A;  2JN0 A;  2L3P A;  2COY A;  5D7U A;  4LOS A;  3RUX A;  2RD1 A;  2I0N A;  1M90 R;  4BD3 A;  3CME T;  3OS5 A;  5LJ5 f;  2FZC B;  4AMC A;  3QJY A;  2AIR B;  3L2W A;  3TSW A;  3ZD2 A;  1ZSZ A;  4FIB A;  4L5G A;  3PIP A;  4R56 A;  2E1H A;  2KQW A;  1WXU A;  1I4K 1;  2OTJ Q;  2HBP A;  1D1A A;  5LJ3 d;  1RAG B;  1UHF A;  2XG8 D;  4JRQ A;  2JM8 A;  1KG1 A;  4NL2 A;  1M3A A;  2EAY A;  4HCK A;  2NUP B;  3VKI A;  2ZYC A;  3O8E B;  4AFU C;  1OZ2 A;  1OU8 A;  2IVW A;  2KY9 A;  1Q82 R;  2F5T X;  2RJF A;  3R62 A;  4JPB W;  1MND A;  4M77 F;  4DBR A;  5GMK m;  1R77 A;  2EJ9 A;  1ARK A;  4ATO A;  2KDS A;  3L2Q A;  3SWN B;  2K6D A;  3UF4 A;  1VVD A;  2E3I A;  1BI1 A;  1D09 B;  2FHD A;  1N6A A;  2LT4 A;  3CC7 Q;  4C8Q F;  1C1Z A;  2MMP A;  1KQS P;  3M0P A;  1NG2 A;  3FRN A;  1KHC A;  1VQN A;  3E9G A;  4FYV B;  1NWV A;  4IIO A;  2D8H A;  2QA4 A;  1B07 A;  5LJ5 j;  1BU1 A;  2ZAE A;  4HVU A;  3GP8 A;  4BE1 A;  4EMK C;  4PFZ A;  4Y91 A;  1VQM T;  1RAD B;  2A08 A;  4C16 A;  3QPH A;  3HRS A;  1IGU A;  2F69 A;  3CD6 T;  2IZ4 A;  4XTX A;  3PNW C;  3VUZ A;  4OMP A;  2RHZ A;  1GL5 A;  3G4S A;  1O9A A;  2K5L A;  1DJ7 B;  3LX7 A;  3VS2 A;  2DTO A;  1NZ9 A;  1ZA2 B;  1U1S A;  5I2M A;  4MZM A;  3JCM g;  2JNG A;  2UWN A;  2ZPG B;  3REA B;  2YDL A;  1UGP B;  3ZD1 A;  1W70 A;  2RB6 A;  3ASK A;  2EHF A;  3M0R A;  4Q5W A;  2CSQ A;  5KYX A;  1KC8 C;  4R0K A;  1WJQ A;  3I55 T;  1GBQ A;  3JSC A;  1X6G A;  4ZN3 A;  4HCC A;  3S3N A;  1WGS A;  1RAI B;  1HSQ A;  2RI2 A;  3CMA A;  3QWX X;  1MV0 B;  1SS2 A;  1K9M C;  4ZGD B;  1JQQ A;  4F16 A;  3QZ9 B;  1SG5 A;  2AZV A;  1YIJ Q;  4JUV A;  4M75 B;  4BI8 B;  1JRI A;  1VQ7 T;  1WIE A;  1VQP A;  2EQU A;  4IUU A;  4J6Y A;  2DBM A;  2XWB F;  3FLG A;  3INB C;  3CCJ Q;  3M5A A;  3CCR A;  1YCS B;  1NBE B;  2B5I D;  3FJP A;  5GAN 5;  5IH2 A;  1RLH A;  2RLP A;  2L89 A;  1H03 P;  3UAT A;  1ACM B;  4XU0 A;  3FGT A;  3I5R A;  2K9G A;  1VQ4 T;  1PKS A;  1Q81 R;  2X4J A;  4J9C A;  3DLM A;  2JW4 A;  2P0Q A;  2CDT A;  3N5B B;  2RPN A;  2RMO A;  2Y4Y A;  2W81 A;  4FSX A;  1YJ9 T;  4WTO B;  3CCJ T;  3MHX A;  1GRI A;  2O01 E;  3MPU B;  1H3Z A;  3DLL A;  2L3R A;  4XTW A;  2M0Y A;  3S3O A;  4LDW A;  5KYU A;  1WHJ A;  4FYX B;  1QVF P;  2JGW A;  5FWB A;  3QBY A;  3RKW A;  4LN2 A;  4KH1 B;  2RM4 A;  1OJV A;  1RL2 A;  3NHN A;  1LOJ A;  1XNI A;  3QKJ A;  4E2F B;  2EJF A;  2L5Q A;  6AT1 B;  2QEX A;  1TUG B;  3JCM P;  1KHI A;  2V1Q A;  1M1K U;  3TVJ A;  4ESR A;  4GBQ A;  5GMK h;  1QVF S;  1WHK A;  5DN4 A;  4D8D A;  5GMK e;  4BB7 A;  1P92 A;  3CCE A;  4J6X A;  4BI3 A;  3FC3 A;  3JB9 J;  1VIE A;  5KE3 A;  3L2U A;  3H0I A;  5IAY A;  1N9S A;  3X20 B;  2W0Z A;  2DA9 A;  1BIB A;  1Q3X A;  3OYL A;  1VQ8 Q;  1VQP T;  4OGE A;  2BE7 D;  3NTK A;  5GAN 6;  3FB9 A;  3VS3 A;  2BTT A;  2QQA A;  1R8O B;  2EQJ A;  4N7E A;  1YHQ Q;  1AD5 A;  5FU7 C;  1JEG A;  5CKD A;  4AYE A;  3CAL A;  5HCK A;  3CXC S;  4LUE A;  3SB2 A;  1UGV A;  3M58 A;  1X6B A;  3HKS A;  4OB0 B;  4E6R A;  1UEC A;  5GAN d;  2KI7 A;  3M4Y A;  1OI1 A;  2PTK A;  3OBW A;  2OTL A;  3VS0 A;  4C8Q D;  5GJW B;  1VQO A;  3THK A;  4RKU E;  2DTH A;  4IKF A;  2VVK A;  4M75 E;  2GF7 A;  4K12 A;  5GAN 7;  1U06 A;  3EFR A;  2L0A A;  4JJD A;  4RCC A;  4KGZ B;  3M0S A;  2JTE A;  3S6W A;  4IUT A;  2CP7 A;  5DLO A;  3NTH A;  1YI2 T;  1ZUY A;  2AZS A;  1EFN A;  2WAC A;  2QXF A;  3TSZ A;  2RHX A;  1IRE B;  3ER0 A;  4F7U G;  3GF5 A;  2R57 A;  4JRK A;  1SPK A;  4C8Q A;  5GAN f;  1ZBX A;  1W2B P;  1PHT A;  2AK5 A;  3CBP A;  2GTO A;  1FMW A;  5HKC A;  1KQS S;  4PJO F;  1V1C A;  3I5S A;  3M0Q A;  2FG0 A;  4KUI A;  4LDY A;  3QO3 A;  1NYF A;  2EWN A;  2OTJ T;  4AYM A;  3JCM h;  5CQX A;  5GAM f;  4CI0 C;  4Z8A A;  2DX1 A;  4JZ4 A;  2JJ9 A;  1Q82 C;  3BY7 A;  1RAH B;  3X25 B;  1NPR A;  4E7H A;  5LJ5 e;  2LCL A;  2BKD N;  2YHT A;  3OYC A;  4LDX A;  1K0X A;  4M78 D;  2VV5 A;  5HY6 A;  2DL7 A;  2SRC A;  5J26 A;  4C8Q G;  3RES A;  4M7A A;  3CC7 A;  4JRP A;  3PVL A;  3HFN A;  3V8J A;  3FIF A;  1M1K R;  1JJ2 P;  2LJ3 A;  5CKH A;  2EYQ A;  2QGF B;  2QQB A;  2XQW C;  4KRT A;  4M77 E;  1VQL T;  3OSS C;  4BDY A;  4XU1 A;  4A54 A;  1PM3 A;  5FLX E;  3PVQ A;  4X1V A;  5M9O A;  2CH4 W;  1SRZ A;  2HQH A;  1AZE A;  4RTV A;  2RHU A;  7AT1 B;  2O2O A;  1SRM A;  2J6K A;  3LGF A;  2ZCF B;  1K73 U;  1NE8 A;  5GAN g;  1KQ2 A;  4FL6 A;  2XHC A;  4LXC A;  3CPW P;  5A2Q E;  1FWZ A;  1JB0 E;  1X2K A;  2JMC A;  3O8V