4WJG2

Structure of t. brucei haptoglobin-hemoglobin receptor binding to human haptoglobin-hemoglobin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
314
structure length
310
Chain Sequence
CPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemoglobin subunit alpha
publication title Structural basis for trypanosomal haem acquisition and susceptibility to the host innate immune system.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus n315
molecule tags Endocytosis
total genus 58
structure length 310
sequence length 314
chains with identical sequence C, H, M, R, W
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4wjg201
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wjg203
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4wjg202
1CU1A 1FAXA 1T31A 5JYIA 3RXUA 3GCOA 3RXKA 2GCTC 2CV3A 2GGVB 1PPFE 4K1TA 1ELCA 2Y5FA 1P9UA 1HXFH 2XC5A 1OYTH 1P2JA 3EA9A 4UFEH 2GT7A 2FS9A 1SG8B 4FUEA 3MH6A 6GCHG 2PGQB 4CHAC 2BLWA 4CH2B 1C5RA 2O8WA 1P04A 1SHYA 1GI5A 4BNRA 4UDWH 1G3EA 1TA2A 2FOHA 4FU9A 1FV9A 1TGTA 2EI7A 4AGKA 4MNWA 1LQDB 1DXPA 2FPZA 1BRAA 2ZF0H 1UJ1A 4X8UH 5PTPA 3RLWH 3H7TA 1AO5A 1W3CA 2XCFA 3S7KB 2ANMH 1F0SA 1O5AB 3FAOA 1HUTH 2F9NA 2C8WB 1BA8B 2BVXH 1WQVH 1OP0A 3O8RA 3ZZCA 4GHTA 1O2GH 2VNTA 1ARBA 1WV7H 1CGHA 2V3HH 1FY1A 2IPHA 1ANCA 1DSUA 4D76A 4O3UA 1AQ7A 1C5WB 4NSVA 4KTCA 4B2CA 1LPKB 1F5RA 1N8OC 2FS8A 2Z9LA 3KXVA 1MZDA 2XXLA 1KXAA 1HAOH 3LJOA 1UTMA 3L89M 2A1DB 1GMCG 1EAIA 3LONA 3ODFA 3RMNH 1MQ6A 1ZTLA 1C1WH 2Z7FE 2G55A 4XBDA 1T8OA 5C5OA 2ZFFH 1UOTP 4IBLH 2I6SA 1A1RA 2ZPSA 3W94A 3T5FH 4XE4A 1Y5AT 3TLOA 1TE0A 3HKIB 1HJAC 2RLPA 1BCUH 5C20A 3HGPA 2V6NA 1GJCB 3A82A 3E0NB 1EPTC 2AIPA 4A92A 1YBWA 1CHGA 3SU2A 1ETRH 3BIUH 4UFDH 2J4IA 1AKSA 1P2IA 2Q6DA 3M61U 1FZZA 2FYQA 2CXVA 4LOYH 1D3DB 1T32A 3UOUA 1MKXH 4J2YB 5C5NA 4INHA 1C2HA 1GVLA 1LKBA 2CGAA 2DUCA 1J17T 3TK6A 1FDPA 1WTGH 1FMGA 1NC6A 3LC3A 1GI4A 3VB6A 1KXEA 2ZU2A 2ANWA 3LC5A 2GDDA 4GCHG 1ZPZA 1TNKA 4GHQA 3PMHB 4UD9H 1SFIA 1GBEA 4ISHH 1GBIA 1LMWB 1V2RT 1Z8JB 2ZWLH 1NRPH 4MUCA 3INBC 3SU5A 2BX4A 1O3AA 3I29A 3A8AA 1ZYOA 3BG8A 5GJ4B 2GP9B 3FZZA 1V2QT 3NZIA 2CG6A 1G3CA 3LGTA 1GBCA 2PV9B 2YRAA 3M35A 3QTOH 4Y7BA 2ANKH 1C2FA 3NK8A 2ZU5A 2ZIQH 3I77A 1ELFA 1WBGB 4PZ5A 1O35A 3A7VA 1WSSH 2K1QA 4ZMAH 2WPLS 3F9FA 3QZQA 4TPIZ 5T3HA 3OX7U 3K65B 1IQGA 5CHAC 2BOHB 1OX1A 1S82A 3ZV8A 2VVVA 1O2VA 1O3DA 1FBRA 1W12U 1XX9A 3P92A 2R0KA 7ESTE 1TPNA 5JB9S 1GWAA 3GY6A 5LGOA 2F83A 1F2SE 1BUIA 3PMAB 2O9QA 3PTNA 2P94A 4NZQA 5GDSH 3SI3H 2ZQ1A 1O3EA 3SNCA 2QGRA 2ALVA 3LJJA 1D4PB 2FDAA 4DOQA 4ABAA 2CF8H 2O8TA 1H9HE 1ZZZA 2ZU4A 1QB6A 3DA9B 1OOKB 2UUJB 4XSKU 3GY3A 5CMXH 3ZVAA 2JGWA 1P01A 1KY9A 2Z3CA 4H6SB 1O33A 1PYTC 5EODA 2THFB 1T4VH 2R9PA 2IZ3A 1GDUA 1CVWH 4K3JA 3UREA 1KIGH 4K12A 3M5OA 1F5KU 2R2WU 3E1XB 4GCHF 1TQ7B 2DE9A 4NIYA 2YNBA 3TH3H 3NWUA 3SORA 1GHBG 1ANBA 1HV7A 4ABEA 3M7TA 3MFJA 4I31A 1THSH 4WH6A 2FM2A 5L2ZH 1QQ4A 2Z6BD 1V2OT 2DE8A 4A1XA 2Y81A 2ZG0H 4VGCB 2W3KA 3UNRA 2QIQA 1E0FD 2FWWA 1OPHB 2R0LA 1F0TA 1HFIA 1ELBA 3DT0H 1A5GH 3F1SB 4ZROA 1C2JA 1C2IA 2WPIS 1UTQA 1K1LA 3HK3B 1GHQB 1YPHE 2FO9A 1ZR0A 1GMHF 2CG7A 2A7CA 1HB0B 3V0XA 3M5MA 3GICB 2QY0A 1BBRK 5FXLA 3SUFA 1UVSH 1DLKB 1D9IA 4I33A 2P3FH 5A09A 3UR9A 2BDYA 4CR9A 1BTWA 4ESTE 1LTOA 