4WJG2

Structure of t. brucei haptoglobin-hemoglobin receptor binding to human haptoglobin-hemoglobin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
314
structure length
310
Chain Sequence
CPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Hemoglobin subunit alpha
publication title Structural basis for trypanosomal haem acquisition and susceptibility to the host innate immune system.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus n315
total genus 58
structure length 310
sequence length 314
chains with identical sequence C, H, M, R, W
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4wjg201
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wjg203
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wjg202
1GJ4H 1P2IA 4TYDA 3SU6A 2I6SA 2O8TA 3K6YA 4FUGA 2D2DA 3GDUA 3BV9B 1FAKH 2P94A 3VB4A 5JDUB 2VVVA 1OXGA 5JB9S 2P3TB 1GMHG 2KRIA 1WV7H 1B7XB 2W26A 1P12E 1SMFE 1GI9B 5BPEA 2W3KA 5AHGH 3PMBB 3MNSA 3SGBE 2FX4A 4NIWA 4Q7YA 1F0UA 1AVGH 1GMCF 4GAWA 3A89A 1GBHA 3LGYA 1FY1A 2A5IA 4X8UH 3BTKE 1QURH 1OWJA 3RMLH 1O2PA 2AIPA 4X8VH 9ESTA 1JRTA 1SHYA 1Y8TA 3SV7A 2Y5FA 2OXSA 2VIPA 1HFDA 1KXAA 2ZKSA 4WH6A 2BHGA 1QY6A 5A8XA 4ZKRU 1XVMA 2NWNA 4IMQA 2ZZUH 5EQSA 2KMSA 1FUJA 2QXJA 3GCNA 1TMTH 2QAAA 1VITF 1PPFE 2AERH 2FS9A 1OX1A 2QGRA 1EZXC 3RU4E 5EODA 3RU4D 3ERBA 4B2BA 3B9FH 1GCTC 1O2QA 3IX0A 3MH6A 1GL0E 4X6MA 3RDZA 1GHVH 1S6FA 1GBTA 1TRMA 1A0HB 4Z6AH 1RTFB 2ERJA 1QGFA 4I8LA 1YC0A 1O2TA 3Q3YA 3VB5A 5JBCS 1G32B 1DUAA 4D76A 1O2ZA 4BTTB 1WQVH 2Y81A 1LPKB 5DP6A 1H8IH 4MNVA 2PWXA 3EGKH 2C8WB 1F0TA 1LKAA 4IC5A 4OS5A 2CJIA 2DUCA 3BTGE 3HGNA 4AFZA 1O3IA 1TMUH 2C8ZB 5H4IB 1YPHE 1NFWA 1OS8A 3A88A 4J1YA 5G4BA 4K8BA 4NSYA 1GI5A 3F9FA 2O8WA 4Y7AA 2UUKB 2PHBA 1NS3A 1W3CA 1PYTC 1ACBE 4JYVH 1DSUA 3TK6A 1BOQA 2W80A 1C5RA 1P2JA 3A86A 1C2DA 1AUJA 2HVXA 3UTUH 1AWFH 5GJ4B 1GMDG 1KLJH 1P10A 5ESBA 1KXFA 2RG3A 4E7RG 1SQAA 1P9SA 4AZ2B 1OJVA 3SNBA 1OWIA 1VCWA 1MQ5A 1HFIA 1ZJDA 2F9PA 2ZGCA 5FCRA 2EI7A 2R3UA 4RKOB 3QLPH 2B7DH 4XE4A 4IBLH 1SLVB 5C67A 3QTVH 3FAOA 1GI3A 5DP5A 4X6NA 1XKBC 1WOFA 1HAYB 1ZSKA 1NO9H 1ETTH 2ZF0H 1BZXE 2Z9JA 3CP7A 1CHOF 1O37A 2ZU2A 3GCHB 1TNGA 1MD8A 1ABIH 1DANH 3FP8E 4ISIH 1FIZA 1GGDB 2J94A 2ZU1A 1UTMA 5E8EH 1ELBA 1TOMH 1H2PP 1NM6A 1F5KU 1O5EH 1K1JA 4XBDA 2G4UA 2ASUB 2VWMA 4RN6A 1NFXA 2XC5A 2J38A 1QB6A 1G2LA 3CENA 2RLPA 4BAHB 1LQEA 3I77A 1HLTH 1FMGA 1FDPA 1C2MA 1FN8A 2Q1JA 2A2XH 1VITH 1B5GH 1EJAA 3BN9A 4Q2KA 3UNRA 4D9QA 3BF6H 3BG4B 4K12A 2QN5T 3V7TA 1MH0A 1TPSA 1T8LA 1AKSA 1HJ9A 1TGTA 3FZDA 4Y8XA 3EDXB 4WJG2 3UREA 4VGCC 2BXUH 4K2YA 3TIUA 1UHBB 2PW8H 3M35A 4OS6A 1O9AA 1OP2A 1LVBA 1C4V2 5DP8A 1T4VH 1UTJA 2VJ1A 1MKWH 1QQUA 3MQLA 1O32A 1DITH 1CBWC 1TNLA 2WINI 2Q6FA 3ZYDA 4OS2A 3QGNB 1G2MA 5FBEA 1HAPH 4JZDH 2HALA 1C5PA 3P70B 2XC4A 1HAXB 5CHAC 1D3QB 1C5SA 3O8EB 1V2WT 4MPUA 3SI4H 3A7XA 4IGDA 3ZZBA 4Y76A 1QR3E 4ISLA 1GJDB 3Q3KA 3GY6A 2BVSH 2AGEX 1FNIA 2PTCE 4K69A 4MLFB 3TJUA 3MH4A 4Y11E 5EPYA 3VXFH 4I31A 4BOHA 1CT0E 3LH1A 1CE5A 5TCAA 3V13A 4CBOA 1HFHA 4A7IB 1C5VA 2GMTC 1AU8A 3LC3A 1NROH 4I8HA 2OTVA 2EA3A 4Q7ZA 2HPQH 2FI4E 4Y7BA 1O2XA 1EPTA 3SHAH 3T27A 5JPMG 2FP7B 1P3EA 3LOXA 1MTNC 4MPXA 2EI8A 1UK2A 1HJAB 3SZNA 3V3MA 3SV9A 5ABWA 1C1VH 2ZDLA 3PLKA 4Y0YE 3BTEE 5F8ZA 3RXOA 1MKWK 2HRVA 1A61H 1C2EA 5F8TA 3ZZ7A 4A1VA 3UQOA 3TNSA 2B5TB 5LPFA 2OP9A 4SGAE 2SGEE 2WPLS 1H03P 2FWWA 1A5IA 2WUCA 2BDHA 3TH2H 2OQ5A 3GYMA 4KTSA 2ULLA 4X1PU 1O5DH 1FJSA 3SNAA 2BD2A 1AB9B 4A1TA 1AFQC 1QQ4A 2AH4X 2XRDA 2Q6DA 4RKJB 3U8RH 2Q6GA 2RA3A 2KAIA 2XWJI 5C1UA 1LKBA 1LQDB 1BMAA 2BMGB 1ZTJA 2SFAA 2ZWLH 1KDQA 4FUHA 3K65B 1TGNA 2G81E 1Z92B 3F68H 3SJIA 4TPIZ 2WPMS 1B0FA 1UCYE 3I29A 4K1SA 1K1IA 1SL3A 3K6ZA 1S84A 1LMWB 1HAVB 3RXIA 1O3JA 1NRSH 1UTQA 1S6HA 1TGBA 3RP2A 3TJVA 1C1UH 3EA7A 3KF2A 2UUYA 1BTWA 2F9OA 5J4QA 2PTNA 3NXPA 1C9TA 4ABAA 2FS8A 4ZXYH 1FQ3A 1RFNA 2C8YB 1ELDE 1E38B 4MNWA 1BJVA 1S0RA 3PROA 1BITA 1GHAF 1GHWH 2XCNA 3PLBA 2BXTH 4BNRA 3UQVA 3AW1A 1SGEE 3K2UA 4MNYA 4ZHLU 1VCQA 1TX6A 4GHTA 2Z94A 4DGJA 4FVDA 1O5GH 5F03A 3OY6U 2ODQA 1Y3XA 1N6YA 1NC6A 4X2WA 1PPEE 2D26C 2ZHEH 1DXPA 1LPZB 2GVFA 4ZMAH 1YPMH 1XX9A 2PFEA 2P3UB 1TBQH 3SORA 2HLCA 4X2XA 5HYUB 1OJWA 4UFGH 5C1XA 2V8EA 3MWIU 1O3DA 1W12U 2GZ7A 3AW0A 3D62A 1AZ8A 1O34A 1P2QA 2FI5E 3FVFB 3PYHA 2FXRA 4KTCA 3VEQB 2DE9A 2PKSB 1LPGB 4ISNA 3O8RA 1UK4A 1E36B 5EXLA 4X6OA 3M7QA 1GHBF 4MPVA 4NFFA 3KXVA 1V2QT 3JZ2B 2JH5D 4RSPA 1O2LA 2TBSA 3SUGA 2XBWA 1D6RA 1C1OA 2HWLB 1UVUH 3FANA 3LC5A 2ANWA 4KELA 2UUJB 5JYIA 1Q3XA 3MO3A 2ZO3H 5AF9H 1G3EA 2ALVA 1ZTLA 1YLCA 4B74A 3I78A 3KQEA 1QRZA 4QT8C 4B71A 4AYVB 5F8XA 4JZEH 3SNEA 4E7NA 1PPZA 1ZJKA 1AE8H 1CU1A 2ZFSA 5DP7A 3OP8A 1AVWA 2Y82A 1O3BA 3HATH 4YOIA 1BDAA 3S7HB 1ANCA 4HZHA 4DW2U 4GCHF 2VB0A 4BAOB 2IPHA 2IJOB 3SQHE 1UK3A 2G4TA 2WUBA 3GOVA 2BDCA 4CSYA 3M7PA 1L4ZA 3RMOH 1P8VC 1TLDA 4CRDA 4OGYA 3GDSA 2R2MB 1G3DA 3BTTE 3PMHB 1MZAA 2A1DB 1EAXA 8ESTE 3MH5A 2PSXA 4CHAB 2Z9LA 1G37A 5GXPA 2ZU4A 5HZPB 1ARCA 2OC1A 3U9AH 1BIOA 2G8TA 2C90B 4YOJA 4TY7A 2QC2A 5GPIB 3TVJB 1C5LH 1F7ZA 1SLXB 4AN7A 1QRXA 3VB7A 1FY4A 3QGJA 1W14U 3KIDU 