A;  2QI2 A;  5GAN 2;  1QCO A;  1BKB A;  2W10 A;  1OJY A;  1QVP A;  1YI2 A;  3AHU A;  2AT1 B;  1KSW A;  2Y4X A;  3EG9 B;  4ZN1 A;  3OYB A;  4IUR A;  4DA4 A;  1AWO A;  3A8M B;  2DKG A;  4RMO A;  2KXC A;  2DBK A;  4M7A G;  2PUK B;  4BUG A;  4F4O C;  3MEU A;  1VQ8 T;  4M78 G;  4C92 E;  4DOW A;  1G4F A;  1X75 C;  1D0X A;  4FW2 A;  3T5O A;  3VYG A;  2O31 A;  3V8L A;  8ATC B;  2A3L A;  2WII C;  2DXC A;  3L1A A;  5GAO p;  2XI9 A;  1VQL Q;  3I56 A;  2JMA A;  5KYY B;  1T0J A;  3KXV A;  2KYB A;  2F2X A;  3JCM e;  1KQ1 A;  3A1P A; 
#chains in the Genus database with same CATH homology
 3OS5 A;  5LJ5 f;  3PMI A;  5CK9 A;  2DD5 A;  5CKB A;  3WVD B;  1G3T A;  3OYD A;  4N4I A;  4EMK A;  4MZP A;  5GAN 4;  1YBY A;  3M9Q A;  5CIU A;  3FDR A;  2E12 A;  3JCM c;  3QJY A;  3TU4 K;  3L2W A;  4FIB A;  4L5G A;  4XQ3 A;  3PIP A;  4R56 A;  2F5K A;  2E1H A;  5LJ5 h;  1W2B S;  2KQW A;  1I4K 1;  1KQS A;  2HBP A;  1YJN T;  3KUF A;  1NJI U;  3ZEH A;  5LJ3 d;  4N0A A;  1KC8 U;  4CRI A;  4IUQ A;  2XG8 D;  4JRQ A;  4X9D A;  5HK3 A;  3PIO A;  1YJ9 A;  4MMK A;  1KG1 A;  2DAQ A;  3F6K A;  3M59 A;  4NL2 A;  4LDV A;  2EAY A;  5GAM d;  4M75 A;  3CCJ A;  2BIV A;  2DXB A;  3VKI A;  2K2V A;  3JB9 D;  3P8D A;  4M7A F;  1D3B B;  1SSF A;  3SDZ A;  3OYH A;  1OZ2 A;  2IVW A;  2Y8T A;  3JRZ A;  5CKF A;  2KY9 A;  4EPC A;  5GAO r;  4E47 A;  4ZTJ A;  3LWH A;  1YIJ A;  2F5T X;  3CME A;  2EFI A;  2RJF A;  3CCU A;  2V8K A;  3JB9 J;  3QDR B;  3I56 T;  1QW1 A;  2O4X B;  4RG8 A;  4M77 F;  3KXT A;  1QP2 A;  3M4G A;  4JS5 A;  4M77 D;  5CO7 A;  5GMK m;  4M7A A;  2Y8S A;  2EJ9 A;  1LNX A;  4ATO A;  2KDS A;  3L2Q A;  2B8A A;  4TVR A;  4PLL A;  3SWN B;  5CKE A;  4M78 B;  1BI0 A;  4PNO A;  4JS4 A;  2DPP B;  3PT9 A;  1BI1 A;  4OB1 B;  2LTO A;  3QXE B;  4J8O A;  2FHD A;  5LJ3 g;  1N6A A;  4XTV A;  2LT4 A;  5I21 A;  4MDW A;  1YIJ T;  2CZ0 B;  2OAU A;  4JLG A;  4C8Q F;  3QUI A;  4MSL A;  2MMP A;  2YLB A;  4PJO D;  1WQW A;  3SWN A;  1WJS A;  3FRN A;  1KHC A;  5GMK j;  1VQN A;  3H8Z A;  3E9G A;  4A4E A;  5LJ3 e;  4BAC A;  2QA4 A;  3PFS A;  1YJW A;  2RHY A;  5LJ5 j;  5FU6 C;  4A4K A;  3GP8 A;  3ME9 A;  3GIB A;  4BE1 A;  3WSX A;  4EMK C;  4Y91 A;  3OS2 A;  2MF2 A;  2LNV