2KMSA 1YKTA 3K6YA 4ABFA 1G32B 5T6FA 2BLVA 2A2QH 3ZZ7A 2ZCLP 4H4FA 2BY9X 1TWXB 4CRBA 3EJHA 1SS2A 1UK3A 2D2DA 1IQFA 1GHWH 5ABWA 1XXDA 1EZSC 3A7ZA 4CH8B 2A45B 3T5OA 3UWIA 1CA0C 3Q3KA 5AFYH 1NFWA 1ZSJA 1K22H 4SGBE 1THPB 3MNBA 4X1QU 4D7GA 3EAJA 1MTNB 4NIVA 1QJ7B 5H4IB 4AFZA 1VITH 2AGGX 3GY7A 1LY2A 4B2RA 1HPGA 1LHFH 4Y8ZA 2PKSB 3IU3I 5HYTB 3E8LA 3ATLA 1TPGA 3UNSA 2ZO3H 2ZZUH 1EJMA 3U98H 1OJVA 3MU8A 4MPWA 2FESH 2VWLA 4CRGA 2Y7XA 1VCPA 3DUXH 3F68H 2B8OH 1C5SA 1O2NA 2QYIA 1YLDA 1UTPA 1ELAA 3SBKA 2ZHDA 4BAKB 3ERBA 1A2CH 2QXHA 1MUEB 2BVRH 2VGCC 1O3GA 3FP7E 4FVBA 3T29A 1TX6A 4FUFA 1OYQA 1ELDE 4MPXA 4JYVH 5ETXA 3BIVH 3GDSA 5F8TA 1KDQA 1TBZH 4TY7A 4YM9A 2HNTF 1V2VT 2BDBA 1O3IA 1A46H 2A5IA 4Q7XA 1N8OB 3SU3A 1DWCH 5HMAA 1C1ZA 1O5GH 4AG2A 1T7CA 1A4WH 1P3CA 1V2UT 1V2KT 2PSXA 1EJAA 1O36A 4JYUH 1P09A 4AFUA 1DPOA 5HYUB 1S6HA 4ABDA 2BY8X 1KLJH 1TMUH 1LQEA 2OC0A 2W81A 4O3TA 1LDTT 4YT6H 1C1QA 2FODA 4CSYA 1CGJE 1HNEE 2ODPA 3MI4A 2OINA 1O3NA 1A0JA 2BDCA 2C3SA 3T27A 2PKAB 1LCYA 4IMQA 8KME2 1L1JA 1O2TA 3VB7A 1GBFA 8ESTE 1CGIE 5GCHG 3IITA 3A84A 1OP8A 4R0IA 2ILNA 1QBVH 1NT1A 1HJAB 5EQSA 2WV5A 3U9AH 4D8NA 1ID5H 4CRAA 1T8NA 2ZA5A 2AMQA 2G8TA 1DWDH 3TH4H 2BQ7B 2HLCA 1QNJA 2EI8A 1QRXA 4A6LA 3MO9A 1AVGH 2XRBA 3SN8A 1YPKH 1WCZA 2ZU1A 1ZJDA 3GY2A 4ZHMU 2RCEA 4ZHAA 3A83A 3RXAA 3LDXH 1QURH 1FN6A 2CN0H 4KP0A 1J16A 2FIRH 1MD7A 4IW4E 2OLGA 5DP8A 4Z6AH 2A5KA 2WIIC 1V6DA 1GKNA 3ZYEA 2PW8H 4AYVB 3RM0H 1QB9A 1FY4A 3BTTE 3RC4A 3NFPI 1Q3XA 1O3BA 3MH5A 1FLEE 1TA6A 4A5WB 3RMLH 1QRWA 1IQNA 3A80A 1OWJA 1TGNA 4B2SA 1LVOA 2WUBA 2IN2A 3A88A 1FI8A 1SQAA 1O0DH 3NXPA 4YOGA 3SNEA 1L1NA 1G37A 5HZPB 3NKKA 4INLA 5J4QA 1GJBB 1CT4E 1Z71A 2TGTA 1NFXA 5E0GA 1H8DH 3PROA 4NCYA 5A2MH 1VR1H 2QC2A 1EB2A 2AMDA 4ZKOU 2FXRA 1GBHA 4UFGH 1Y3YA 2FOFA 3E3TA 5CHAB 3S9CA 5FBIA 1YF4A 3FFGA 4E05H 4JYTA 2XNIA 1T4UH 2OD3B 1XUHA 1C5XB 4FUIA 4NA9H 2Y5GA 4ISIH 2Z9GA 3QTVH 2G81E 5FBEA 1O5CB 3H5CB 1AE8H 4LOSA 3KQDA 3RC5A 3PMBB 4AFQA 2F91A 1SGPE 1AE5A 1Z92B 1AI8H 1DY8A 1P11E 2BD3A 1KXBA 3UIRA 1V2TT 1PPCE 5FX6A 3JZ2B 3SQEE 1BJUA 1GI0A 1QBNA 2W26A 4E7RG 3UOPA 3A8BA 3UQOA 2Z9KA 2TPIZ 4JZFH 1YPJH 1VITF 3PLBA 3MMGA 1AN1E 4DURA 1HAXB 2MCZA 1ABJH 3CS7A 4C16A 1A61H 1O2RA 4B74A 2R2MB 1AKSB 1ZGIA 1FIWA 3CALA 4E7NA 1C5OH 2C93B 3P17H 4UE7H 3B8JA 2Y82A 4B73A 2AIQA 1P2OA 2VIDA 1WUNH 3NPSA 4IGDA 3V3MA 4BTTB 3LT3A 9ESTA 2XWAA 3RXDA 1MZAA 2Z9JA 5T6DA 1E34B 3EA8A 4WMEA 5A8XA 3BTHE 5JPMG 1SGEE 1SGFG 3ENSB 2C90B 1GHYH 3A81A 2J94A 1SBWA 2B9LA 1O31A 3ITIA 5BRRE 3SU4A 2PTCE 5FAHA 3VXEH 2TIOA 1MAXA 4J1YA 2IZ4A 1P02A 1MKWK 3U1JB 3SV2H 1CT2E 5GXPA 1TONA 2P95A 3RDZA 1XMNB 1ELVA 2C8YB 3OEDC 5TJXA 3TGJE 4HZHA 2SNWA 2P3UB 1JOUB 4KTUA 1T8MA 3LKWA 1MTNC 2ZHFH 1Y3WA 4DY7B 1OWIA 3A86A 3ZD1A 1RTKA 8GCHG 1FONA 2AEIH 2QAAA 1EXFA 4I8HA 2PKSC 2RKYA 1AD8H 3ESTA 3RXLA 4F49A 2XWJI 1NPMA 1GJ7B 4FUBA 3M5NA 2BMGB 1JWTA 3U8TH 4IC6A 2BQWB 3VB4A 1AVXA 1AHTH 4BAQB 2RKZA 5EXMA 3IG6B 2UWLA 1HDTH 1P06A 1SL3A 5HXFA 1SLXB 1C2KA 2FZZA 4IC5A 4GVUA 3ZZ4A 5IYTA 3SW0X 2QF0A 3FP6E 1K1PA 4K60A 1PPZA 4DIHH 1DS2E 1UK2A 1C5NH 3MWIU 2HNTC 1O3MA 3SV8A 1CA0B 3MNSA 2Z94A 1GDNA 3PTBA 1CHOG 1BRUP 2GMTC 2ZPRA 2G4UA 1QO6A 3LGWA 3MH4A 5C1YA 2BDHA 1Z8IB 4MNVA 2BM2A 1O38A 1BBRE 1C2EA 1PQ7A 4ABGA 3ZZ6A 3KQEA 1HJ9A 4X8SH 1S83A 