1BBRH 2ZFQH 1YPJH 1G3CA 2BYAX 1O2UA 2BDYA 1GL1A 3M5OA 1FY8E 5HM9A 4BANB 2ZHQH 5DP4A 1EB2A 1TBZH 9LPRA 2QCYA 3TGKE 3A7YA 1AE5A 3L33A 1AFEH 4GUXA 4JCNA 1TGSZ 2B5ID 1MU6B 3TNTA 5T3HA 1EJMA 3TITA 1GBBA 1A5GH 1GBCA 3A82A 2FLBH 1W2KH 3NK8A 1O3LA 4O03A 3ZVDA 3UNSA 4MUCA 3BTFE 3SGAE 2FX6A 1NN6A 1NPMA 1O3NA 1VCPA 1YM0A 5EXNA 1ELAA 2ZPQA 4CRAA 1Y3VA 3LONA 1C1MA 1AUTC 1AD8H 2WYGA 1THRH 1KSNA 1TFXA 1DWDH 1G4GA 3ELAH 1QBNA 3OY5U 1IAUA 4UEHH 3E1XB 2OCVB 4YLQH 3VB6A 5DG6A 1H2QP 5EQQA 1GBJA 1P03A 2BLOA 2A31A 4ONTD 4DJZA 5FPYA 1F2SE 2Z6BD 3ATWA 2VU8E 4U30A 3U1IB 2TGDA 1XXDA 4LK4A 3PWBA 4ZXXH 1C5NH 3QO6A 2GD4B 2Z9KA 4JZIA 4H6TA 2A55A 1DLEA 5L2ZH 2ZGXH 2FOFA 4TWWA 7GCHG 3TGIE 1GJ5H 4ZKOU 1GG6B 1NRQH 4C16A 1EAUA 3SU4A 1Y59T 4D7GA 1DY9A 1HNEE 2GT8A 5GCHG 1K1LA 2OINA 1G36A 1L2EA 2AYWA 2XBYA 1JIMA 1TAWA 2LNCA 5A09A 3GCTG 2UWLA 1HB0B 1GJAB 3EE0B 4NGAH 1ELEE 4MDSA 4DT7B 2TGPZ 1Y5BT 1SOTA 1O35A 1C2HA 1K21H 1GBDA 5DK1A 3DFJA 2QY0A 2JETB 2H5CA 4JHSA 3PTNA 3PV4A 5C1YA 4XFQA 2VVUA 1MMJN 1XUFA 1GBFA 1VZQH 4XSKU 3ZZAA 2FO9A 3FP6E 4WY3A 2P93A 1JOUB 4AYIA 1IQGA 2PV9B 5E0JA 1CT4E 2AIQA 2QXGA 3ATKA 2BDAA 4INLA 4Y8YA 4O3TA 3C1KA 4INKA 2G5NA 5DKMA 4GSOA 2SGFE 4TWYA 2JGXA 4PROA 2XWBF 2ZFFH 2GKVE 4GVUA 1KTTB 2A7HA 4O3UA 2W7SA 1QCPA 4NWKA 3KGPA 4JZFH 1AMHA 2CGAA 1DY8A 1ZMLA 4HFPB 2R9PA 1BQYA 1LVMA 5IYTA 2NU0E 2ZFRH 1ZPBA 3RXEA 3VPKA 1A3EH 2H5DA 4DVAU 1P02A 1ANBA 2RCEA 4AYDA 1C9PA 5C2ZA 2RKZA 1TABE 2FPZA 1QJ1B 1SG8B 1GHYH 3E8LA 4K60A 5LH8A 3ZVBA 1HRTH 4FU8A 1O33A 3QWCH 3M7UA 1ZMJA 5LPRA 1TONA 4R8TB 4X1QU 1SQTA 4IN1A 3RLYH 4A6LA 1GHXH 1O2YA 1CA8B 1OP8A 5TJXA 4YM9A 2XYAA 2J92A 2QIQA 1TALA 5F6MA 4MVNA 3KQDA 4I8KA 1EATA 1VGCB 2Z3DA 4TPYA 3SQEE 2A4GA 3U98H 4J2YB 3ESTA 1YLDA 1O2MA 4WH8A 2ODYB 2ZG0H 3SW2B 2GDEH 2R2WU 4I7YH 2FOAA 5EW1H 1YCPH 3GXEA 1LY2A 4R0IA 4ZH8A 3MI4A 2ZHFH 2J95A 1FPCH 4CBNA 1OK3A 1QJ7B 3NCLA 4AORA 4DG4A 3KN2A 1O2RA 3RXUA 2NU2E 2FOMB 3S7KB 2W5EA 1SPJA 3SJOA 3VFEA 2QV1A 4FUIA 1TNJA 1BT7A 1OWEA 1GDNA 3A8BA 2AMDA 1H8DH 1NT1A 3Q76A 2SGQE 1UVOA 4KTUA 1CT2E 2TRMA 1P05A 4IS5A 4KKDA 1LHCH 1TNIA 3RXAA 1SRZA 2AEIH 1MBMA 2O8MA 4AGKA 2BY5X 4K3JA 5K7RA 1B0EA 2IN2A 1C1WH 1SGNE 4ZH1D 3T5OA 1AGJA 2ZNKH 3BIVH 3A7TA 1GGDC 2ZCKP 1BUIA 5ETXA 2FOGA 3LJOA 3R3GB 1QL7A 1GI1A 5FCKA 4WXIA 4YLUA 3UWJH 1GVLA 4NZLA 4B73A 4AG1A 1F0SA 3GY8A 3ZZ4A 1S0QA 3RC4A 2YBYA 3T28A 4E06H 1SFQB 2BD5A 1A0LA 1MKXH 3VB3A 3LH3A 5EGMA 4Y71A 1G4FA 3BEIB 3JZ1B 1RXPA 1UTLM 2CG7A 3ZZCA 1PPGE 3TJOA 3BG4C 5L2YH 2XBXA 5C3NA 1BRAA 1WUNH 1Z8IB 3SU2A 2ZU5A 5EOKA 1HBTH 1A4WH 3F9HA 3HKJB 2CG6A 1XUJA 2BZMA 3SGQE 6LPRA 1OPHB 1XM1A 2C3SA 4H6SB 1RTKA 2Z3CA 1PPBH 1P09A 1JRSA 1QL8A 3SU0A 4X2VA 2PR3A 2CN0H 1OKXA 1SGRE 3BTDE 1F5LA 1V2LT 2HPPH 1V2NT 4BXSA 2XW9A 1HXFH 4Y6DA 2VIWA 3L3TA 1MU8B 1UTKA 3UWIA 1W0ZU 2XC0A 4YOGA 1ANDA 2P95A 2RDLA 5L30H 2CF9H 4ABFA 2THFB 4ABBA 6GCHG 1GBEA 2NU4E 3KCGH 1F0RA 1TNHA 1SBWA 1EAIA 3M61U 3KZJA 4WMDA 1L1GA 1EAWA 4AGJA 2BD4A 1LCYA 3P8GA 1O3AA 3SJKA 1EPTB 3QDZB 3UY9A 5EQRA 3MO9A 2QXIA 5FPTA 1QB9A 1C2IA 3UNQA 1GBMA 5HM2A 1O3CA 2RA0A 2VIDA 2WIIC 1HJAC 2XRCA 3MTYA 1FY5A 3SU5A 1C5ZB 1ZGIA 2FOBA 2FYQA 5HYTB 5LPEA 3V12A 2ZTXA 1C2FA 2A5KA 3C27B 1UCYH 2UWNA 4ASHA 1HUTH 2JH6D 3TJNA 1HAGE 8GCHF 3FZZA 1AQ7A 1N8OC 4ABIA 4MPWA 3RM2H 2R0LA 5GWZA 3B23B 1FY3A 3EAJA 3MHWU 5TCCA 4AOQA 1KDQB 1C5WB 2YOLA 4JMYA 1WAYB 1P3CA 3MU1A 1ZPCA 4BXWA 4YO9A 3URCA 3A7WA 3ITIA 5EXMA 1V2ST 1YP9A 2B8OH 5T6GA 1C2GA 1SFIA 2F83A 2OC0A 4UDWH 2HGTH 3L89M 1GMCG 2V35A 3SUEA 1SGCA 7KMEH 2VH6A 2EEKA 1DOJA 2CHAB 3PMJA 4A1XA 1HIAA 1HYLA 2BD7A 4B2SA 3RM0H 4AYEA 2ZA5A 3S69A 3UR9A 1CBWB 5HMAA 1QA0A 3BTQE 2G7IA 2P8OB 2O9QA 1DWBH 4B2AA 2QF3A 4AB9A 1ELVA 1IQIA 2FTLE 2I6QA 3MU4A 1MQ6A 2G5VA 1K28D 3E0PB 3U69H 3STJA 3ZVFA 1H9LB 4LOSA 1HCGA 3ATMA 1O5CB 2FODA 3ZZ5A 2XCFA 5HGGA 1VITG 1DICA 1QHRB 4I8JA 2BOKA 3Q77A 1DM4B 1XVOA 1QJ6B 4NCYA 2ZEBA 2V6NA 2Z9IA 4CH2B 3RMNH 1SGFG 1Z8GA 2VWNA 1ZPZA 3A8DA 3UFAA 1GI2A 5JBBS 3UR6A 4OS7A 1SQOA 2VIOA 1GPZA 1PYTD 2BVRH 3E16B 1WU1A 3DT0H 1QL9A 5CE1A 2GCHG 3D65E 3MH7A 4D8NA 4GPGA 3M37A 4XBBA 1KXDA 1ANEA 1TX8A 3RXBA 2PKSC 3QK1A 1FXYA 5GIBA 4MQAA 2BX3A 4LXBH 1RIWB 3F6UH 4UFFH 2CMYA 1DVAH 2FOEA 4WF8A 2TGTA 1C5YB 1BRBE 2B0FA 1V2UT 3A7VA 1EKBB 4ISOA 1OP0A 1T8NA 1EX3A 4JYUH 1GI7B 1O3FA 5EPNA 1DDJA 1GJ8B 1Q31A 2OUAA 2TGAA 4ZUHA 2Y5GA 4X8TH 3RXQA 1D6WA 1GVKB 1NESE 1IQJA 2IOTA 3T26A 1P2OA 3T29A 3TPIZ 5FXLA 1HAZB 4F49A 1IQNA 4AFSA 1LVOA 2ALPA 3RXVA 2Y80A 3ZRZA 3R0FA 2EC9H 3PWCA 6ESTA 3RUOA 1P11E 5CMXH 1AO5A 2A45B 4BTIB 4TY6A 1UVSH 1NRNH 2VGCB 3GY7A 1GMHF 3DUXH 2J34A 4X1NU 3SI3H 3OSYA 1WBGB 2ZFTA 1FAXA 1O2KA 1YPLH 1ZOMA 4GLYA 1O2OA 4IMZA 1UMAH 3NUMA 3SN8A 2HNTC 1CHOG 1T32A 3ODFA 2GV6A 4CR9A 4M7GA 4NWLA 1SOZA 4CHAC 1WSSH 3A81A 2GP9B 1H04P 2GX4A 1P2NA 3ZVEA 1V6DA 2MCYA 1SGYE 4ABHA 1MTWA 4OS4A 1TGCA 3MFJA 1O39A 1SLWB 1EUFA 3OYPA 1KY9A 1IOEA 2VVCA 1DE7H 1EZUC 2BQWB 4YESB 3TGJE 4U2WA 3T2NA 1ELFA 5DJ7A 5AFYH 1T7CA 4U32A 1O38A 2STAE 1O3OA 3LDXH 1YYY1 3RXTA 4X2YA 5IDKA 1TOCB 2C93B 1LTOA 4NA8A 1D3DB 1GHQB 2XNIA 3RXJA 4ZKSU 3LGIA 1VR1H 1LO6A 2V3OH 1HAOH 1HGTH 2TPIZ 