A;  1VQM T;  1X6O A;  3MO8 A;  1W2B A;  1K8A U;  4FU6 A;  3QPH A;  3HRS A;  2XK0 A;  4M78 C;  4NL3 A;  2RH2 A;  2F69 A;  3CD6 T;  3TCJ A;  2KK4 A;  4XTX A;  4M7D F;  3PNW C;  2GQV A;  3QYG B;  3VUZ A;  2K3Y A;  1UGS B;  4N4G A;  2M0O A;  4XTY A;  5GAN h;  1PSF A;  2CYZ B;  2DZC A;  5GAO n;  3JB9 I;  3OYM A;  3CCM A;  2RHZ A;  3BFM A;  4MDX A;  1YCY A;  4KUL A;  4E7I A;  1XQH A;  3QZ5 B;  3G4S A;  3OYI A;  2K5L A;  3EAE A;  1DJ7 B;  3LX7 A;  4PJO C;  3OYJ A;  3JCM W;  2DZ9 A;  2DTO A;  1NZ9 A;  4L6V 5;  2D0Q B;  2VXE A;  4EMK B;  3JB9 G;  1U1S A;  5I2M A;  4FM4 B;  3MCA B;  3TEE A;  4MZM A;  3JCM g;  1Q7Y U;  2LCC A;  1UGQ B;  2JNG A;  2E6N A;  3JCM f;  3G71 A;  4GY5 A;  4C92 C;  2ZPG B;  3M53 A;  5GMK i;  2K5F A;  1VQO T;  3HHT B;  1UGP B;  3KBG A;  3CMA T;  5D6Y A;  4ZGJ B;  4HT9 A;  2RB6 A;  1Q81 C;  3ASK A;  3LW5 E;  2XDD A;  1M90 U;  2MI6 A;  3I55 A;  1KC8 C;  4Q5W A;  1Y96 B;  1NJI C;  1ZQ1 A;  2LC4 A;  1XTD A;  1WJQ A;  2PVD B;  4BY6 B;  2WSE E;  3I55 T;  3CCM T;  3JSC A;  4OB3 B;  5GAN 8;  4ZN3 A;  3RKX A;  1YHQ T;  3CCS T;  2MWP A;  4HCC A;  4PJO B;  3S3N A;  4DOV A;  1WGS A;  4M77 B;  2A7Y A;  5L8R E;  4A53 A;  1N9R A;  2GCX A;  2KAF A;  3VV0 A;  2E65 A;  2RI2 A;  3RKY A;  2BUD A;  3CMA A;  2R5A A;  4C0Z A;  1Q7Y C;  3V7S A;  4X34 A;  3QSU A;  3BDL A;  1K9M C;  4ZGD B;  2XDB A;  4M78 F;  4F7U E;  3CCQ T;  4BDZ A;  3J81 E;  1Q86 C;  5GAN j;  3QZ9 B;  1RI0 A;  3HP9 A;  4ZTF A;  3DB3 A;  4JUV A;  1JJ2 A;  1X01 A;  4J6W A;  1U1T A;  2KVQ G;  3GPL A;  3C12 A;  4BE0 A;  4IUP A;  3X28 B;  4M75 B;  2EKO A;  4BI8 B;  1JRI A;  3G7Z A;  1VQ7 T;  2OTL T;  1VQ9 T;  1VQP A;  1OYX A;  2EQU A;  3NFC A;  3JCM Q;  1NPP A;  4IUU A;  2DXU A;  3ZBD A;  4J6Y A;  3E19 A;  1O75 A;  3FLG A;  3M5A A;  3CCR A;  3A8O B;  2XD0 A;  2DEQ A;  4V2S A;  1PSE A;  1M1F A;  4GLK A;  2DVE A;  2JUF A;  3X24 B;  3CCS A;  3FJP A;  1M1G A;  3CBO A;  2NLU A;  5LJ5 d;  2MWO A;  5GAN 5;  3DKM A;  1AHJ B;  2L89 A;  4QQ6 A;  4BI4 A;  3FEO A;  5GMK l;  3CEY A;  3RIR A;  4XU0 A;  4C5G A;  5C6S A;  5A0D A;  2WSF E;  4YTL A;  3FGT A;  2RK1 A;  3RMS A;  3ZFJ A;  3PTA A;  1WNL A;  2LQ8 A;  4J7I A;  5CVI A;  3OYN A;  1VQ4 T;  1BI2 A;  3UPU