1RTFB 1DICA 1AWHB 2AYWA 4I8LA 2ZFRH 1NRSH 4BTIB 4BANB 1FUJA 1MU6B 4RKOB 1JRTA 1SI5H 1XUFA 2PGBB 1NWVA 3O8BA 4NFEA 1TB6H 1ZSLA 1H04P 3HK6B 4B71A 4BXSA 3SUGA 3BEUA 1OP2A 4Y0YE 4AYEA 2VGCB 2ZHWH 3VGCB 3T26A 4JK5A 3EDXB 1BBRH 1UHBA 1O2JA 4GAWA 1HAPH 1N6XA 1SPJA 3QGNB 3QUMP 2FLBH 3Q3YA 1Z8RA 5DP7A 1BDAA 2YBYA 4IMZA 3GDVA 3KQBA 3Q76A 1SHHB 2ODYB 1FPCH 4WXIA 1PJPA 3P95A 1D3PB 6GCHF 1E88A 2PR3A 1AMHA 2IOTA 3B23B 5LPFA 4DW2U 5EG4A 5A8YA 2WYJA 2SGDE 1O2SA 4B2BA 1D3QB 1V2NT 4CRDA 3DFLA 2V3OH 3OYPA 4YLUA 1QUBA 3GISB 5EW1H 1QL7A 5FO8C 2PLXA 4BAMB 1RXPA 1K21H 1PQ8A 3KGPA 1V2WT 2UWNA 1V2MT 2H9HA 1OWHA 2QY0B 1CBWB 2ZI2H 5JB8S 2R3UA 2XYAA 3FZDA 4I8JA 1EZUC 2HNTE 2PUQH 4NZLA 2H2ZA 3EQ0H 2WINI 1K1MA 4THNH 1DX5M 2GV6A 1E37B 2BOKA 4QT8C 4OS6A 1XVMA 1K1OA 2EC3A 5HM2A 3SI4H 4Y76A 3RU4T 1QRZA 3K2UA 4A1VA 1DXWA 1GGDB 3QZRA 2UWOA 4Y6DA 1AB9B 1GDQA 1HXEH 3PMJA 3TVJA 1PPBH 1FJSA 4X8TH 3BF6H 2ESTE 2ODQA 2RA0A 3SNDA 1NRQH 2CJIA 3OTJE 1ZGVA 1SVPA 1SGCA 2GX4A 2BZAA 2SGAA 1QTFA 2Q1JA 3F9GA 3S9BA 3D65E 3M3SA 5A0AE 2UUYA 3HGNA 3N7OA 1J8AA 1HAGE 1YM0A 2GV7A 2BD2A 3MU4A 5FPSA 3CENA 3GY4A 1JBUH 1EP5A 1W7XH 5DJ7A 4BTUB 1L2EA 4XDEA 3RM2H 1GJDB 1C1OA 1KTTB 3PLKA 1KXFA 1YPHC 2BD4A 5HYOA 1VCQA 1GMCF 2GVFA 2QV1A 1MU8B 2FX6A 3WY8A 3LGVA 1SQOA 5F8ZA 1YC0A 4RSPA 1GI3A 2QCYA 4Y8XA 4AGJA 3GOVB 2ALPA 4ISLA 3W95A 3GCHB 2VB0A 2PHBA 3LOXA 4JCNA 1DANH 1O9AA 4DGJA 5DP5A 2XBYA 1BTUA 3AAUA 1H2QP 2RL0A 3KF2A 4WY3A 3MO3A 4BAOB 1ACBE 2ZDLA 1C5UA 1KDQB 1OSSA 1PYTD 1XM1A 1WTHD 2STAE 4YLQH 4TWYA 1GJ8B 1W0YH 2BD8A 4DJZA 3KQCA 1SR5C 3TH2H 1BTHH 1TABE 1O32A 1HGTH 3RLYH 3UWJH 1GI9B 1XUGA 4Y79A 1UCYK 4OS5A 2ZP0H 1SGFA 2XWBI 1O2QA 4ISOA 5EXNA 4B2AA 1GJ9B 1MCTA 3O8CA 2VIQA 1W2KH 5F8XA 3MU5A 1C1RA 1Y8TA 2H9EH 2D26C 1QL9A 1L4DA 2J2UA 4WVPE 3AW0A 4JMYA 1S0QA 1VVCA 2GTBA 2SGEE 2XC0A 3TK9A 4DCDA 4CBOA 1BTYA 1AWFH 1AZZA 2VU8E 2W3IA 3A7TA 1YYY1 4KGAA 1GJAB 1HYLA 2VINA 3O8EB 4X6PA 1Y3VA 2A0QB 4X1NU 3BTKE 4IN1A 7GCHG 2WPMS 1UVPA 3LU9B 3ZYDA 2GZ7A 1ZMLA 1XKAC 1BOQA 3VFEA 1O3LA 2RA3A 4X2XA 3SQHE 4I7YH 2NU2E 2IJOB 4YT7H 3ZZ5A 1OWDA 2BLOA 1ETTH 2ZTXA 1K1JA 3VB3A 5B6OA 3Q77A 4CBNA 5EXLA 3PYHA 2BX3A 3ZD2A 1GI2A 3M7UA 1TLDA 2JH0D 1H8IH 1JXPA 1K9OE 1SOZA 3GCTG 1DFPA 3KN2A 1C5TA 2AERH 4X6OA 5AVDA 2CHAB 1RFNA 4CREA 1VJAU 1NRNH 4B76A 1AGJA 1GHXH 4X2YA 1TALA 1BMAA 1KSNA 1EASA 4ABHA 5G4BA 1YLCA 2WPHS 1DUAA 2H5DA 1ZHRA 1P3EA 1LHGH 3FP8E 1ZRKA 1HAVA 3RXTA 1RJXB 1DITH 4OS2A 2GDEH 1LPGB 3RXRA 1SSXA 1SFQB 1NROH 1HJ8A 2EA3A 1JMOH 3IWMA 3U8RH 3UQVA 1TIOA 2ZDMA 1MH0A 1J15A 3AASA 3NCLA 1TX7A 1O2KA 1TBRH 3ZVFA 1GI8B 4RN6A 1L4ZA 2JETB 1SC8U 2FOMB 1PQ5A 1UTLM 1WYKA 1HAYB 1TYNA 1C2MA 1NFUA 2VVUA 1N1LA 3ZVBA 1O2UA 3RU4D 4AN7A 1NU7B 1GHBF 1JRSA 2NU3E 3EYDA 2QXJA 1BMNH 1BTPA 1GJ6A 1P05A 1W13U 2QA9E 3VGCC 4AYMA 3QO6A 1W11U 2HWLB 1EAWA 1O2WA 1P12E 1FNIA 3K6ZA 2VH0A 2WPJS 1D3TB 4IN2A 1JIMA 2GMTB 3SU0A 1ZSKA 1TPOA 2FI5E 1GG6B 1LKAA 2UUFB 3OY6U 2GCHG 1A0LA 1EZXC 1G36A 2G51A 1BRCE 3RXHA 3ZZ3A 1O3OA 4GPGA 1B0EA 2H1UA 4U30A 4MVNA 1C5QA 1G30B 3KL6A 3ZV9A 1MKWH 3TU7H 2NU4E 1G9IE 5E0JA 2XBWA 4CRCA 2V35A 4MNXA 1KLTA 3SJKA 1CBWC 1GVZA 1O2LA 4ISNA 3E91A 3SGBE 4FXGH 1YCPH 3P6ZB 1FY5A 3EGKH 1XUJA 3M36A 5C1UA 1HFHA 1M9UA 4J38B 1O2MA 1G2LA 1O37A 1MBMA 2F9UA 3UPEA 3A87A 3G01A 4ZAEA 7LPRA 