3TK9A 1BMNH 4JK5A 2FTMA 1J17T 3SV6A 2O8UA 2MCZA 3M5NA 1Y3UA 2VH0A 4X8SH 3GY5A 3AVZA 1RRKA 3DHKH 2SNWA 4GHQA 4NA7A 1GBKA 4BTUB 2SNVA 4X1SU 1UTNA 3K9XB 4DOQA 3P6ZB 2ILNA 1V2KT 4Y8ZA 1FI8A 3QUMP 1QGBA 1S85A 1C2JA 1M9UA 1C1TA 1GJBB 1UO6A 3O8BA 1KYNA 1O2IA 2H2ZA 1PPQA 2P59A 2SGAA 1J9CH 2QA9E 4NZQA 3GDVA 5ESTE 2ZDMA 4UD9H 3ODDA 4HI3A 1QTFA 2VINA 1MD7A 4FUCA 2BB4A 4XBCA 1GMDF 1GBIA 2ANYA 4WMEA 1GG6C 2PSYA 2Z9GA 3E91A 1EQ9A 3KQBA 5FAHA 1Y5AT 1NRPH 1BTZA 1NFYA 1OK2A 1ID5H 1GI4A 1SGDE 3S9AA 2ZDKA 1HAHH 5JBAS 1K2I1 1Z6EA 2H1UA 3M5MA 1TMBH 5HYOA 1PQ5A 2ZQ1A 1F92A 1O2HA 1T31A 1FPHH 4X1RU 2QY0B 4FU9A 1BBRK 3RXSA 4AX9H 2BVXH 2BY7X 2ZCLP 1Z8RA 2IZ4A 4IN2A 3TVJA 2ZECA 3SO3A 4ZHAA 4MNXA 2ANMH 1O36A 4IW4E 3UIRA 3E0NB 1LHEH 1AY6H 3VGCB 1Z8JB 2FEQH 3O8DA 1GBLA 4K1EA 1OK9A 1DSTA 2A7CA 3P17H 1RTLA 1EOJA 2C4FH 4Y0ZE 1K22H 3PO1B 1ZHRA 4Q7XA 3A7ZA 3RC5A 2BTCE 4UONA 1C4U2 1KXCA 4CRFA 1VJ9U 4WWYA 1BTYA 3SV2H 5B6OA 1BA8B 2GTBA 1CO7E 1GJ9B 1L1JA 2W81A 1HDTH 1FV9A 3CALA 1MZDA 4YT6H 1TIOA 3TK5A 1FN6A 4ABEA 1X7AC 2OC7A 1GHAG 1C1PA 1CA0B 1OYQA 1TE0A 1P2MA 2D8WA 1AWHB 3RXCA 2FLRH 4UFDH 4CRGA 1THPB 2G51A 3IU3I 1RS0A 2YRAA 1C1SA 2BZ6H 4J38B 1TPPA 2M5TA 4FUJA 4INHA 1ZZZA 4YZUA 1CKLA 2XQWC 1A1RA 1FZZA 1RGQA 2FMJA 1YBWA 5E0GA 5C5OA 2XTTB 1IQLA 2A32A 1P2KA 1WTGH 3SJ8A 4CRBA 1Z1JA 5E2PA 5FO8C 5PTPA 3ZZ8A 5JB8S 2H9HA 4WVPE 4ZHMU 5T6FA 1OWKA 2ZGBH 1O3HA 1TYNA 1VGCC 3LGWA 2GV7A 2OBQA 1KIGH 3NPSA 5HXFA 1SGQE 3PB1E 5JBTA 5AVDA 2A2QH 2ZFPH 2GZ8A 1YPEH 1TPOA 1GHBG 4B75A 2LOJA 1N6XA 1VJAU 3T25A 4NSVA 1YPGH 1TA6A 2FIRH 2GCTB 1GDQA 1O31A 5A0CA 3RXKA 2PKAA 3LPRA 1Q2WA 1ETSH 2ZDAH 4PZ5A 1RJXB 4YTAA 1W8BH 4JYTA 4AB8A 1IHSH 1GJ6A 2JGWA 5A0BA 2BOHB 3S9BA 2RKYA 1QBOA 3BEUA 3V0XA 3CS0A 3P95A 6CHAB 4NFEA 1P9UA 1ETRH 4FVBA 3BTWE 1Y3WA 4BAKB 4ZKNU 2YNBA 3D49H 3AAUA 3DA9B 3SHCH 1U6QA 1D3TB 3MU8A 1C1QA 7ESTE 2BY8X 1W10U 5A8ZA 1KLTA 1S81A 3BTHE 4GCHG 4ABGA 1ZSLA 2D1JA 2FESH 3FP7E 3MNXA 3GY2A 4B76A 1A7SA 3P8OA 1N1LA 2ZC9H 4X6PA 4CRCA 1XUIA 1HJ8A 1GJ7B 3BTME 4MTBA 1W7XH 2H6MA 3MNBA 3H7OA 1ZMNA 3LGVA 4LZ1H 4LOYH 1NY22 1KXEA 1A46H 2F3CE 1ZTKA 1P01A 3EYDA 1V2OT 1XMNB 1WYKA 1E0FD 3ZVGA 5SGAE 2XWBI 1Z71A 5FHTA 3BEFB 3QX5H 2SGPE 2XRBA 2AGGX 3W95A 2GCHF 1O5FH 4AYMA 3AASA 3W94A 3GCHC 4I8GA 2VIQA 3KNXA 1K1NA 1SHHB 3KEEA 3ZZ3A 4AFUA 1GKGA 1C5MD 1KLIH 3BG8A 1EP5A 2CF8H 4HGCA 5FX6A 1ELCA 1CGJE 4B2RA 1XKAC 4IC6A 3ZZ9A 3ZD1A 2AGIX 1J14A 1O2JA 1SSXA 1YCPK 1V2TT 1HPGA 1GBAA 2ZCHP 1MBQA 3ZVAA 1BHXF 3SOSA 3ZV9A 2AFQB 2A7JA 3UOUA 2J4IA 1C1ZA 1E88A 1GCTB 2CV3A 2WV5A 1BTUA 2AS9A 2FZZA 5EU8A 1QBVH 1OK1A 2BD8A 2AMQA 1J16A 2WPHS 2BLWA 1TPAE 2P3FH 1DS2E 1AKSB 4OGXA 1BMMH 1C1RA 3ZD2A 3LKWA 4B2CA 3A8CA 1O3GA 4FUFA 1ZYOA 3PM3A 4Z0KA 5DPAA 3TLOA 1ZSJA 1P06A 3RXLA 1EPTC 3M3VA 5JPMH 3ZVCA 3KQCA 4DCDA 3SNCA 2A4QA 1F5RA 1H4WA 1OOKB 5DGJA 1J15A 5DP9A 2O39C 2W7UA 3HPTB 4FUBA 2FI3E 1VVDA 2ZGJA 4YT7H 1SI5H 3F9EA 3MYWA 1A2CH 1L0ZA 1BHXB 2XWAA 2AMPA 4XDEA 1SGIB 3MNCA 3MU0A 1PPCE 3UUZA 2ZDVH 3STIA 3GISB 2WYJA 1GI6A 1K9OE 1FONA 1CSOE 1OWHA 2ZTZA 2F9UA 1QNJA 1EJNA 4DY7B 2BX4A 1DWEH 1YPKH 3OTJE 1SGFA 1BTXA 1MKXK 3H5CB 3NZIA 4U01A 1PFXC 2CXVA 1Y5UT 2PLXA 3OEDC 1SR5C 1O0DH 3IWMA 1GJCB 3NWUA 4E05H 3ENSB 1SLUB 3SU1A 5FPSA 1P0SH 2JH0D 3N7OA 3H7TA 2LPRA 2F91A 1ELGA 3UOPA 3F1SB 2ESTE 1HIAB 1W11U 2J2UA 2V0BA 2CHAC 1D4PB 1U5MA 1GCDA 1ZR0A 2GDDA 2FDAA 1K1MA 2RL0A 1QFKH 1ZHMA 2PUXB 2EI6A 3ATLA 3Q00A 2ZPSA 2P8OC 1C2LA 5I25A 2EHFA 3RXHA 2H9TH 1AB9C 1LDTT 2KAIB 1WCZA 2ZHDA 1V2RT 2ZPRA 4DIHH 3TH4H 1ZLRA 3QZQA 3EA8A 4LOTA 4JK6A 1EP6A 1NU9A 1KXBA 1LHGH 1S82A 2F9VA 3U1JB 1G9IE 4NA9H 3R62A 3UPEA 1XUHA 3URDA 1TQ7B 4DIIH 2BDBA 1DFPA 1QRWA 1GWAA 1YKTA 4A5WB 1MTVA 1C2KA 2C8XB 2Y6TA 2OLGA 2WPKS 3M5LA 3Q3XA 4VGCB 1BJUA 1IHTH 2V3HH 2J9NA 1JIRA 4SGBE 1ABJH 1GHZA 1UHBA 1O2NA 1VVCA 2ZHWH 3GICB 5EG4A 2VWLA 4K5ZA 1PJPA 1IQKA 2G55A 4AYYB 1W13U 4XOJA 3NFPI 1YF4A 2NU1E 3RC6A 1UCYK 1S5SA 1E35B 2A4RA 4DURA 2BLVA 5CHAB 4YNXA 2ZU3A 1RIWC 1C5TA 3MO6A 2JRAA 1XUKA 1NWVA 1ARBA 1MCTA 4H42U 3HK3B 1SGPE 3RJ3D 2UUFB 4CREA 2BQ7B 3HGPA 4B1TA 1FBRA 1OYTH 1QUBA 1ZGVA 3GCOA 4HTCH 1SGTA 1N8OB 1MUEB 1LVYA 2GMTB 3E6PH 1J8AA 1TPGA 4AFQA 5C20A 3RXMA 3WY8A 2IZ3A 5T6DA 1O2VA 4THNH 5GDSH 3IITA 1O5AB 4BAQB 2JKHA 1MTNB 7GCHF 3LIWA 2F9BH 4ISHH 3PTBA 1E8BA 1A5HA 3A87A 2A4OA 1CGHA 1UJ1A 3RXPA 3IG6B 4UFEH 5GCHF 2VGCC 1PQAA 1H9HE 1SC8U 1OJYA 3LGUA 1IQMA 1W0YH 3D23A 3MMGA 1Y3YA 1CHGA 2ZGHA 4ZAEA 5BRRE 5EW2H 3T62A 1K1PA 1QIXB 4X0WU 3GCTF 1ZHPA 5A2MH 1NZQH 1A0JA 4ABJA 3RXGA 8LPRA 3ZZ6A 2UWPA 2VIVA 1AN1E 4AG2A 1LHDH 3M36A 1UVTH 4ABDA 3QN7A 1IQEA 1AFQB 3SJ9A 3AAVA 2W3IA 3A84A 1GDUA 1C5OH 2ZP0H 1NFUA 1BTPA 4NG9H 2RLQA 1BTHH 1THSH 2BLQA 4FXGH 2Y5HA 3CS7A 3DD2H 3QTOH 2PUQH 4ZROA 5A0AE 1JMOH 3RXDA 1FIWA 3E3TA 3M3TA 1DUEA 1O3MA 3SUFA 5DO4H 1MTSA 2TIOA 2BQ6B 3GOVB 1O3EA 1EZSC 1GI0A 1O3PB 3KL6A 1ZRBA 5AFZH 1HAVA 1C5XB 8KME2 1DPOA 2HOBA 1K1OA 1NTPA 1ZRKA 2CKUA 3SBKA 1AHTH 1ESAA 1TQ0B 1MCVA 1PPHE 2Y7XA 1BRCE 1TB6H 3P92A 2O8LA 3OU0A 3BSQA 1H1BA 1RD3B 2BDIA 2VNTA 4FUEA 3SV8A 2ZI2H 2ODPA 3TH3H 1C5QA 1OSSA 2H9EH 5J4SA 2GT7A 1GKNA 2P16A 2HNTF 