A;  4M75 C;  3M54 A;  5HK0 A;  1YJW T;  2X4J A;  3CCL A;  3LH0 A;  3P8H A;  4JLI A;  3DLM A;  5LL6 S;  2LRQ A;  2P0Q A;  3NTI A;  3N5B B;  3CPF A;  3E1S A;  2LQK A;  2Y4Y A;  5KCH A;  2RI3 A;  4XTZ A;  3LGL A;  3MEW A;  4FSX A;  1YJ9 T;  3ZLD A;  3MP1 A;  4M77 A;  2HQX A;  4OVA A;  3MHX A;  3INZ A;  3CCJ T;  4M7A C;  2E64 A;  3A8G B;  2O01 E;  2PQW A;  1H3Z A;  3DLL A;  2L3R A;  1HXD A;  3CCE T;  1Q82 U;  2X4Y A;  3OY9 A;  1G3W A;  3OSV A;  4XTW A;  2X35 A;  1YJN A;  3S3O A;  4LDW A;  3UT1 A;  3M56 A;  3QJ6 A;  3G71 T;  4A4H A;  2K3X A;  3HSB A;  3JCM V;  4NOY A;  3QBY A;  3RKW A;  5GAM j;  5A0L A;  2OTJ A;  1N8R C;  3UDC A;  4C8Q B;  1M8V A;  2RM4 A;  3OBY A;  1Y71 A;  4M75 D;  4UC4 A;  3BW1 A;  1RL2 A;  2RJC A;  3CC7 T;  4M7A E;  1WJR A;  1LOJ A;  1XNI A;  2PUO B;  3QKJ A;  2EJF A;  2L5Q A;  3JCM P;  2P4T A;  4J7F A;  3VJP A;  2QEX A;  1JBM A;  4E7L A;  1QVG S;  4APL A;  1KHI A;  4M7A B;  3G6E A;  4C92 G;  1M1K U;  4C92 B;  2JTM A;  3TRE A;  2E70 A;  4O5V A;  5GMK h;  3MEA A;  4PL6 A;  3OMC A;  5GAM h;  1QVF S;  4XU2 A;  3UWN A;  1G3Y A;  4N4H A;  4EDU A;  3J7A F;  5GMK e;  1Y7X A;  4BB7 A;  1P92 A;  3CCE A;  3LYI A;  2H3J A;  4J6X A;  4BI3 A;  3OYF A;  3C4S A;  3C95 A;  3OYK A;  4EMG A;  1VIE A;  2ZPH B;  4JRI A;  4C5I A;  3FC3 A;  5KE3 A;  4F7U B;  3L2U A;  4E7J A;  4LDU A;  2E5Q A;  5IAY A;  5LJ5 g;  3FGR A;  4WF2 A;  2EIF A;  3RER A;  1N9S A;  2X4X A;  3X20 B;  1BIB A;  3OYL A;  3GNG A;  1VQP T;  4OGE A;  1VQ9 A;  3NTK A;  3ZLE A;  5GAN 6;  1M4Z A;  3FB9 A;  3LLR A;  3M55 A;  4MZT A;  3T9N A;  4B9X A;  5KE2 A;  3JAM E;  2LDM A;  2QQA A;  1R8O B;  2EQJ A;  5CQY A;  3SFM A;  4PJO A;  4N7E A;  3A8H B;  2LVM A;  2E6Z A;  5FU7 C;  2K5I A;  3RMQ A;  3WXM B;  5CR2 A;  2CGH A;  5CKD A;  4RCB A;  5C0M A;  1BI3 A;  2X4W A;  3QG1 A;  3CXC S;  4FT2 A;  5J3B A;  3SB2 A;  4M7D A;  1M5Q 1;  4XK8 E;  4Y28 E;  3M58 A;  4OB0 B;  3HKS A;  4OP0 A;  3VUB A;  1VQN T;  2M1H A;  5LJ3 f;  3L2R A;  4BWC A;  4MML A;  4B9W A;  5GAN d;  3E9F A;  3M4Y A;  2PVO B;  1OI1 A;  2K57 A;  3R6O A;  1BIA A;  2JZ2 A;  3OBW A;  4M7D E;  4QW2 A;  2OTL A;  1YIT A;  1I5L A;  2LX9 A;  5I2S A;  1UEB A;  4C8Q D;  4KUD K;  1VQO A;  1M1K