2FX4A 1BT7A 3ATKA 2BDIA 4ABBA 1GGDC 1AB9C 4DG4A 5ESTE 6ESTA 1GI6A 1LVBA 4Y10E 1GJ4H 1MTWA 1Z8GA 3OSYA 1TOMH 1CKLA 4YOIA 2ZQ2A 4U01A 1HCCA 3M7PA 3A8CA 4D9QA 1GBBA 3B9FH 1BTZA 3LH3A 3F9HA 1K28D 1GCDA 1QCPA 1TNIA 1D6RA 3A85A 2C8XB 5LPEA 4KKDA 2VWNA 4Q7ZA 1DDJA 4HI3A 2G52A 3BTME 2KRIA 1Y3UA 4LK4A 1NESE 1AVWA 1DUEA 2RLQA 3TPIZ 1YPGH 3SJIA 1D6WA 1G3DA 1QA7A 2OCVB 5EQRA 2XRDA 4H6TA 2XQWC 2H9TH 2VIWA 1C1TA 4KELA 2EC9H 4GLYA 1TGCA 1SGDE 1H4WA 3STIA 3OU0A 1QQUA 4ABJA 1OK1A 1ZPBA 3ATWA 4K8BA 3GCHC 2HALA 1TFXA 2BD5A 3TGIE 2ZC9H 3P8OA 3KEEA 2VWMA 3QGJA 2FLRH 3BTDE 2FYRA 2CF9H 4NFFA 4WJG2 1O3HA 5JPMH 1QJ1B 1C9TA 3ATIA 4CRFA 1HRTH 3RXSA 3F6UH 4FUJA 3BN9A 1SRZA 4AFSA 3VB5A 2BDAA 5JBTA 2HRVA 1O5BB 1C1UH 4WMFA 3LIWA 2FTMA 1EB1H 4OS7A 3L6PA 1ANDA 1GHAG 1NFYA 5DGJA 2HGTH 2D1JA 2ZGBH 1GBJA 1W7GH 1KTSB 2G5VA 1VGCC 4JZEH 4FUGA 3S0NA 2ANYA 2C4FH 1C1NA 1DVAH 2WV4A 5E0HA 1Z6EA 2ASUB 1C1MA 1HIAA 2ZHEH 2O8LA 4OS1A 3UR6A 1UVTH 1LHDH 3EE0B 4TWWA 2RDLA 3LH1A 2NU1E 1G2MA 2KAIA 4K2YA 2A4QA 2B0FA 3MTYA 4U2WA 2XCNA 3SJ9A 5GCHF 1IQJA 3P70B 1O39A 2QXIA 5F03A 3E90B 2EHFA 1PPGE 3PM3A 4AOQA 2SFAA 5I46H 3RXVA 1UHBB 9LPRA 4Z0KA 2P93A 1ELGA 4ZH1D 1A3BH 4FUCA 3MU0A 1TRNA 1SLWB 4E06H 5C2ZA 3TITA 2HPQH 4X2WA 1NRRH 1ZTJA 4H42U 1C4Y2 3VXFH 2WYGA 1WAYB 2BD7A 3MHWU 1F0UA 4Y7AA 3GYLB 2NU0E 4X1RU 1AY6H 2STBE 3EA7A 3QX5H 1O5DH 1SGRE 1ZMJA 2LPRA 4ZKNU 2G00A 1GVKB 2TRMA 1V3XA 3BTQE 1MTVA 5GIBA 1P2MA 2RG3A 2ZKSA 3TJUA 2BZ6H 4X6MA 2XBXA 4A7IB 2FOGA 1QGFA 2CHAC 1ORFA 5ESBA 1YPEH 1C5VA 2A7JA 1P03A 1OWKA 1V2PT 1C1SA 1O34A 1W0ZU 3TJNA 3UNQA 1RD3B 1HAHH 2UUKB 2ZDKA 3GY5A 2A32A 1HCGA 2ZTYA 1AFQC 4R8TB 2GT8A 5DP4A 1V2JT 1L1GA 3TVJB 1YCPK 4GUXA 1WOFA 1BHXF 2SNVA 2UWPA 4ZXYH 1EAUA 5JBCS 3Q3XA 1EPTA 2VWOA 5A0BA 1O2IA 3L3TA 4D7FA 5C3NA 2BY6X 1S85A 3KNXA 2Q6GA 1GHAF 5C67A 2BYAX 4U32A 1UCYE 1FQ3A 1VZQH 5AFZH 1RS0A 1PFXC 1ESTA 1UTJA 2XC4A 3U1IB 1FY8E 1MCVA 4Y11E 2JETC 4UEHH 4YO9A 1TBQH 4ZHLU 1C1VH 2BHGA 2ZHQH 3P8NA 1TGSZ 3SNAA 5GPIB 3QN7A 1B0FA 3U8OH 1IAUA 3D23A 3DD2H 1KXDA 1IHSH 1CA8B 1GJ5H 3M7QA 3STJA 1P2QA 3RXMA 2P59A 4AB8A 1GHZA 2SGPE 1WU1A 4Y0ZE 2OC7A 2ZPQA 3R0FA 3P8GA 3RMMH 3OY5U 1W14U 1UCYH 2LOJA 2PWXA 3SU6A 2GZ9A 1XVOA 4TPYA 2ERJA 3FANA 2M5TA 3LGUA 3TGKE 1GG6C 1Y5UT 1C4V2 2BXUH 2ZECA 4WH8A 2BDGA 5DPAA 3ZZBA 5C1XA 1P9SA 3PLPA 1CT0E 3PO1C 4FVDA 1QY6A 4MPUA 2CKUA 1IQLA 3UFAA 4DJZB 1BMMH 1ABIH 1E8BA 3AVZA 5TCCA 4F4OC 3SJOA 7KMEH 4FU7A 3PWCA 3IX0A 1HAZB 1O2YA 5J4SA 1LHEH 2GZ8A 3T28A 3RXBA 4ZXXH 1ARCA 4UONA 1W10U 2P8OB 4TYDA 3D62A 4JK6A 1IQMA 2FOCA 3BEIB 1YP9A 1HAIH 1TMBH 3AAVA 2AGIX 2ZEBA 4X2VA 1O2ZA 4LOTA 1C2LA 3ZZAA 1CQQA 3T25A 4DVAU 4WXVA 5FCRA 1NS3A 1ZHPA 1FAKH 3BG4B 4AYIA 2XRCA 5DG6A 1O5FH 4ZH8A 5DO4H 1E38B 2A4RA 3ODDA 1AUJA 3TK5A 1TNHA 3SV9A 2OBOA 4AB9A 5DP9A 2VIOA 4O03A 8GCHF 1KXCA 1QHRB 1ZPCA 2ZGJA 4DIIH 1BB0B 1Z1IA 3SOSA 1GHVH 1MQ5A 2A4GA 2PSYA 3T2NA 3RP2A 1G3BA 1OK9A 1GBKA 1LO6A 1QIXB 1B7XB 1Y59T 3SO3A 2BTCE 2OQUA 1TNLA 4MLFB 3BTWE 6CHAB 1ELEE 2ZDNA 5L30H 3M3VA 3V12A 1CO7E 1HBTH 2QN5T 5CE1A 3GYMA 3ZRZA 2FOAA 3BEFB 3MU1A 1EZQA 4WF8A 4ZKRU 1GI1A 4Y8YA 1CSOE 2ZFSA 2ZNKH 1H9IE 4LXBH 4WMDA 1S5SA 3D49H 3P8FA 2OC8A 4X1PU 3BTFE 3A7YA 3CP7A 1O5EH 1O2HA 1RIWC 4M7GA 3PB1E 1PPEE 1O2PA 4JZDH 1CHOF 3URDA 5K7RA 1E36B 4X6NA 2JRAA 3GXEA 