3RMMH 1P57B 2Z3EA 1TRNA 4BAMB 4CR5A 1Z7KA 1TPNA 4KP0A 4O97A 3HKIB 1T8MA 2OQUA 2BDGA 2DE8A 1ORFA 1PQ7A 3DFLA 3U8TH 4FU7A 2BY9X 4A5TS 5E2OA 1L4DA 2XXLA 3E90B 1G30B 3SNDA 1W7GH 1QB1A 1HAIH 4D9RA 2G52A 4OS1A 3VXEH 1C5UA 3KHVA 3EA9A 4O9VA 2SGDE 3P8FA 3F9GA 1V2VT 5C5NA 2BM2A 2ZTYA 2R3YA 3A83A 4Q80A 4CH8B 2BD9A 3M3SA 3INBC 5I0QB 3MU5A 4F4OC 2B9LA 3EQ0H 1V3XA 1CQQA 3LGTA 3P8NA 1BCUH 1O2SA 1AVXA 1S83A 2K1QA 1OWDA 1LHFH 1YGCH 3RU4T 2A0QB 1TRYA 1H9IE 3OXUD 1T8OA 2ZQ2A 1E34B 2WV4A 1Z1IA 4WXVA 1UOTP 3LT3A 4I33A 1EXFA 2YNAA 4K1TA 4DJZB 3O8CA 1FLEE 3SUDA 8GCHG 4FXGG 3L6PA 1D3PB 4KGAA 4A92A 1DXWA 1DLKB 1TBRH 1UVPA 3RLWH 2FYRA 3VGCC 2UWOA 1V2PT 1AZZA 2WPIS 1HCCA 1AIXH 4ESTE 2VWOA 2NU3E 1O3KA 3PLPA 1YPHC 1O2WA 1BMLA 3PMAB 3B8JA 2A5AA 3SW0X 1AI8H 1BRUP 1KTSB 2OC8A 3LJJA 3PO1C 2WPJS 3HK6B 1SS2A 2QYIA 4WMFA 3GY3A 1P04A 2R0KA 1XUGA 1WQSA 1MAXA 2PGQB 2Y7ZA 1ELTA 2STBE 5K0HA 5L6NH 4Y10E 3ZYEA 1GI8B 3M7TA 1EZQA 3SU3A 3FFGA 5FX5A 5HYPA 1DWCH 5A8YA 2ANKH 2F9NA 1C1NA 3LU9B 2JETC 4H4FA 1MAYA 1EASA 3EJHA 5LGOA 1CA0C 4NIVA 3A85A 1DT2A 3ZZDA 3GY4A 2OBOA 1Z6JH 1ESBA 3NKKA 3TU7H 1C4Y2 2PGBB 7LPRA 1MTUA 2ZIQH 2FOCA 1WTHD 2GZ9A 4NIYA 1UTOA 1PQ8A 2OD3B 2FM2A 1TNKA 1QA7A 2GGVB 2EC3A 2ZDNA 1CVWH 1V2JT 1ESTA 2BZAA 2G00A 1TX7A 2BD3A 1O30A 1E5GA 4UE7H 1T4UH 4FUDA 3RXFA 6GCHF 1BBRE 2QF0A 4LZ4B 5DP3A 5FBIA 1HV7A 1EB1H 3OX7U 5I46H 1CGIE 3RXRA 1JBUH 1V2MT 3ATIA 1GVZA 3S9CA 1G3BA 1YCPM 1IQFA 4NIXA 1D9IA 3U8OH 3QZRA 2PKAB 1O5BB 2GCTC 1XXFA 1JWTA 1SB1H 3ZV8A 3A80A 3BIUH 4I32A 2FOHA 1SVPA 1O2GH 1UTPA 2BY6X 1TA2A 4Y79A 3T5FH 4MG3A 2QXHA 1TPMA 6CHAC 4K8YA 1L1NA 1EOLA 4D7FA 1QO6A 1TWXB 3S0NA 1JXPA 1DX5M 1BB0B 5E0HA 2Z7FE 3GYLB 3A8AA 1A3BH 1IQHA 3MOCA 4JZ1A 2XBVA 1E37B 1NRRH 1INCA 1HXEH 2HNTE 1NU7B 3G01A
chains in the Genus database with same CATH superfamily
1GJ4H 1P2IA 4TYDA 3SU6A 4P02A 2I6SA 2O8TA 3K6YA 3W1EA 4FUGA 2D2DA 3GDUA 3BV9B 1FAKH 2P94A 3VB4A 5JDUB 2VVVA 1OXGA 5JB9S 2P3TB 1GMHG 2KRIA 1W0JD 1WV7H 1B7XB 2W26A 1P12E 1SMFE 1GI9B 5BPEA 2W3KA 3UB0A 5AHGH 1K0HA 3PMBB 3MNSA 3SGBE 2FX4A 5GNDA 4NIWA 4Q7YA 1F0UA 1AVGH 1GMCF 4GAWA 3A89A 1GBHA 3LGYA 1FY1A 2A5IA 4X8UH 3BTKE 1QURH 1OWJA 3RMLH 1O2PA 2AIPA 4X8VH 9ESTA 1JRTA 1SHYA 1Y8TA 3SV7A 2Y5FA 2OXSA 2VIPA 1HFDA 4YIZA 3VG8A 1KXAA 2ZKSA 4WH6A 2BHGA 1QY6A 5A8XA 4ZKRU 1XVMA 2NWNA 4IMQA 2ZZUH 5EQSA 2KMSA 1FUJA 2QXJA 3GCNA 1TMTH 2QAAA 1VITF 1PPFE 2AERH 2FS9A 1OX1A 2QGRA 1EZXC 3RU4E 1W0KD 5EODA 3ERBA 3RU4D 4B2BA 3B9FH 1GCTC 1O2QA 3IX0A 3MH6A 1GL0E 4X6MA 4XD7D 3RDZA 1GHVH 1S6FA 1GBTA 1TRMA 1A0HB 4Z6AH 1RTFB 2ERJA 1QGFA 4I8LA 1YC0A 2WPDD 1O2TA 3Q3YA 3VB5A 5JBCS 1G32B 1DUAA 2QF5A 3ZLDA 4D76A 1O2ZA 4BTTB 1WQVH 2Y81A 1LPKB 5DP6A 1H8IH 4MNVA 2PWXA 3EGKH 1H8ED 2C8WB 1F0TA 1LKAA 4IC5A 4OS5A 5HIZA 2CJIA 2DUCA 3BTGE 3HGNA 4AFZA 1O3IA 1TMUH 2C8ZB 5H4IB 1YPHE 1NFWA 1OS8A 3A88A 4J1YA 5G4BA 4K8BA 4NSYA 1GI5A 3F9FA 2O8WA 4Y7AA 2UUKB 1EFRD 2PHBA 1NS3A 1W3CA 1PYTC 4M9FA 1ACBE 4JYVH 1DSUA 3TK6A 1BOQA 2W80A 1C5RA 1P2JA 3A86A 1C2DA 1AUJA 2HVXA 3UTUH 1AWFH 5GJ4B 1GMDG 1KLJH 1P10A 5ESBA 1KXFA 2RG3A 2EY4C 4E7RG 1SQAA 1P9SA 4AZ2B 1OJVA 3SNBA 1OWIA 1VCWA 1MQ5A 1HFIA 1ZJDA 2F9PA 3WSXA 2ZGCA 2EI7A 5FCRA 1RLHA 2R3UA 4RKOB 3QLPH 2B7DH 4XE4A 4IBLH 1SLVB 5C67A 3QTVH 3FAOA 1GI3A 5DP5A 4X6NA 1XKBC 3N7EA 1WOFA 1HAYB 1ZSKA 1NO9H 1ETTH 2ZF0H 1BZXE 2Z9JA 2KM0A 3CP7A 1CHOF 1O37A 2ZU2A 3GCHB 1TNGA 1MD8A 1ABIH 1DANH 3FP8E 4ISIH 1FIZA 1GGDB 2J94A 2ZU1A 1UTMA 5E8EH 1ELBA 1TOMH 1H2PP 1NM6A 1F5KU 1O5EH 5HIYA 1K1JA 4XBDA 2G4UA 2ASUB 2VWMA 4RN6A 1NFXA 2XC5A 2J38A 1QB6A 1G2LA 3CENA 2RLPA 4BAHB 1LQEA 3I77A 1HLTH 1FMGA 1FDPA 1C2MA 1FN8A 2Q1JA 2A2XH 1VITH 1B5GH 1NBME 1NBMD 1EJAA 3BN9A 4Q2KA 3UNRA 4D9QA 3BF6H 3BG4B 4K12A 2QN5T 3V7TA 1MH0A 1TPSA 1T8LA 1AKSA 1HJ9A 1TGTA 3FZDA 4Y8XA 3EDXB 4WJG2 3UREA 4VGCC 4Q63A 2BXUH 4K2YA 3TIUA 1UHBB 2PW8H 3M35A 4OS6A 1O9AA 1OP2A 1LVBA 1C4V2 5DP8A 1T4VH 1UTJA 2QE7D 2VJ1A 1MKWH 1QQUA 3MQLA 1O32A 1DITH 1CBWC 1TNLA 2WINI 2Q6FA 3ZYDA 4OS2A 3QGNB 1G2MA 5FBEA 1MABB 1HAPH 4JZDH 2HALA 1C5PA 3P70B 2XC4A 1HAXB 5CHAC 3ZLEA 1C5SA 3O8EB 1D3QB 1V2WT 4MPUA 3SI4H 3A7XA 4IGDA 3ZZBA 4Y76A 1QR3E 4ISLA 1GJDB 2KZ4A 5C94A 3Q3KA 2M2AA 3GY6A 2BVSH 2AGEX 1FNIA 2PTCE 3WW7A 4K69A 4MLFB 3TJUA 3MH4A 4Y11E 5EPYA 3VXFH 4I31A 4BOHA 1CT0E 3LH1A 1CE5A 5TCAA 3V13A 4CBOA 1HFHA 4A7IB 1C5VA 2GMTC 3PV5A 1AU8A 3LC3A 1NROH 4I8HA 2OTVA 2EA3A 4Q7ZA 2HPQH 2FI4E 4Y7BA 1O2XA 1EPTA 3SHAH 3T27A 5JPMG 2FP7B 1P3EA 3LOXA 2PP6A 1MTNC 4MPXA 2EI8A 1UK2A 1HJAB 3SZNA 3V3MA 3SV9A 5ABWA 1E79D 1C1VH 2ZDLA 3PLKA 4Y0YE 3BTEE 5F8ZA 3RXOA 1MKWK 2HRVA 1A61H 1C2EA 5F8TA 3ZZ7A 4A1VA 3UQOA 3TNSA 2B5TB 5LPFA 2OP9A 4SGAE 4ASUD 2SGEE 2WPLS 1H03P 2FWWA 1A5IA 2WUCA 2L6OA 2BDHA 3TH2H 3FN8A 2OQ5A 3GYMA 4KTSA 2ULLA 3UAIC 4X1PU 1O5DH 5EJLA 1FJSA 3SNAA 2BD2A 1AB9B 4A1TA 4AC9A 1AFQC 1QQ4A 2AH4X 2XRDA 2Q6DA 4RKJB 3U8RH 2Q6GA 2RA3A 2KAIA 2XWJI 5C1UA 1LKBA 1LQDB 1BMAA 2BMGB 1ZTJA 2SFAA 2ZWLH 1KDQA 4FUHA 3K65B 1TGNA 2G81E 1Z92B 3F68H 3SJIA 4TPIZ 2WPMS 2WV9A 1B0FA 1UCYE 3I29A 4K1SA 1K1IA 1SL3A 3K6ZA 1S84A 1LMWB 4B6EA 1HAVB 3RXIA 1O3JA 1NRSH 1UTQA 1S6HA 1TGBA 3RP2A 