C;  4F7U A;  4HT8 A;  4O6J A;  4M78 E;  4RKU E;  4F7U F;  2R58 A;  3JCM J;  3EFS A;  2DTH A;  2G3R A;  2RJD A;  1W4S A;  2ZPE B;  3URG A;  4C0G A;  4M75 E;  2GF7 A;  2JVV A;  3CC2 A;  5A0G A;  1GXI E;  5GAN 7;  4M7A D;  2PVG B;  3EFR A;  3OS1 A;  3CCV A;  4RCC A;  4PKC C;  1S72 T;  5EG2 A;  4M75 G;  2PU9 B;  3CCQ A;  1LJO A;  2M16 A;  4KBM B;  4ELZ C;  4ME7 A;  3S6W A;  3WSY A;  2M9U A;  4IUT A;  2RA2 A;  1B34 B;  2QDY B;  5FU7 B;  5DLO A;  4BY6 C;  3NTH A;  4XAX B;  4JJN K;  3HRU A;  1YI2 T;  2DIQ A;  2Y90 A;  1JJ2 S;  1VUB A;  3OYG A;  2WAC A;  1I81 A;  1XOV A;  2QXF A;  5IN1 A;  5CAI A;  1N27 A;  2RHI A;  1ZHI A;  2YLC A;  2RHX A;  4QVC A;  3BDU A;  1IRE B;  3ER0 A;  4F7U G;  5GAO q;  3GF5 A;  2R57 A;  4JRK A;  4C92 F;  3OYE A;  3LWI A;  1K73 C;  5GAN 3;  4C5E A;  2DIG A;  4C8Q A;  4D6W A;  5GAN f;  1ZBX A;  4A4G A;  2RO0 A;  2ZPF B;  4XTU A;  2HAX A;  3CBP A;  1I8F A;  3CCV T;  1K8A C;  2HNI A;  3L2Z A;  2FL7 A;  5HKC A;  1KQS S;  4PJO F;  1VQK A;  2MAM A;  2VYT A;  1Y07 A;  2DK3 A;  4KUI A;  2QA4 T;  1KD1 C;  4LDY A;  4QQD A;  3QO3 A;  1B34 A;  2DXT A;  2EJG A;  4FT4 A;  4OF1 A;  3H6Z A;  3A5Z B;  1HK9 A;  4J83 A;  2XDP A;  3CCL T;  1WPY A;  2EWN A;  2CS7 A;  1OZ3 A;  2OTJ T;  4M7D C;  5DLQ E;  3JCM h;  5FRO A;  3OS0 A;  1VQ4 A;  5DY9 A;  5CQX A;  5GAM f;  2C06 A;  4CI0 C;  2QQ9 A;  4DQ2 A;  2AHJ B;  2VXF A;  3HRT A;  3PMT A;  4HCZ A;  4M7D G;  3OYY A;  2XID A;  3HFO A;  3MP6 A;  3CPW S;  4C0F A;  2R5M A;  3BY7 A;  2JTF A;  4ELY C;  1Q82 C;  1QVG A;  1VQ6 T;  3X25 B;  2DD4 A;  2EQK A;  1NPR A;  4J5Y A;  1Y96 A;  4YIZ A;  2CKK A;  1G3S A;  4C8Q E;  4E7H A;  1QP3 A;  3P8B B;  3G6E T;  5LJ5 e;  3SD4 A;  1VQM A;  4C5H A;  1VQ5 T;  2LCL A;  2BKD N;  2YHT A;  3OYC A;  4LDX A;  2P0P A;  3A8L B;  4M78 D;  4RG2 A;  3OW2 A;  2KSS A;  2VV5 A;  2ZZD A;  3OQ5 A;  4QQG A;  2ZGW A;  5HY6 A;  5J26 A;  2V8I A;  3RES A;  4C8Q G;  5CCA A;  5J39 A;  4L59 A;  3NJA A;  3CC7 A;  2K4Y A;  2HD0 A;  4JRP A;  3HFN A;  2DJZ A;  4C8Q C;  3J80 E;  5FRN A;  1Q86 U;  3DB4 A;  4C0D C;  2GFU A;  1IZ6 A;  1N8R U;  3V8J A;  4NS5 A;  2ZPI B;  2DO3 A;  3FIF A;  3GOX A;  4EMH A;  2XKO C;  4HA8 A;  2L8D A;  4XU3 A;  2IG0 A;  5CKH