2H6MA 5SGAE 1ANEA 3SUDA 1HAVB 1QR3E 1QFKH 4MPVA 3ZZ9A 5JBAS 1F5LA 2F3CE 4NG9H 4X1SU 1AFEH 1Q2WA 2ZFPH 1GCTB 1GMHG 4MNYA 1SOTA 1SMFE 3Q00A 4HGCA 4SGAE 2TGDA 1TNJA 3LGYA 2JKHA 3U69H 5I0QB 2XW9A 1OJWA 2A31A 1K2I1 3BTEE 1SLUB 2BD9A 1UVOA 4Q2KA 1BZXE 2ZFQH 2NWNA 1ZRBA 1LPZB 4YESB 3HPTB 3A8DA 4MTBA 1TX8A 1GBDA 4LZ4B 2HOBA 1GBMA 1FPHH 3SUEA 2ZGCA 2Y7ZA 2VIVA 3VEQB 1THRH 3V13A 2XBVA 2Z3EA 2ZU3A 3V7TA 2FOBA 2TGPZ 4TY6A 1GL1A 3MYWA 2J34A 3E0PB 5AHGH 1P8VC 1YGCH 2FP7B 3K9XB 3RXJA 4ZUHA 1VGCB 1E35B 3ZVDA 4OS4A 1K1NA 1KYNA 2BQ6B 3VPKA 4B1TA 1MTUA 3TIUA 2B5TB 3OXUD 1VJ9U 4BOHA 4ABIA 2P16A 1AIXH 2R3YA 1A0HB 1EUFA 1PPQA 4I8KA 2FTLE 5FCKA 5L6NH 3FVFB 3AW1A 3I78A 3UY9A 1HLTH 4O97A 1NTPA 2WPKS 1MBQA 1AU8A 5FHTA 2ZDVH 1OWEA 1EAXA 1KLIH 1TRYA 1LVMA 1V2LT 1XUKA 1ZJKA 4LZ1H 2G7IA 1YCPM 1F92A 3E16B 1E5GA 1IQIA 4K5ZA 2I6QA 2F9VA 1O2OA 4HTCH 4NA8A 2ZGHA 3KIDU 5DP6A 1G4FA 2J38A 3RXOA 4AORA 1W8BH 3UTUH 1IQEA 1GBAA 4NIWA 4MDSA 2O39C 1DY9A 1TPPA 2TGAA 1C5PA 3URCA 2W7SA 1OK3A 2SGQE 2W80A 1AUTC 1PQAA 5HYPA 1DE7H 1EJNA 1NN6A 1FIZA 4CR5A 1Q31A 2J92A 1UO6A 1FY3A 2W5EA 4X8VH 1B5GH 1TOCB 1BRBE 2V0BA 3BSQA 8LPRA 4FU8A 4NA7A 1GL0E 1H03P 4K69A 5FX5A 1BIOA 3H7OA 4O9VA 4GSOA 2JH5D 2BVSH 2Z3DA 2SGFE 1C1PA 1V2ST 2AMPA 1C5YB 3KZJA 2ZCHP 1SGNE 4K1EA 3RXQA 1DM4B 2QF3A 3DHKH 2O8UA 1Z6JH 1H1BA 2VJ1A 1Z1JA 1P2NA 2AGEX 1S6FA 1AZ8A 2ZCKP 4AZ2B 4MQAA 4I32A 1AFQB 3ATMA 3S69A 2B5ID 3BV9B 1EX3A 3RJ3D 1MKXK 3SGAE 2JH6D 3SHCH 5LH8A 1BJVA 1PPHE 3BTGE 4BAHB 1S0RA 1GBTA 2GCTB 3GY8A 4UFFH 3GCNA 1UMAH 1O2XA 5EPYA 1ESBA 1GKGA 2A4OA 1N6YA 1A3EH 2OUAA 1IHTH 1A5IA 1J9CH 2FMJA 2FEQH 3M5LA 1ZOMA 2JGXA 4CHAB 2F9BH 4A1TA 1MD8A 1TAWA 5JDUB 4Q80A 2P3TB 2QXGA 4IS5A 3DFJA 1DWEH 1HIAB 4ONTD 1OS8A 4WWYA 1SGIB 2P8OC 3KHVA 3CS0A 2KAIB 1QBOA 3RC6A 3KCGH 2Y80A 2Z9IA 3GOVA 1U5MA 1A7SA 1VVDA 1QL8A 5AF9H 2PTNA 1Z7KA 3ZZ8A 3BG4C 2XTTB 6LPRA 1WQSA 3RMOH 3ZVCA 3HATH 1C9PA 7GCHF 2BB4A 1JIRA 3M37A 4XOJA 1EP6A 1INCA 1ZHMA 1DT2A 3QK1A 2EI6A 1O3FA 1VCWA 3PO1B 1X7AC 1CE5A 4K8YA 5A0CA 5DKMA 5L2YH 5HM9A 5EW2H 1TQ0B 1OKXA 3L33A 2O8MA 2C8ZB 4JZ1A 1EKBB 3RXFA 2A55A 5F6MA 1MTSA 1SQTA 5E2OA 1XKBC 2D8WA 6CHAC 1A5HA 1BITA 4JHSA 3HKJB 3SNBA 5EGMA 3GCTF 3QDZB 3R3GB 1GI7B 4AG1A 4OGYA 1TNGA 4AYYB 1MMJN 2ZFTA 4JZIA 1F7ZA 1LHCH 2VIPA 3GDUA 1P57B 5EPNA 1DLEA 3TJOA 1C2DA 2BY5X 3A89A 4ZKSU 1S84A 1C4U2 2GKVE 2ULLA 2ZGXH 2V8EA 5K0HA 4Y71A 3LPRA 3SW2B 3TNTA 5FPYA 1FXYA 3C27B 2A7HA 5JBBS 5EOKA 1T8LA 5EU8A 1P10A 3TNSA 1S81A 2TBSA 3MNXA 4I8GA 2BZMA 1TGBA 4OGXA 1NU9A 4FUDA 1VITG 1IOEA 1EPTB 1O3PB 3NUMA 1ESAA 2H5CA 1NM6A 3RXIA 3SGQE 3SV6A 1GCTC 1UVUH 1RRKA 2PFEA 1UK4A 3F9EA 2J95A 4K1SA 4YNXA 4YZUA 3SU1A 1NY22 1H9LB 1J14A 2VVCA 1YPMH 4B75A 2ZTZA 2ZDAH 1GMDG 2CMYA 3SHAH 5T6GA 1EOLA 1U6QA 2XWBF 5LPRA 1IQKA 1SGYE 2OBQA 3QLPH 1C5MD 3RU4E 3ELAH 3RXPA 3MO6A 4NSYA 1RIWB 3MQLA 4D9RA 3TJVA 4Q7YA 3JZ1B 5FPTA 1RGQA 2EEKA 2OTVA 1QGBA 2YOLA 1EQ9A 1EATA 3S9AA 1YPLH 4XBBA 1RTLA 1DOJA 1P2KA 2G4TA 4DT7B 2YNAA 2GCHF 2B7DH 3MH7A 1OXGA 4A5TS 1H2PP 1DSTA 1SGTA 2WUCA 4XFQA 1GBLA 4X0WU 3S7HB 1ZMNA 5I25A 5IDKA 1GPZA 2VH6A 3RXCA 1UTKA 3SZNA 1SLVB 1ZLRA 5A8ZA 2OP9A 1QJ6B 3E6PH 2MCYA 2J9NA 3UUZA 1EOJA 1TMTH 1BMLA 5EQQA 3C1KA 1QB1A 4NWLA 3PV4A 4FXGG 5HGGA 4PROA 3MOCA 5TCAA 3T62A 1O3JA 1BQYA 4YOJA 1K1IA 2BY7X 