3TJVA 1C1UH 3EA7A 3KF2A 2UUYA 1BTWA 2F9OA 5J4QA 3FKSD 2PTNA 3NXPA 1C9TA 4ABAA 2FS8A 4ZXYH 1FQ3A 2OK5A 1RFNA 2C8YB 1ELDE 1E38B 4MNWA 1BJVA 1H8HD 1S0RA 3PROA 1BITA 1GHAF 1GHWH 2XCNA 3PLBA 2BXTH 4BNRA 3UQVA 2KX4A 3AW1A 1SGEE 3K2UA 4MNYA 4ZHLU 1VCQA 1TX6A 4GHTA 2Z94A 4DGJA 4FVDA 1VKYA 1O5GH 5F03A 3OY6U 2ODQA 1Y3XA 1N6YA 1NC6A 4X2WA 1PPEE 2D26C 2ZHEH 1DXPA 1LPZB 2GVFA 4ZMAH 4OM9A 1YPMH 1XX9A 2PFEA 2P3UB 1TBQH 3SORA 1E1QD 2HLCA 4X2XA 5HYUB 1OJWA 4UFGH 5C1XA 2V8EA 3MWIU 1O3DA 1W12U 2GZ7A 3AW0A 3D62A 1AZ8A 1O34A 1P2QA 2FI5E 3FVFB 3PYHA 2FXRA 4KTCA 3VEQB 2DE9A 2PKSB 1LPGB 4ISNA 3O8RA 1UK4A 1E36B 5EXLA 4X6OA 3M7QA 1GHBF 4MPVA 2IJD1 4NFFA 3KXVA 1V2QT 3JZ2B 2JH5D 4RSPA 1O2LA 2TBSA 3SUGA 2XBWA 1D6RA 1C1OA 2HWLB 1UVUH 3FANA 3LC5A 2ANWA 4KELA 2UUJB 5JYIA 1Q3XA 3MO3A 2ZO3H 3DSPA 5AF9H 1G3EA 2ALVA 1ZTLA 2HLDD 1YLCA 4B74A 3I78A 3KQEA 1QRZA 4QT8C 4B71A 4AYVB 5F8XA 4JZEH 3SNEA 4E7NA 1PPZA 1ZJKA 1AE8H 1CU1A 2ZFSA 5DP7A 3OP8A 1AVWA 2Y82A 1O3BA 5DN5A 3HATH 4YOIA 1BDAA 3S7HB 1ANCA 4HZHA 4DW2U 4GCHF 2VB0A 4BAOB 2IPHA 2IJOB 3SQHE 1UK3A 2G4TA 2WUBA 3GOVA 2BDCA 4CSYA 2WZQA 3M7PA 1L4ZA 3RMOH 1P8VC 1TLDA 4CRDA 4OGYA 3GDSA 2R2MB 1G3DA 3BTTE 3PMHB 1MZAA 2A1DB 1EAXA 8ESTE 3MH5A 2PSXA 4CHAB 2Z9LA 1G37A 5GXPA 2ZU4A 5HZPB 2VBCA 1ARCA 2IPQX 2OC1A 3U9AH 1BIOA 2G8TA 2C90B 4YOJA 4TY7A 2QC2A 5GPIB 3TVJB 1C5LH 1F7ZA 4TT3D 1SLXB 4AN7A 1QRXA 3VB7A 1FY4A 3QGJA 1W14U 2X2ZA 3KIDU 1BBRH 2ZFQH 1YPJH 1G3CA 2BYAX 1O2UA 2BDYA 1GL1A 3M5OA 3FO8D 1FY8E 5HM9A 4BANB 2ZHQH 5DP4A 1EB2A 1TBZH 3PV2A 9LPRA 3NRLA 2QCYA 2JDID 3TGKE 3A7YA 1AE5A 3L33A 1AFEH 4GUXA 4JCNA 1TGSZ 2F4LA 2LELA 2B5ID 1MU6B 3TNTA 5IK2D 5T3HA 1EJMA 3TITA 1GBBA 1A5GH 1GBCA 3A82A 2FLBH 1W2KH 3NK8A 1O3LA 4O03A 3ZVDA 3UNSA 4MUCA 1SKYE 3BTFE 3PRDA 3DSOA 3SGAE 2FX6A 1NN6A 1NPMA 1O3NA 1VCPA 1YM0A 5EXNA 1ELAA 2ZPQA 4CRAA 1Y3VA 3LONA 1C1MA 1AUTC 1AD8H 2WYGA 1THRH 1KSNA 1TFXA 1DWDH 1G4GA 3ELAH 1QBNA 3OY5U 1IAUA 4UEHH 3E1XB 2OCVB 4YLQH 3VB6A 5DG6A 1H2QP 5EQQA 1GBJA 1P03A 2BLOA 2A31A 5EJ1A 4ONTD 4DJZA 5FPYA 1F2SE 2Z6BD 3ATWA 2VU8E 4U30A 3U1IB 2TGDA 1XXDA 4LK4A 3PWBA 4ZXXH 1C5NH 3QO6A 2GD4B 2Z9KA 4JZIA 4H6TA 2A55A 1DLEA 5L2ZH 2ZGXH 2FOFA 4TWWA 7GCHG 3TGIE 3CI0J 1GJ5H 4ZKOU 1GG6B 1NRQH 4C16A 1EAUA 3SU4A 1Y59T 4D7GA 1DY9A 1HNEE 2GT8A 5GCHG 1K1LA 2OINA 1G36A 1L2EA 2AYWA 2XBYA 2JIZD 1JIMA 1TAWA 2LNCA 5C17A 5A09A 3GCTG 2UWLA 1HB0B 1GJAB 3EE0B 4NGAH 1ELEE 4MDSA 4DT7B 2TGPZ 1Y5BT 1SOTA 1O35A 1C2HA 1K21H 1GBDA 5DK1A 3DFJA 2QY0A 2JETB 2H5CA 4JHSA 3PTNA 3PV4A 5C1YA 4XFQA 5EIYA 2VVUA 1MMJN 1XUFA 1GBFA 1VZQH 4XSKU 3ZZAA 2FO9A 4Z1MD 3FP6E 4WY3A 2P93A 1JOUB 4AYIA 1IQGA 2PV9B 2Y8RA 5E0JA 1CT4E 2AIQA 2QXGA 3ATKA 2BDAA 4INLA 4Y8YA 4O3TA 3C1KA 2ZYCA 4INKA 2G5NA 5DKMA 4GSOA 2SGFE 4TWYA 2JGXA 4PROA 3OAAD 2XWBF 2ZFFH 2GKVE 4GVUA 1KTTB 2A7HA 4O3UA 2W7SA 3F0PA 1QCPA 4NWKA 3KGPA 4JZFH 1AMHA 2CGAA 1DY8A 1ZMLA 4HFPB 2R9PA 1BQYA 1LVMA 5IYTA 2NU0E 2ZFRH 1ZPBA 3RXEA 3VPKA 1A3EH 2H5DA 4DVAU 1P02A 1ANBA 2RCEA 4P00A 4AYDA 1C9PA 5C2ZA 2RKZA 1TABE 2FPZA 1QJ1B 1SG8B 1GHYH 3E8LA 4K60A 5LH8A 3ZVBA 1HRTH 4FU8A 1O33A 3QWCH 3M7UA 1ZMJA 5LPRA 1TONA 4R8TB 4X1QU 1SQTA 4IN1A 3RLYH 4A6LA 1GHXH 1O2YA 1CA8B 1OP8A 5TJXA 4YM9A 2XYAA 2J92A 2QIQA 1TALA 5F6MA 4MVNA 3KQDA 4I8KA 1EATA 1VGCB 2Z3DA 4TPYA 3SQEE 2A4GA 3U98H 4J2YB 3ESTA 1YLDA 1O2MA 4WH8A 2ODYB 2ZG0H 3SW2B 2GDEH 2R2WU 4I7YH 2FOAA 5EW1H 1YCPH 3GXEA 1LY2A 4R0IA 4ZH8A 3MI4A 2ZHFH 2J95A 1FPCH 4CBNA 2J98B 1OK3A 1QJ7B 3NCLA 4AORA 4DG4A 3KN2A 1O2RA 3RXUA 2NU2E 2FOMB 3S7KB 2W5EA 1SPJA 3SJOA 5T1VA 3VFEA 2QV1A 4FUIA 1TNJA 1BT7A 1OWEA 1GDNA 3A8BA 2AMDA 1H8DH 1NT1A 3Q76A 2SGQE 1UVOA 4KTUA 1CT2E 2TRMA 1P05A 4IS5A 4KKDA 1LHCH 1TNIA 3RXAA 1SRZA 2AEIH 1MBMA 2O8MA 3K3TA 4AGKA 2BY5X 4K3JA 5K7RA 1B0EA 2IN2A 1C1WH 1SGNE 4ZH1D 3T5OA 1AGJA 2ZNKH 3BIVH 3A7TA 1GGDC 2ZCKP 1BUIA 5ETXA 2FOGA 3LJOA 3R3GB 1QL7A 1GI1A 5FCKA 3DSGA 4WXIA 4YLUA 3UWJH 1GVLA 4NZLA 4B73A 4AG1A 1F0SA 3GY8A 3ZZ4A 1S0QA 3RC4A 2YBYA 3T28A 4E06H 1SFQB 2BD5A 1A0LA 1MKXH 3VB3A 3LH3A 5EGMA 4Y71A 1G4FA 3BEIB 3JZ1B 1RXPA 1UTLM 3SYJA 2CG7A 3ZZCA 1PPGE 3TJOA 3BG4C 5L2YH 2XBXA 5C3NA 2CK3D 1BRAA 1WUNH 1Z8IB 3SU2A 2ZU5A 5EOKA 1HBTH 1A4WH 1WXRA 3F9HA 3HKJB 2V3MA 2CG6A 1XUJA 2BZMA 3SGQE 6LPRA 2YMSD 1OPHB 1XM1A 2C3SA 4H6SB 1RTKA 2Z3CA 1PPBH 1P09A 1JRSA 1QL8A 3SU0A 4X2VA 2PR3A 2CN0H 1OKXA 1SGRE 3BTDE 1F5LA 1V2LT 2HPPH 1V2NT 4BXSA 2XW9A 1HXFH 4Y6DA 2VIWA 3L3TA 1MU8B 3AK5A 1UTKA 3UWIA 1W0ZU 2XC0A 4YOGA 1ANDA 2P95A 2RDLA 5L30H 2CF9H 4ABFA 2THFB 4ABBA 6GCHG 1GBEA 2NU4E 3KCGH 1F0RA 1TNHA 3OTPA 1SBWA 1EAIA 3M61U 3N7DA 3KZJA 4WMDA 1L1GA 1EAWA 4N7EA 4AGJA 2BD4A 1LCYA 3P8GA 1O3AA 3SJKA 1EPTB 3QDZB 3UY9A 5EQRA 3MO9A 2QXIA 5FPTA 1QB9A 1C2IA 3UNQA 1GBMA 5HM2A 1O3CA 2RA0A 2VIDA 2WIIC 1HJAC 2XRCA 3MTYA 1FY5A 3SU5A 1C5ZB 1ZGIA 2FOBA 2FYQA 5HYTB 5LPEA 2Y8SA 5DN4A 3V12A 2ZTXA 1C2FA 2A5KA 3C27B 2HVYB 1UCYH 2UWNA 4ASHA 1HUTH 2AHME 2JH6D 3TJNA 1HAGE 8GCHF 3FZZA 1AQ7A 1N8OC 3OEED 4ABIA 4MPWA 5CHBA 3RM2H 2R0LA 5GWZA 3B23B 1FY3A 3EAJA 3MHWU 5TCCA 4AOQA 1KDQB 1C5WB 2YOLA 4JMYA 1WAYB 1P3CA 3MU1A 1ZPCA 4BXWA 4YO9A 3URCA 3A7WA 3ITIA 5EXMA 1V2ST 