A;  3GLX A;  2EYQ A;  5LJ3 h;  2QQB A;  3OA6 A;  3MET A;  3HL8 A;  2QQR A;  4M77 E;  1VQL T;  4M77 C;  1TH7 A;  4LD9 K;  1VQ6 A;  4KT0 E;  3OSS C;  2EQM A;  4BDY A;  4PLI A;  2FB7 A;  4XU1 A;  3CBM A;  1VIF A;  4A54 A;  4C92 D;  4M77 G;  1M90 C;  3VU3 C;  1H64 1;  3OB9 A;  2QTX A;  5FLX E;  3MEV A;  1D3B A;  2QEX T;  5M9O A;  3CCU T;  3F70 A;  4C0D B;  3L42 A;  4A4F A;  2FYK A;  3HPW A;  5LJ3 j;  5FU6 B;  5D6W A;  1M9S A;  1S72 A;  3OMG A;  4II1 A;  5DM7 R;  2RHU A;  4QVZ A;  4VUB A;  4OGC A;  1K9M U;  2Y8R A;  2DTI A;  1VQK T;  2FVU A;  2KMT A;  3LGF A;  2ZCF B;  1K73 U;  1NE8 A;  2P0K A;  3MP8 A;  5GAN g;  4FL6 A;  5GAO m;  1KQ2 A;  4ZGE B;  2XHC A;  2VGN A;  2JOY A;  3CXC A;  5GAO l;  3OYA A;  4Z02 A;  3G4S T;  4M7D B;  5IT9 E;  1G5V A;  2XIC A;  5A2Q E;  1FWZ A;  1MGQ A;  1JB0 E;  3GNF B;  1O9S A;  3O8V A;  4OMF B;  1MHN A;  2QI2 A;  3QII A;  4M7D D;  4HCB A;  4LD6 A;  2GFA A;  5GAN 2;  4C92 A;  1BKB A;  3JCM d;  3QYH B;  2E41 A;  4HKE A;  4N0A C;  1EIF A;  3L2V A;  1VQ7 A;  3OW2 S;  1QVP A;  4E7K A;  4M75 F;  1YI2 A;  1VQL A;  3JCM X;  3AHU A;  2CZ6 B;  2Y4X A;  3C94 A;  4X9C A;  3JB9 F;  1QVF A;  4ZN1 A;  4OB2 B;  5KH6 A;  2RI5 A;  3OYB A;  5FRM A;  4IUR A;  3CPW A;  2VUB A;  3QHS A;  4DA4 A;  1VQ5 A;  3VYH B;  3CC2 T;  3A8M B;  2DKG A;  4RMO A;  3V8K A;  3CC4 A;  2WSC E;  4R55 A;  2HQE A;  3JB9 H;  5GAN e;  3Q1J A;  2VC8 A;  4JDS A;  1YHQ A;  5AYF A;  3M57 A;  1FX7 A;  4M7A G;  2PUK B;  3CCR T;  3WVE B;  1YIT T;  3S3M A;  5GAM e;  4BUG A;  4IUV A;  3SWN C;  2RK2 A;  3PGG A;  1U8R A;  2RJE A;  2D9T A;  3MEU A;  1BYM A;  3V7R A;  1VQ8 T;  2V8J A;  3CME T;  2CZ1 B;  4M78 G;  2D6F A;  3V7C A;  4C92 E;  4DOW A;  1FXX A;  1X75 C;  2VGM A;  1VQ8 A;  2ZPB B;  3VYG A;  3X26 B;  5GAM g;  4IKF A;  3V8L A;  2X2Z A;  2O4X A;  2A3L A;  4PO7 A;  4PJO G;  1Q81 U;  2DXC A;  5D6X A;  3L1A A;  5KCO A;  3CC4 T;  3CD6 A;  5GAO p;  2XI9 A;  1V29 B;  4BE2 A;  1KD1 U;  2I2L A;  1WQ7 A;  3JCM b;  3I56 A;  4PJO E;  1UB4 A;  2CZ7 B;  2YRV A;  2JN0 A;  4M78 A;  2E10 A;  2QQS A;  1UGR B;  4P5N A;  3RUX A;  2RD1 A;  3JCM e;  2XU8 A;  1KQ1 A;  4BD3 A;  2LT1 A;  4QVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...