2FOEA 3OP8A 3MNCA 2BLQA 4ASHA 1O30A 4NIXA 5E2PA 3RXGA 1OJYA 2A2XH 1TPSA 1HFDA 2F9PA 3A7WA 1NO9H 4NWKA 4RKJB 3PWBA 1Y5BT 4YTAA 4KTSA 2HVXA 3ZZDA 1FN8A 5DK1A 1XUIA 1ELTA 1C5LH 2OXSA 4AYDA 2FI4E 3ZVEA 2BXTH 4INKA 1SB1H 3A7XA 3LGIA 4FUHA 2AH4X 4VGCC 2AS9A 2AFQB 5E8EH 5GWZA 2Y6TA 3RUOA 1C2GA 3ZVGA 2G5NA 1ETSH 4XBCA 1O3KA 2LNCA 2W7UA 2Y5HA 1TPMA 2GD4B 4MG3A 3SJ8A 1TPAE 1QA0A 1SGQE 3SV7A 1OK2A 2PUXB 1DWBH 2FI3E 1XXFA 3O8DA 3M3TA 1P0SH 1L0ZA 1TRMA 4BXWA 3RXEA 1IQHA 2Q6FA 3R62A 1O3CA 1GMDF 1ZTKA 2PKAA 4HFPB 3QWCH 2A5AA 1UTOA 1NZQH 2OQ5A 4AX9H 2HPPH 1UTNA 1F0RA 1C5ZB 5BPEA 4NGAH 1Y3XA 2F9OA 5DP3A 1BTXA 1BHXB 1G4GA 1MAYA 2OC1A 1LVYA
chains in the Genus database with same CATH superfamily
1CU1A 1FAXA 1T31A 5JYIA 3RXUA 3GCOA 3RXKA 2GCTC 2CV3A 2GGVB 1PPFE 4K1TA 1ELCA 2Y5FA 1P9UA 1HXFH 2XC5A 1OYTH 1P2JA 3EA9A 4UFEH 2GT7A 2FS9A 1SG8B 4FUEA 3MH6A 6GCHG 2PGQB 4CHAC 2BLWA 4CH2B 1C5RA 2J5UA 3NRLA 2O8WA 1P04A 1SHYA 1GI5A 4BNRA 4UDWH 1G3EA 1TA2A 2FOHA 4FU9A 1FV9A 1TGTA 2EI7A 4AGKA 4MNWA 1LQDB 1DXPA 2FPZA 1BRAA 2ZF0H 1UJ1A 3FGRA 4X8UH 3OFND 5PTPA 3RLWH 3H7TA 1AO5A 1W3CA 2XCFA 3S7KB 2ANMH 1F0SA 1O5AB 3FAOA 1HUTH 2F9NA 2C8WB 2YMSB 1BA8B 2BVXH 1WQVH 4YIZA 1OP0A 3O8RA 3ZZCA 4GHTA 1O2GH 2PP6A 2VNTA 1ARBA 1WV7H 1CGHA 2V3HH 3W1EA 1FY1A 2IPHA 2J98B 1ANCA 1DSUA 4D76A 4O3UA 1AQ7A 1C5WB 4NSVA 4KTCA 4B2CA 1LPKB 2KFWA 1F5RA 1N8OC 2FS8A 2Z9LA 3KXVA 4I86A 1MZDA 2XXLA 1KXAA 1HAOH 3LJOA 1UTMA 3L89M 2A1DB 1GMCG 1EAIA 3LONA 3ODFA 3RMNH 1MQ6A 1ZTLA 1C1WH 2Z7FE 3PRDA 2G55A 4XBDA 1T8OA 5C5OA 2ZFFH 1UOTP 4IBLH 2I6SA 1A1RA 2ZPSA 3W94A 3T5FH 4XE4A 1Y5AT 3KQ5A 3TLOA 1TE0A 3HKIB 1HJAC 2RLPA 1BCUH 5C20A 2HLDD 2V6NA 3HGPA 1GJCB 3A82A 3E0NB 1EPTC 2AIPA 4A92A 1YBWA 1CHGA 3SU2A 1ETRH 3BIUH 4UFDH 2J4IA 1AKSA 1P2IA 2Q6DA 3M61U 1FZZA 2FYQA 2CXVA 4LOYH 1D3DB 1T32A 3UOUA 1MKXH 4J2YB 5C5NA 4INHA 1C2HA 1GVLA 1LKBA 1K0HA 2CGAA 2DUCA 1J17T 3TK6A 4ACBA 1FDPA 1WTGH 1FMGA 1NC6A 3LC3A 1GI4A 3VB6A 1KXEA 2ZU2A 2ANWA 3LC5A 2GDDA 4GCHG 1ZPZA 1TNKA 4GHQA 3PMHB 4UD9H 4ZCNA 1SFIA 1GBEA 4ISHH 1GBIA 1LMWB 1V2RT 1Z8JB 2ZWLH 1NRPH 4MUCA 3INBC 3SU5A 2BX4A 1O3AA 3I29A 3A8AA 1ZYOA 3BG8A 5GJ4B 2K8IA 2GP9B 3FZZA 1V2QT 3NZIA 2CG6A 1G3CA 3LGTA 1GBCA 2PV9B 2YRAA 3M35A 3QTOH 4Y7BA 2ANKH 1C2FA 3NK8A 2ZU5A 2ZIQH 3I77A 1ELFA 1WBGB 4PZ5A 1O35A 3A7VA 1WSSH 2K1QA 4ZMAH 4RT0A 2WPLS 3F9FA 3QZQA 4TPIZ 5T3HA 3OX7U 3K65B 1IQGA 5CHAC 3DSGA 2BOHB 1OX1A 1S82A 3ZV8A 2VVVA 1O2VA 1O3DA 1FBRA 1W12U 1XX9A 3ZLDA 3P92A 2R0KA 7ESTE 1TPNA 5JB9S 1GWAA 3GY6A 5LGOA 2F83A 1F2SE 2EY4C 1BUIA 3PMAB 2O9QA 3PTNA 2P94A 4NZQA 5GDSH 3SI3H 2ZQ1A 1O3EA 4MSLA 3SNCA 2QGRA 2ALVA 2VBCA 3LJJA 1D4PB 2FDAA 4DOQA 4ABAA 2CF8H 2O8TA 1H9HE 1ZZZA 2ZU4A 1QB6A 3DA9B 1OOKB 2UUJB 4XSKU 3GY3A 5CMXH 3ZVAA 2JGWA 1P01A 1KY9A 2Z3CA 4H6SB 1O33A 1PYTC 5EODA 2THFB 1T4VH 2R9PA 2IZ3A 1GDUA 1CVWH 4K3JA 3UREA 1KIGH 4K12A 3M5OA 1F5KU 2R2WU 3E1XB 4GCHF 1TQ7B 2DE9A 4NIYA 2YNBA 3TH3H 3NWUA 2GJGA 3SORA 1GHBG 1WXRA 1ANBA 1HV7A 4ABEA 3M7TA 3MFJA 4I31A 1THSH 4WH6A 2FM2A 5L2ZH 1QQ4A 2Z6BD 1V2OT 2DE8A 4A1XA 2Y81A 2ZG0H 4VGCB 2W3KA 3UNRA 2QIQA 1E0FD 2FWWA 1OPHB 2R0LA 1F0TA 1HFIA 1ELBA 3DT0H 1A5GH 3F1SB 4ZROA 1C2JA 1C2IA 2WPIS 1UTQA 1K1LA 3HK3B 1GHQB 1YPHE 2FO9A 3UB0A 4N7EA 1ZR0A 1GMHF 2CG7A 2A7CA 1HB0B 3V0XA 3M5MA 3GICB 