1YP9A 2B8OH 5T6GA 1C2GA 2K0QA 1SFIA 2F83A 2OC0A 4UDWH 2HGTH 3L89M 1GMCG 2V35A 3SUEA 1SGCA 7KMEH 2VH6A 2EEKA 1DOJA 2CHAB 3PMJA 4A1XA 1HIAA 4YXWD 1HYLA 2BD7A 4B2SA 3RM0H 4AYEA 2ZA5A 3S69A 3UR9A 1CBWB 5HMAA 1QA0A 3BTQE 5FL7D 2G7IA 1YY3A 2P8OB 2O9QA 1DWBH 4B2AA 2QF3A 4AB9A 1ELVA 1IQIA 2FTLE 2I6QA 3MU4A 1MQ6A 2G5VA 1K28D 3E0PB 3U69H 4B6FA 4XRNA 1YLNA 3STJA 3ZVFA 1H9LB 4LOSA 1HCGA 3ATMA 1O5CB 2FODA 3ZZ5A 5CDFE 2XCFA 5HGGA 1VITG 1DICA 1QHRB 4I8JA 2BOKA 3Q77A 1DM4B 1XVOA 1QJ6B 4NCYA 2ZEBA 2V6NA 2Z9IA 4CH2B 3RMNH 1SGFG 3FOAA 1Z8GA 2VWNA 1ZPZA 3A8DA 3UFAA 1GI2A 5JBBS 3UR6A 4OS7A 1SQOA 2VIOA 1GPZA 1PYTD 2BVRH 3E16B 1WU1A 3DT0H 1QL9A 5CE1A 2GCHG 3D65E 3MH7A 4D8NA 4GPGA 3M37A 4XBBA 1KXDA 1ANEA 1TX8A 3RXBA 2PKSC 3QK1A 1FXYA 5GIBA 4MQAA 2BX3A 4LXBH 1RIWB 3F6UH 4UFFH 2CMYA 1DVAH 2FOEA 2JJ1D 2TGTA 1C5YB 4WF8A 1BRBE 2B0FA 1V2UT 3A7VA 1EKBB 4ISOA 1OP0A 1T8NA 1EX3A 4JYUH 1GI7B 1O3FA 5EPNA 1DDJA 1GJ8B 1Q31A 2OUAA 2TGAA 4ZUHA 2Y5GA 3KQ5A 4X8TH 1D6WA 3F2HA 3RXQA 1GVKB 1NESE 1IQJA 2IOTA 3T26A 1P2OA 3T29A 3TPIZ 5FXLA 1HAZB 3N99A 4F49A 1IQNA 4AFSA 1LVOA 2ALPA 3RXVA 2Y80A 3ZRZA 3R0FA 2EC9H 3PWCA 6ESTA 3RUOA 1P11E 5CMXH 1AO5A 2A45B 4BTIB 4TY6A 1UVSH 1NRNH 2JJ2D 2VGCB 3GY7A 1GMHF 3DUXH 2J34A 4X1NU 3SI3H 3OSYA 1WBGB 2ZFTA 1FAXA 1O2KA 1YPLH 1ZOMA 4GLYA 1O2OA 4IMZA 1UMAH 3NUMA 3SN8A 2HNTC 1CHOG 1T32A 3ODFA 2GV6A 4CR9A 4M7GA 1YWUA 4NWLA 1SOZA 4CHAC 3WWBA 1WSSH 3A81A 2GP9B 1H04P 2GX4A 5DSFA 1P2NA 3ZVEA 1V6DA 2KCAA 2MCYA 1SGYE 4ABHA 1MTWA 4OS4A 1TGCA 3MFJA 1O39A 1SLWB 1EUFA 3OYPA 1KY9A 1IOEA 2VVCA 1DE7H 1EZUC 2BQWB 4YESB 1S6LA 3TGJE 4U2WA 3T2NA 1ELFA 5DJ7A 5AFYH 1T7CA 4U32A 1O38A 2STAE 1O3OA 3LDXH 1YYY1 3RXTA 4X2YA 5IDKA 1TOCB 2C93B 1LTOA 4NA8A 1D3DB 1GHQB 2XNIA 3RXJA 4ZKSU 4ZCNA 3LGIA 1VR1H 1LO6A 3F3BA 2V3OH 1HAOH 1HGTH 2TPIZ 3TK9A 1BMNH 4JK5A 2FTMA 1J17T 3SV6A 2O8UA 2MCZA 3M5NA 1Y3UA 2VH0A 4X8SH 3GY5A 3AVZA 1RRKA 3DHKH 2SNWA 4GHQA 4NA7A 2KR7A 1GBKA 4BTUB 2SNVA 4X1SU 1UTNA 3K9XB 4DOQA 3P6ZB 2ILNA 1V2KT 4Y8ZA 1FI8A 3PRBA 3QUMP 1QGBA 1S85A 1C2JA 1M9UA 1C1TA 1GJBB 1UO6A 3O8BA 1KYNA 1O2IA 2H2ZA 1PPQA 2P59A 3U28C 2SGAA 1J9CH 2J97A 2QA9E 4NZQA 3GDVA 5ESTE 2ZDMA 4UD9H 3ODDA 4HI3A 1QTFA 2VINA 1MD7A 4FUCA 2BB4A 4XBCA 1GMDF 1GBIA 2ANYA 4WMEA 1GG6C 2PSYA 2Z9GA 3E91A 1EQ9A 3KQBA 5FAHA 1Y5AT 1NRPH 1BTZA 1NFYA 1OK2A 5F53A 1ID5H 1GI4A 1SGDE 3S9AA 2ZDKA 1HAHH 5JBAS 1K2I1 1Z6EA 2H1UA 3M5MA 1TMBH 4TSFD 5HYOA 1PQ5A 2ZQ1A 1F92A 1O2HA 4MSLA 1FPHH 1T31A 4X1RU 2QY0B 4FU9A 1BBRK 3RXSA 4ACAA 2BVXH 2BY7X 4AX9H 2ZCLP 1Z8RA 2IZ4A 4IN2A 3TVJA 2ZECA 3SO3A 4ZHAA 4MNXA 2ANMH 1O36A 3F6KA 4IW4E 3UIRA 3E0NB 1LHEH 1AY6H 3VGCB 1Z8JB 2FEQH 3O8DA 1GBLA 4K1EA 1OK9A 2GJGA 1DSTA 2V7QD 2A7CA 3P17H 1RTLA 1EOJA 2C4FH 4Y0ZE 1K22H 3PO1B 1ZHRA 4Q7XA 3A7ZA 3RC5A 2BTCE 4UONA 1C4U2 1KXCA 4CRFA 1VJ9U 4WWYA 1BTYA 3SV2H 5B6OA 1BA8B 2GTBA 1CO7E 1GJ9B 1L1JA 2W81A 1HDTH 1FV9A 3CALA 1MZDA 4YT6H 1TIOA 3TK5A 1FN6A 4ABEA 1X7AC 2OC7A 1GHAG 1C1PA 1CA0B 1OYQA 1TE0A 4FOUC 1P2MA 2D8WA 1AWHB 3RXCA 2FLRH 4UFDH 4CRGA 1THPB 2G51A 3IU3I 1RS0A 2YRAA 1C1SA 2BZ6H 4J38B 1TPPA 1COWD 2M5TA 4FUJA 4INHA 1ZZZA 4YZUA 1CKLA 2XQWC 1A1RA 1FZZA 1RGQA 1YBWA 2FMJA 5E0GA 5C5OA 2XTTB 1IQLA 2A32A 2F43B 1P2KA 1WTGH 3SJ8A 4CRBA 1Z1JA 5E2PA 5FO8C 5PTPA 3ZZ8A 5JB8S 2H9HA 2YMSB 4WVPE 4ZHMU 5T6FA 1OWKA 2ZGBH 1O3HA 1TYNA 1VGCC 3LGWA 2GV7A 2OBQA 1KIGH 3NPSA 5HXFA 1SGQE 3PB1E 5JBTA 5AVDA 2A2QH 2ZFPH 2GZ8A 1YPEH 1TPOA 1GHBG 4B75A 2LOJA 1N6XA 1VJAU 3T25A 4NSVA 1YPGH 1TA6A 2FIRH 2GCTB 1GDQA 1O31A 5A0CA 3RXKA 2PKAA 3LPRA 1Q2WA 1ETSH 2ZDAH 4PZ5A 1RJXB 4YTAA 1W8BH 4JYTA 4AB8A 5KEDA 3F0OA 1IHSH 1GJ6A 2JGWA 5A0BA 2BOHB 3S9BA 2RKYA 1QBOA 3BEUA 3V0XA 3CS0A 3P95A 6CHAB 4NFEA 1P9UA 1ETRH 4FVBA 3BTWE 1Y3WA 4BAKB 4ZKNU 2YNBA 1OHHD 3D49H 3AAUA 3DA9B 3SHCH 1U6QA 1D3TB 3MU8A 1C1QA 7ESTE 5C0TA 2BY8X 1W10U 3VWOA 1KLTA 2W6ID 1S81A 4FETA 5A8ZA 3BTHE 4GCHG 4ABGA 1ZSLA 2D1JA 2FESH 3FP7E 3MNXA 3GY2A 4B76A 1A7SA 3P8OA 1N1LA 2ZC9H 4X6PA 4CRCA 1XUIA 1HJ8A 1GJ7B 2KCOA 3BTME 4MTBA 1W7XH 2H6MA 3MNBA 3F2GA 4HG6A 3H7OA 1ZMNA 3LGVA 2I2LA 3SZEA 4LZ1H 4LOYH 1NY22 1KXEA 1A46H 2F3CE 1ZTKA 1P01A 3EYDA 1V2OT 1XMNB 1WYKA 1E0FD 3ZVGA 5SGAE 1UW7A 3FGRA 2XWBI 1Z71A 5FHTA 3BEFB 2KFWA 3QX5H 2SGPE 2XRBA 2AGGX 3W95A 2GCHF 1O5FH 4AYMA 3AASA 3W94A 3GCHC 4I8GA 2VIQA 2K8IA 1K1NA 1SHHB 3KNXA 3KEEA 3ZZ3A 4AFUA 1GKGA 1C5MD 1KLIH 3BG8A 1EP5A 2CF8H 4HGCA 5FX6A 1ELCA 1CGJE 4B2RA 1XKAC 4IC6A 3ZZ9A 3F2FA 3ZD1A 2AGIX 1J14A 1O2JA 3ZIAD 1SSXA 1YCPK 1V2TT 1HPGA 1GBAA 2ZCHP 1MBQA 3ZVAA 1BHXF 4Q4LA 3SOSA 3ZV9A 2AFQB 2A7JA 3UOUA 2J4IA 1C1ZA 1E88A 1GCTB 2CV3A 2WV5A 1BTUA 5KECA 2AS9A 2FZZA 5EU8A 1QBVH 1OK1A 2BD8A 2AMQA 1J16A 2WPHS 2BLWA 1TPAE 2P3FH 1DS2E 1AKSB 4OGXA 1BMMH 1C1RA 3ZD2A 2J98A 3LKWA 4B2CA 3A8CA 1O3GA 4FUFA 1ZYOA 3PM3A 4Z0KA 5DPAA 3TLOA 1ZSJA 1P06A 3RXLA 1EPTC 3M3VA 5JPMH 3ZVCA 3KQCA 4DCDA 3SNCA 2A4QA 3H09A 1F5RA 1H4WA 1OOKB 4RT0A 5DGJA 1J15A 5DP9A 2O39C 2W7UA 3HPTB 4PO7A 4FUBA 2FI3E 1VVDA 2ZGJA 4YT7H 1SI5H 3F9EA 3MYWA 1A2CH 1L0ZA 1BHXB 2XWAA 2AMPA 4XDEA 1SGIB 3MNCA 3MU0A 1PPCE 3UUZA 2ZDVH 3STIA 3GISB 2WYJA 1GI6A 1K9OE 1FONA 1CSOE 1OWHA 2ZTZA 3DCLA 2F9UA 1QNJA 1EJNA 4DY7B 2BX4A 1DWEH 1YPKH 3OTJE 1SGFA 1BTXA 1MKXK 3H5CB 3NZIA 4U01A 1PFXC 2CXVA 1Y5UT 2PLXA 3OEDC 4F48B 1SR5C 1O0DH 3IWMA 1GJCB 3NWUA 4E05H 2RFKC 2W6JD 1SLUB 3ENSB 3SU1A 5FPSA 1P0SH 2JH0D 3N7OA 3H7TA 2LPRA 2F91A 1ELGA 3UOPA 3F1SB 2ESTE 1HIAB 1W11U 2J2UA 2V0BA 2CHAC 1D4PB 1U5MA 1GCDA 1ZR0A 2GDDA 2FDAA 1K1MA 2RL0A 1QFKH 1ZHMA 2PUXB 2EI6A 3ATLA 3Q00A 2ZPSA 2P8OC 1C2LA 2Y8TA 5I25A 2EHFA 3RXHA 2H9TH 1AB9C 1LDTT 2KAIB 1WCZA 2ZHDA 1V2RT 2ZPRA 4DIHH 3TH4H 1ZLRA 3QZQA 3EA8A 4LOTA 4JK6A 1EP6A 1NU9A 1KXBA 1LHGH 1S82A 5DN6D 2F9VA 3U1JB 1G9IE 4NA9H 3R62A 3UPEA 1XUHA 3URDA 1TQ7B 4DIIH 2BDBA 1DFPA 1QRWA 1WDIA 1GWAA 1YKTA 4RI0A 4A5WB 1MTVA 1C2KA 2C8XB 2Y6TA 2OLGA 2WPKS 3M5LA 3Q3XA 4VGCB 1BJUA 1IHTH 2V3HH 2J9NA 1E1RD 1JIRA 4SGBE 1ABJH 1GHZA 1UHBA 1O2NA 1VVCA 2ZHWH 2L74A 3GICB 5EG4A 1BMFD 2VWLA 4K5ZA 1PJPA 1IQKA 2G55A 4AYYB 1W13U 4XOJA 3NFPI 1YF4A 2NU1E 3RC6A 1UCYK 1S5SA 1E35B 2A4RA 1KMHB 4DURA 2BLVA 5CHAB 4YNXA 1SQRA 2ZU3A 1RIWC 2QF4A 1C5TA 3MO6A 2JRAA 1XUKA 1NWVA 1ARBA 1MCTA 4H42U 3HK3B 1SGPE 3RJ3D 2UUFB 4CREA 2BQ7B 3HGPA 4B1TA 3OEHD 1FBRA 1OYTH 2XNDD 3KYGA 1QUBA 1ZGVA 3GCOA 4HTCH 1SGTA 1N8OB 1MUEB 1LVYA 2GMTB 3E6PH 1J8AA 1TPGA 4AFQA 5C20A 3RXMA 3WY8A 2WHXA 2IZ3A 5T6DA 1O2VA 4THNH 5GDSH 3IITA 1O5AB 4BAQB 5HKKD 2JKHA 1MTNB 7GCHF 3LIWA 2F9BH 4ISHH 3PTBA 1E8BA 1A5HA 3A87A 2A4OA 1CGHA 1UJ1A 3RXPA 3IG6B 4UFEH 5GCHF 2VGCC 1PQAA 1H9HE 1SC8U 1OJYA 3LGUA 1IQMA 1W0YH 3D23A 3MMGA 1Y3YA 1CHGA 2ZGHA 4ZAEA 5BRRE 5EW2H 3T62A 1K1PA 1QIXB 4X0WU 3GCTF 1ZHPA 5A2MH 1NZQH 1A0JA 4ABJA 3RXGA 8LPRA 3ZZ6A 2UWPA 2VIVA 1AN1E 4AG2A 1LHDH 3M36A 1UVTH 4ABDA 3QN7A 1IQEA 1AFQB 3SJ9A 3AAVA 2W3IA 3A84A 1GDUA 1C5OH 1FX0B 2ZP0H 1NFUA 1BTPA 4ACBA 4NG9H 2RLQA 1BTHH 1THSH 2BLQA 4FXGH 2Y5HA 3CS7A 3DD2H 2KCYA 3QTOH 2PUQH 4ZROA 2KCPA 2LP6A 5A0AE 3KYFA 1JMOH 3RXDA 1FIWA 3E3TA 3M3TA 1DUEA 1O3MA 2RDEA 3SUFA 5DO4H 1MTSA 2TIOA 2BQ6B 3GOVB 1O3EA 5C0UA 1EZSC 1GI0A 1O3PB 3KL6A 1ZRBA 5AFZH 1HAVA 1C5XB 8KME2 1DPOA 2HOBA 1QZ8A 1K1OA 1NTPA 1ZRKA 2CKUA 3SBKA 1AHTH 1ESAA 1TQ0B 1MCVA 1PPHE 2Y7XA 4DT4A 1BRCE 1TB6H 3P92A 2O8LA 3OU0A 3BSQA 1H1BA 1RD3B 2BDIA 2VNTA 4FUEA 3SV8A 2ZI2H 2ODPA 3TH3H 1C5QA 1OSSA 2H9EH 5J4SA 2GT7A 1GKNA 2P16A 3CNRA 2HNTF 3RMMH 1P57B 2Z3EA 1TRNA 4BAMB 4CR5A 1Z7KA 1TPNA 4KP0A 4O97A 3HKIB 1T8MA 2OQUA 2BDGA 2DE8A 1ORFA 3MQKC 1PQ7A 3DFLA 3U8TH 4FU7A 2BY9X 4A5TS 2J5UA 5E2OA 1L4DA 2XXLA 3E90B 1G30B 3SNDA 1W7GH 1QB1A 1HAIH 4D9RA 2G52A 4OS1A 3VXEH 1C5UA 3KHVA 3EA9A 4O9VA 2SGDE 3P8FA 3F9GA 1V2VT 4APLA 5C5NA 4BWCA 2BM2A 2ZTYA 2R3YA 3A83A 4Q80A 4CH8B 2BD9A 3M3SA 3INBC 5I0QB 3MU5A 4F4OC 2B9LA 3EQ0H 1V3XA 1CQQA 3LGTA 3P8NA 1BCUH 1O2SA 1AVXA 1S83A 2K1QA 1OWDA 1LHFH 1YGCH 3RU4T 2A0QB 1TRYA 1H9IE 3OXUD 1T8OA 2ZQ2A 1E34B 2WV4A 1Z1IA 4WXVA 1UOTP 3LT3A 4I33A 1EXFA 2YNAA 4K1TA 4DJZB 3O8CA 1FLEE 3SUDA 8GCHG 5EJZA 4FXGG 3L6PA 1D3PB 4KGAA 4A92A 1DXWA 1DLKB 1TBRH 1UVPA 3RLWH 2FYRA 3VGCC 2UWOA 1V2PT 1AZZA 2WPIS 1HCCA 1AIXH 4ESTE 2VWOA 2NU3E 1O3KA 3PLPA 1YPHC 1O2WA 4I86A 1BMLA 3PMAB 3B8JA 2A5AA 3SW0X 1AI8H 1BRUP 1KTSB 2OC8A 3LJJA 3PO1C 3FGTA 2WPJS 3HK6B 1SS2A 2QYIA 4WMFA 4F55A 3GY3A 1P04A 2R0KA 1XUGA 1WQSA 1MAXA 2PGQB 2Y7ZA 1ELTA 2STBE 5K0HA 5L6NH 4Y10E 2XOKD 3ZYEA 1GI8B 3M7TA 1EZQA 3OE7D 5KGOA 3SU3A 3FFGA 5FX5A 5HYPA 1DWCH 5A8YA 2ANKH 2F9NA 1C1NA 3LU9B 2JETC 4H4FA 1MAYA 2WSSD 1EASA 3EJHA 3WSYA 5LGOA 1CA0C 4NIVA 3A85A 2EQNA 1DT2A 3ZZDA 3GY4A 2OBOA 1Z6JH 1ESBA 3EE7A 3NKKA 3TU7H 1C4Y2 2PGBB 7LPRA 1MTUA 2ZIQH 3GS9A 3NJAA 2FOCA 1WTHD 2GZ9A 4NIYA 1UTOA 1PQ8A 2OD3B 2FM2A 1TNKA 1QA7A 2GGVB 2EC3A 2ZDNA 1CVWH 1V2JT 1ESTA 2BZAA 2G00A 1TX7A 2BD3A 1O30A 1E5GA 4UE7H 1T4UH 2YMSC 4FUDA 3RXFA 6GCHF 1BBRE 2QF0A 4LZ4B 5DP3A 5FBIA 1HV7A 1EB1H 3OX7U 5I46H 1CGIE 3RXRA 1JBUH 1V2MT 3ATIA 1GVZA 3S9CA 1G3BA 1YCPM 1IQFA 4NIXA 1D9IA 3U8OH 3QZRA 2PKAB 1O5BB 2GCTC 1XXFA 1JWTA 1SB1H 3ZV8A 3A80A 3BIUH 4I32A 2FOHA 1SVPA 1O2GH 1UTPA 2BY6X 1TA2A 4Y79A 4RT1A 3T5FH 4MG3A 2QXHA 1TPMA 6CHAC 4K8YA 1L1NA 1EOLA 3WWFA 4D7FA 1QO6A 1TWXB 3S0NA 1JXPA 1DX5M 1BB0B 5E0HA 2Z7FE 3GYLB 3A8AA 1A3BH 3OFND 5B6LA 1IQHA 3MOCA 4JZ1A 2XBVA 1E37B 1NRRH 1INCA 1HXEH 2HNTE 1NU7B 3G01A
chains in the Genus database with same CATH topology
1GJ4H 1P2IA 4TYDA 3SU6A 2I6SA 2O8TA 3K6YA 4FUGA 2D2DA 3GDUA 3BV9B 1FAKH 2P94A 3VB4A 5JDUB 2VVVA 1OXGA 5JB9S 2P3TB 1GMHG 2KRIA 1WV7H 1B7XB 2W26A 1P12E 1SMFE 1GI9B 5BPEA 2W3KA 5AHGH 3PMBB 3MNSA 3SGBE 2FX4A 4NIWA 4Q7YA 1F0UA 1AVGH 1GMCF 4GAWA 3A89A 1GBHA 3LGYA 1FY1A 2A5IA 4X8UH 3BTKE 1QURH 1OWJA 3RMLH 1O2PA 2AIPA 4X8VH 9ESTA 1JRTA 1SHYA 1Y8TA 3SV7A 2Y5FA 2OXSA 2VIPA 1HFDA 1KXAA 2ZKSA 4WH6A 2BHGA 1QY6A 5A8XA 4ZKRU 1XVMA 2NWNA 4IMQA 2ZZUH 5EQSA 2KMSA 1FUJA 2QXJA 3GCNA 1TMTH 2QAAA 1VITF 1PPFE 2AERH 2FS9A 1OX1A 2QGRA 1EZXC 3RU4E 5EODA 3RU4D 3ERBA 4B2BA 3B9FH 1GCTC 1O2QA 3IX0A 3MH6A 1GL0E 4X6MA 3RDZA 1GHVH 1S6FA 1GBTA 1TRMA 1A0HB 4Z6AH 1RTFB 2ERJA 1QGFA 4I8LA 1YC0A 1O2TA 3Q3YA 3VB5A 5JBCS 1G32B 1DUAA 4D76A 1O2ZA 4BTTB 1WQVH 2Y81A 1LPKB 5DP6A 1H8IH 4MNVA 2PWXA 3EGKH 2C8WB 1F0TA 1LKAA 4IC5A 4OS5A 2CJIA 2DUCA 3BTGE 3HGNA 4AFZA 1O3IA 1TMUH 