2QY0A 1BBRK 5FXLA 3SUFA 1UVSH 1DLKB 1D9IA 4I33A 2P3FH 5A09A 3UR9A 2BDYA 5CDFE 4CR9A 1BTWA 4ESTE 1LTOA 1OHHD 2KMSA 1YKTA 3K6YA 4ABFA 1G32B 5T6FA 2BLVA 2A2QH 3ZZ7A 2ZCLP 4H4FA 2BY9X 1TWXB 4CRBA 3EJHA 1SS2A 1UK3A 2D2DA 1IQFA 1GHWH 5ABWA 1XXDA 4OM9A 1EZSC 3A7ZA 4CH8B 2A45B 3T5OA 3UWIA 1CA0C 3Q3KA 5AFYH 1NFWA 1ZSJA 1WDIA 1K22H 4SGBE 1THPB 3MNBA 4TSFD 4X1QU 4D7GA 3EAJA 1MTNB 4NIVA 1QJ7B 5H4IB 4AFZA 4XD7D 1VITH 2AGGX 3GY7A 1LY2A 4B2RA 1HPGA 1LHFH 4Y8ZA 2PKSB 3IU3I 5HYTB 3E8LA 3ATLA 1TPGA 3UNSA 2ZO3H 2ZZUH 1EJMA 3U98H 1OJVA 2V3MA 3MU8A 4MPWA 2FESH 2VWLA 4CRGA 2Y7XA 1VCPA 3DUXH 3F68H 2B8OH 1C5SA 1O2NA 2QYIA 1YLDA 1UTPA 1ELAA 3SBKA 2ZHDA 4BAKB 3ERBA 1A2CH 2QXHA 1MUEB 2BVRH 2VGCC 1O3GA 3FP7E 4FVBA 3T29A 1TX6A 4FUFA 1OYQA 1ELDE 4MPXA 4JYVH 5ETXA 3BIVH 3GDSA 5F8TA 1KDQA 3NJAA 1TBZH 4TY7A 4YM9A 2HNTF 1V2VT 2BDBA 1O3IA 1A46H 2A5IA 4Q7XA 1N8OB 3SU3A 1DWCH 5HMAA 1C1ZA 2K0QA 1O5GH 4AG2A 1T7CA 1A4WH 1P3CA 2KCYA 1V2UT 1V2KT 2PSXA 1EJAA 1O36A 4JYUH 1P09A 4AFUA 1DPOA 5HYUB 1S6HA 4ABDA 2BY8X 1KLJH 1TMUH 1LQEA 2OC0A 2W81A 4O3TA 1LDTT 4YT6H 1C1QA 2FODA 4CSYA 3WSYA 1CGJE 1HNEE 2ODPA 2OINA 3MI4A 1H8ED 1A0JA 1O3NA 2BDCA 2C3SA 2PKAB 1LCYA 4IMQA 3T27A 8KME2 1L1JA 5CHBA 1O2TA 3VB7A 1GBFA 8ESTE 1CGIE 5GCHG 3IITA 2Y8RA 3A84A 2L74A 1OP8A 4R0IA 2ILNA 1QBVH 1NT1A 1HJAB 5EQSA 2WV5A 3U9AH 4D8NA 1ID5H 4CRAA 1T8NA 2ZA5A 2AMQA 2G8TA 1DWDH 3TH4H 2BQ7B 2HLCA 1QNJA 2EI8A 1QRXA 4A6LA 3MO9A 1AVGH 2XRBA 3SN8A 1YPKH 1WCZA 2ZU1A 1ZJDA 3GY2A 4ZHMU 2RCEA 4ZHAA 3A83A 3RXAA 3LDXH 1QURH 1FN6A 2CN0H 4KP0A 1J16A 2FIRH 1BMFD 1MD7A 4IW4E 2OLGA 5DP8A 4Z6AH 2A5KA 2WIIC 1V6DA 1GKNA 3ZYEA 2PW8H 4TT3D 4AYVB 3RM0H 1QB9A 1FY4A 3BTTE 3RC4A 3NFPI 1Q3XA 1O3BA 3MH5A 3PV5A 1FLEE 1TA6A 4A5WB 3RMLH 1QRWA 1IQNA 3A80A 1OWJA 1TGNA 4B2SA 1LVOA 2WUBA 2IN2A 3A88A 5HIZA 1FI8A 1SQAA 1O0DH 2KM0A 3NXPA 4YOGA 3SNEA 1L1NA 1G37A 5HZPB 3NKKA 4INLA 5J4QA 1GJBB 1CT4E 1Z71A 2TGTA 1NFXA 5E0GA 1H8DH 3PROA 4NCYA 5A2MH 1VR1H 2QC2A 1EB2A 2AMDA 4ZKOU 3F2HA 2QF5A 2FXRA 1GBHA 4UFGH 1Y3YA 2FOFA 3E3TA 5CHAB 3OEHD 3S9CA 5FBIA 1YF4A 3FFGA 4E05H 4JYTA 2XNIA 1T4UH 2OD3B 1XUHA 1C5XB 4FUIA 4NA9H 2Y5GA 4ISIH 2Z9GA 3QTVH 2G81E 5FBEA 1O5CB 3H5CB 1AE8H 4LOSA 3KQDA 3RC5A 3PMBB 4AFQA 2F91A 1SGPE 1AE5A 1Z92B 1AI8H 1DY8A 1P11E 2BD3A 1KXBA 3UIRA 1V2TT 1PPCE 5FX6A 3JZ2B 3SQEE 1BJUA 1GI0A 1QBNA 2W26A 4E7RG 3UOPA 3A8BA 3UQOA 2Z9KA 2TPIZ 5HIYA 4JZFH 1YPJH 1VITF 3PLBA 3MMGA 5F53A 1AN1E 4DURA 1HAXB 2MCZA 1ABJH 2WSSD 3CS7A 4C16A 1A61H 1O2RA 4B74A 2R2MB 1AKSB 1ZGIA 1FIWA 3CALA 4E7NA 1C5OH 2C93B 3P17H 4UE7H 3B8JA 2Y82A 4B73A 2AIQA 1P2OA 2VIDA 1WUNH 3NPSA 4IGDA 3V3MA 4BTTB 3LT3A 9ESTA 2XWAA 3RXDA 1MZAA 4Q4LA 2Z9JA 4FOUC 1E34B 3EA8A 4WMEA 5T6DA 5A8XA 3BTHE 5JPMG 1SGEE 1SGFG 3ENSB 2C90B 1GHYH 3A81A 2J94A 1SBWA 2B9LA 1O31A 3ITIA 1SQRA 5BRRE 3SU4A 2PTCE 5FAHA 3VXEH 2TIOA 1MAXA 4J1YA 2IZ4A 1P02A 1MKWK 3U1JB 3SV2H 1W0KD 1CT2E 5GXPA 1TONA 2P95A 3RDZA 1XMNB 1ELVA 3FO8D 2C8YB 3OEDC 5TJXA 3TGJE 4HZHA 2SNWA 2P3UB 1JOUB 4KTUA 1T8MA 3LKWA 1MTNC 2ZHFH 1Y3WA 4DY7B 3AK5A 1OWIA 3A86A 3ZD1A 1RTKA 3WWBA 8GCHG 1FONA 2AEIH 2QAAA 1EXFA 4I8HA 2WHXA 2PKSC 2RKYA 1AD8H 2KX4A 3ESTA 3RXLA 4F49A 2XWJI 1NPMA 1GJ7B 4FUBA 3M5NA 2BMGB 1JWTA 3U8TH 4IC6A 2BQWB 3VB4A 1AVXA 2QE7D 1AHTH 4BAQB 2RKZA 5EXMA 3IG6B 3ZIAD 2UWLA 