2C8ZB 5H4IB 1YPHE 1NFWA 1OS8A 3A88A 4J1YA 5G4BA 4K8BA 4NSYA 1GI5A 3F9FA 2O8WA 4Y7AA 2UUKB 2PHBA 1NS3A 1W3CA 1PYTC 1ACBE 4JYVH 1DSUA 3TK6A 1BOQA 2W80A 1C5RA 1P2JA 3A86A 1C2DA 1AUJA 2HVXA 3UTUH 1AWFH 5GJ4B 1GMDG 1KLJH 1P10A 5ESBA 1KXFA 2RG3A 4E7RG 1SQAA 1P9SA 4AZ2B 1OJVA 3SNBA 1OWIA 1VCWA 1MQ5A 1HFIA 1ZJDA 2F9PA 2ZGCA 5FCRA 2EI7A 2R3UA 4RKOB 3QLPH 2B7DH 4XE4A 4IBLH 1SLVB 5C67A 3QTVH 3FAOA 1GI3A 5DP5A 4X6NA 1XKBC 1WOFA 1HAYB 1ZSKA 1NO9H 1ETTH 2ZF0H 1BZXE 2Z9JA 3CP7A 1CHOF 1O37A 2ZU2A 3GCHB 1TNGA 1MD8A 1ABIH 1DANH 3FP8E 4ISIH 1FIZA 1GGDB 2J94A 2ZU1A 1UTMA 5E8EH 1ELBA 1TOMH 1H2PP 1NM6A 1F5KU 1O5EH 1K1JA 4XBDA 2G4UA 2ASUB 2VWMA 4RN6A 1NFXA 2XC5A 2J38A 1QB6A 1G2LA 3CENA 2RLPA 4BAHB 1LQEA 3I77A 1HLTH 1FMGA 1FDPA 1C2MA 1FN8A 2Q1JA 2A2XH 1VITH 1B5GH 1EJAA 3BN9A 4Q2KA 3UNRA 4D9QA 3BF6H 3BG4B 4K12A 2QN5T 3V7TA 1MH0A 1TPSA 1T8LA 1AKSA 1HJ9A 1TGTA 3FZDA 4Y8XA 3EDXB 4WJG2 3UREA 4VGCC 2BXUH 4K2YA 3TIUA 1UHBB 2PW8H 3M35A 4OS6A 1O9AA 1OP2A 1LVBA 1C4V2 5DP8A 1T4VH 1UTJA 2VJ1A 1MKWH 1QQUA 3MQLA 1O32A 1DITH 1CBWC 1TNLA 2WINI 2Q6FA 3ZYDA 4OS2A 3QGNB 1G2MA 5FBEA 1HAPH 4JZDH 2HALA 1C5PA 3P70B 2XC4A 1HAXB 5CHAC 1D3QB 1C5SA 3O8EB 1V2WT 4MPUA 3SI4H 3A7XA 4IGDA 3ZZBA 4Y76A 1QR3E 4ISLA 1GJDB 3Q3KA 3GY6A 2BVSH 2AGEX 1FNIA 2PTCE 4K69A 4MLFB 3TJUA 3MH4A 4Y11E 5EPYA 3VXFH 4I31A 4BOHA 1CT0E 3LH1A 1CE5A 5TCAA 3V13A 4CBOA 1HFHA 4A7IB 1C5VA 2GMTC 1AU8A 3LC3A 1NROH 4I8HA 2OTVA 2EA3A 4Q7ZA 2HPQH 2FI4E 4Y7BA 1O2XA 1EPTA 3SHAH 3T27A 5JPMG 2FP7B 1P3EA 3LOXA 1MTNC 4MPXA 2EI8A 1UK2A 1HJAB 3SZNA 3V3MA 3SV9A 5ABWA 1C1VH 2ZDLA 3PLKA 4Y0YE 3BTEE 5F8ZA 3RXOA 1MKWK 2HRVA 1A61H 1C2EA 5F8TA 3ZZ7A 4A1VA 3UQOA 3TNSA 2B5TB 5LPFA 2OP9A 4SGAE 2SGEE 2WPLS 1H03P 2FWWA 1A5IA 2WUCA 2BDHA 3TH2H 2OQ5A 3GYMA 4KTSA 2ULLA 4X1PU 1O5DH 1FJSA 3SNAA 2BD2A 1AB9B 4A1TA 1AFQC 1QQ4A 2AH4X 2XRDA 2Q6DA 4RKJB 3U8RH 2Q6GA 2RA3A 2KAIA 2XWJI 5C1UA 1LKBA 1LQDB 1BMAA 2BMGB 1ZTJA 2SFAA 2ZWLH 1KDQA 4FUHA 3K65B 1TGNA 2G81E 1Z92B 3F68H 3SJIA 4TPIZ 2WPMS 1B0FA 1UCYE 3I29A 4K1SA 1K1IA 1SL3A 3K6ZA 1S84A 1LMWB 1HAVB 3RXIA 1O3JA 1NRSH 1UTQA 1S6HA 1TGBA 3RP2A 3TJVA 1C1UH 3EA7A 3KF2A 2UUYA 1BTWA 2F9OA 5J4QA 2PTNA 3NXPA 1C9TA 4ABAA 2FS8A 4ZXYH 1FQ3A 1RFNA 2C8YB 1ELDE 1E38B 4MNWA 1BJVA 1S0RA 3PROA 1BITA 1GHAF 1GHWH 2XCNA 3PLBA 2BXTH 4BNRA 3UQVA 3AW1A 1SGEE 3K2UA 4MNYA 4ZHLU 1VCQA 1TX6A 4GHTA 2Z94A 4DGJA 4FVDA 1O5GH 5F03A 3OY6U 2ODQA 1Y3XA 1N6YA 1NC6A 4X2WA 1PPEE 2D26C 2ZHEH 1DXPA 1LPZB 2GVFA 4ZMAH 1YPMH 1XX9A 2PFEA 2P3UB 1TBQH 3SORA 2HLCA 4X2XA 5HYUB 1OJWA 4UFGH 5C1XA 2V8EA 3MWIU 1O3DA 1W12U 2GZ7A 3AW0A 3D62A 1AZ8A 1O34A 1P2QA 2FI5E 3FVFB 3PYHA 2FXRA 4KTCA 3VEQB 2DE9A 2PKSB 1LPGB 4ISNA 3O8RA 1UK4A 1E36B 5EXLA 4X6OA 3M7QA 1GHBF 4MPVA 4NFFA 3KXVA 1V2QT 3JZ2B 2JH5D 4RSPA 1O2LA 2TBSA 3SUGA 2XBWA 1D6RA 1C1OA 2HWLB 1UVUH 3FANA 3LC5A 2ANWA 4KELA 2UUJB 5JYIA 1Q3XA 3MO3A 2ZO3H 5AF9H 1G3EA 2ALVA 1ZTLA 1YLCA 4B74A 3I78A 3KQEA 1QRZA 4QT8C 4B71A 4AYVB 5F8XA 4JZEH 3SNEA 4E7NA 1PPZA 1ZJKA 1AE8H 1CU1A 2ZFSA 5DP7A 3OP8A 1AVWA 2Y82A 1O3BA 3HATH 4YOIA 1BDAA 3S7HB 1ANCA 4HZHA 4DW2U 4GCHF 2VB0A 4BAOB 2IPHA 2IJOB 3SQHE 1UK3A 2G4TA 2WUBA 3GOVA 2BDCA 4CSYA 3M7PA 1L4ZA 3RMOH 1P8VC 1TLDA 4CRDA 4OGYA 3GDSA 2R2MB 1G3DA 3BTTE 3PMHB 1MZAA 2A1DB 1EAXA 8ESTE 3MH5A 2PSXA 4CHAB 2Z9LA 1G37A 5GXPA 2ZU4A 5HZPB 1ARCA 2OC1A 3U9AH 1BIOA 2G8TA 2C90B 4YOJA 4TY7A 2QC2A 5GPIB 3TVJB 1C5LH 1F7ZA 1SLXB 4AN7A 1QRXA 3VB7A 1FY4A 3QGJA 1W14U 3KIDU 1BBRH 2ZFQH 1YPJH 1G3CA 2BYAX 1O2UA 2BDYA 1GL1A 3M5OA 1FY8E 5HM9A 4BANB 2ZHQH 5DP4A 1EB2A 1TBZH 9LPRA 2QCYA 3TGKE 3A7YA 1AE5A 3L33A 1AFEH 4GUXA 4JCNA 1TGSZ 2B5ID 1MU6B 3TNTA 5T3HA 1EJMA 3TITA 1GBBA 1A5GH 1GBCA 3A82A 2FLBH 1W2KH 3NK8A 1O3LA 4O03A 3ZVDA 3UNSA 4MUCA 3BTFE 3SGAE 2FX6A 1NN6A 1NPMA 1O3NA 1VCPA 1YM0A 5EXNA 1ELAA 2ZPQA 4CRAA 1Y3VA 3LONA 1C1MA 1AUTC 1AD8H 2WYGA 1THRH 1KSNA 1TFXA 1DWDH 1G4GA 3ELAH 1QBNA 3OY5U 1IAUA 4UEHH 3E1XB 2OCVB 4YLQH 3VB6A 5DG6A 1H2QP 5EQQA 1GBJA 1P03A 2BLOA 2A31A 4ONTD 4DJZA 5FPYA 1F2SE 2Z6BD 3ATWA 2VU8E 4U30A 3U1IB 2TGDA 1XXDA 4LK4A 3PWBA 4ZXXH 1C5NH 3QO6A 2GD4B 2Z9KA 4JZIA 4H6TA 2A55A 1DLEA 5L2ZH 2ZGXH 2FOFA 4TWWA 7GCHG 3TGIE 1GJ5H 4ZKOU 1GG6B 1NRQH 4C16A 1EAUA 3SU4A 1Y59T 4D7GA 1DY9A 1HNEE 2GT8A 5GCHG 1K1LA 2OINA 1G36A 1L2EA 2AYWA 2XBYA 1JIMA 1TAWA 2LNCA 5A09A 3GCTG 2UWLA 1HB0B 1GJAB 3EE0B 4NGAH 1ELEE 4MDSA 4DT7B 2TGPZ 1Y5BT 1SOTA 1O35A 1C2HA 1K21H 1GBDA 5DK1A 3DFJA 2QY0A 2JETB 2H5CA 4JHSA 3PTNA 3PV4A 5C1YA 4XFQA 2VVUA 1MMJN 1XUFA 1GBFA 1VZQH 4XSKU 3ZZAA 2FO9A 3FP6E 4WY3A 2P93A 1JOUB 4AYIA 1IQGA 2PV9B 5E0JA 1CT4E 2AIQA 2QXGA 3ATKA 2BDAA 4INLA 4Y8YA 4O3TA 3C1KA 4INKA 2G5NA 5DKMA 4GSOA 2SGFE 4TWYA 2JGXA 4PROA 2XWBF 2ZFFH 2GKVE 4GVUA 1KTTB 2A7HA 4O3UA 2W7SA 1QCPA 4NWKA 3KGPA 4JZFH 1AMHA 2CGAA 1DY8A 1ZMLA 4HFPB 2R9PA 1BQYA 1LVMA 5IYTA 2NU0E 2ZFRH 1ZPBA 3RXEA 3VPKA 1A3EH 2H5DA 4DVAU 1P02A 1ANBA 2RCEA 4AYDA 1C9PA 5C2ZA 2RKZA 1TABE 2FPZA 1QJ1B 1SG8B 1GHYH 3E8LA 4K60A 5LH8A 3ZVBA 1HRTH 4FU8A 1O33A 3QWCH 3M7UA 1ZMJA 5LPRA 1TONA 4R8TB 4X1QU 1SQTA 4IN1A 3RLYH 4A6LA 1GHXH 1O2YA 1CA8B 1OP8A 5TJXA 4YM9A 2XYAA 2J92A 2QIQA 1TALA 5F6MA