1HDTH 1P06A 1SL3A 5HXFA 1SLXB 1C2KA 2FZZA 4IC5A 4GVUA 3ZZ4A 5IYTA 3SW0X 2QF0A 3FP6E 1K1PA 4K60A 1PPZA 4DIHH 1DS2E 1UK2A 1C5NH 1KMHB 3MWIU 2HNTC 1O3MA 3SV8A 1CA0B 2KCAA 3MNSA 2Z94A 5EIYA 1GDNA 3FOAA 3PTBA 1CHOG 1BRUP 2GMTC 2ZPRA 2G4UA 1QO6A 3LGWA 3MH4A 5C1YA 2BDHA 1Z8IB 4MNVA 2BM2A 1O38A 3CI0J 1BBRE 1C2EA 1PQ7A 4ABGA 3ZZ6A 3KQEA 1HJ9A 4X8SH 1S83A 1RTFB 1DICA 1AWHB 2AYWA 4I8LA 2ZFRH 1NRSH 4BTIB 4BANB 1FUJA 1MU6B 4RKOB 1JRTA 1SI5H 1XUFA 2PGBB 1NWVA 3O8BA 4NFEA 1TB6H 1ZSLA 2AHME 1H04P 3HK6B 4B71A 4BXSA 3SUGA 3BEUA 1OP2A 4Y0YE 4AYEA 2VGCB 2ZHWH 3VGCB 1E1QD 3T26A 4JK5A 3EDXB 1BBRH 1UHBA 1O2JA 4GAWA 1HAPH 1N6XA 1SPJA 3QGNB 3QUMP 2FLBH 3Q3YA 1Z8RA 5DP7A 1BDAA 2YBYA 4IMZA 3GDVA 4M9FA 3KQBA 3Q76A 1SHHB 2ODYB 1FPCH 4WXIA 1PJPA 3P95A 3SYJA 1D3PB 6GCHF 1E88A 2PR3A 1AMHA 2IOTA 3B23B 3F0OA 5LPFA 4DW2U 5EG4A 5A8YA 2WYJA 2SGDE 1O2SA 4B2BA 1D3QB 1V2NT 4CRDA 3DFLA 2V3OH 3OYPA 4YLUA 1QUBA 3GISB 5EW1H 1QL7A 5FO8C 2PLXA 4BAMB 1RXPA 1K21H 1PQ8A 3KGPA 1V2WT 2UWNA 1V2MT 2H9HA 1OWHA 2QY0B 1CBWB 2WZQA 2ZI2H 5JB8S 4FETA 2R3UA 2XYAA 3FZDA 4I8JA 3WSXA 1EZUC 2HNTE 2PUQH 4NZLA 2H2ZA 3EQ0H 2WINI 1K1MA 3N7EA 4THNH 1DX5M 2GV6A 1E37B 2L6OA 2BOKA 4QT8C 4OS6A 1XVMA 1K1OA 2EC3A 5HM2A 3SI4H 4Y76A 3RU4T 1QRZA 3K2UA 4A1VA 1DXWA 1GGDB 3OAAD 3QZRA 2UWOA 4Y6DA 1AB9B 1GDQA 1HXEH 3PMJA 3TVJA 1PPBH 1FJSA 4X8TH 3BF6H 2ESTE 2ODQA 2RA0A 3SNDA 1NRQH 2CJIA 5KGOA 3OTJE 1ZGVA 1SVPA 1SGCA 2GX4A 2BZAA 2KCOA 2SGAA 1QTFA 1YLNA 2Q1JA 3F9GA 3PRBA 3D65E 3S9BA 3M3SA 5A0AE 2UUYA 3HGNA 3N7OA 1J8AA 1HAGE 1YM0A 2GV7A 2BD2A 3MU4A 5FPSA 3CENA 3GY4A 1JBUH 1EP5A 1W7XH 5DJ7A 4BTUB 1L2EA 4XDEA 3RM2H 1GJDB 1C1OA 1KTTB 3PLKA 1KXFA 1YPHC 2BD4A 5DSFA 5HYOA 1VCQA 1GMCF 2GVFA 2QV1A 1MU8B 2FX6A 3EE7A 3WY8A 3LGVA 2EQNA 1SQOA 5F8ZA 1YC0A 4RSPA 1GI3A 2QCYA 4Y8XA 4AGJA 3GOVB 2ALPA 4ISLA 3W95A 3GCHB 2VB0A 2PHBA 3LOXA 4HG6A 4JCNA 1DANH 1O9AA 4DGJA 5DP5A 2XBYA 1BTUA 3AAUA 1H2QP 2RL0A 3KF2A 4WY3A 3MO3A 4BAOB 1ACBE 2W6JD 4YXWD 2ZDLA 1C5UA 1KDQB 1OSSA 1PYTD 1XM1A 1WTHD 2STAE 4YLQH 4TWYA 1GJ8B 1W0YH 2BD8A 2M2AA 4DJZA 3KQCA 3K3TA 1SR5C 2ZYCA 3TH2H 1BTHH 1TABE 1O32A 1HGTH 3RLYH 3UWJH 1GI9B 1XUGA 4Y79A 5FL7D 1UCYK 4OS5A 2ZP0H 1SGFA 2XWBI 1O2QA 4ISOA 5EXNA 4B2AA 1GJ9B 1MCTA 3O8CA 2VIQA 1W2KH 5F8XA 3MU5A 5C17A 1C1RA 1Y8TA 2H9EH 2D26C 1QL9A 1L4DA 2J2UA 4WVPE 3AW0A 4JMYA 1S0QA 1VVCA 2GTBA 2SGEE 2XC0A 3TK9A 4DCDA 4CBOA 1BTYA 1AWFH 1AZZA 2VU8E 2W3IA 3A7TA 1YYY1 4KGAA 5EJ1A 1GJAB 1HYLA 2VINA 3ZLEA 3O8EB 4X6PA 1Y3VA 3MQKC 2A0QB 4X1NU 3BTKE 4IN1A 7GCHG 2WPMS 1UVPA 3LU9B 3ZYDA 1W0JD 2GZ7A 1ZMLA 1XKAC 1BOQA 3VFEA 1O3LA 2RA3A 4X2XA 3SQHE 4I7YH 4ASUD 2NU2E 2IJOB 4YT7H 3ZZ5A 1OWDA 2BLOA 1ETTH 2ZTXA 1K1JA 3VB3A 5B6OA 3Q77A 4CBNA 5EXLA 3PYHA 2BX3A 3ZD2A 1GI2A 2YMSD 5B6LA 3M7UA 1TLDA 2JH0D 1H8IH 1JXPA 1K9OE 1SOZA 3GCTG 1DFPA 3KN2A 1C5TA 2AERH 4X6OA 5AVDA 2CHAB 1RFNA 4CREA 1VJAU 3WWFA 1NRNH 2J97A 4B76A 1AGJA 1GHXH 4X2YA 1TALA 1BMAA 1KSNA 1EASA 4ABHA 5G4BA 1YLCA 4P02A 2WPHS 1DUAA 2H5DA 5KEDA 1ZHRA 1P3EA 1LHGH 3FP8E 1ZRKA 1HAVA 3RXTA 1RJXB 1DITH 4OS2A 2GDEH 3FN8A 1LPGB 3RXRA 1SSXA 1SFQB 1NROH 1HJ8A 2EA3A 1JMOH 3IWMA 3U8RH 3UQVA 1TIOA 2ZDMA 1MH0A 1J15A 3AASA 3NCLA 1TX7A 1O2KA 1TBRH 3ZVFA 1GI8B 4RN6A 1L4ZA 2JETB 1SC8U 2FOMB 1PQ5A 1UTLM 1WYKA 1HAYB 1TYNA 1C2MA 1NFUA 2VVUA 1N1LA 3ZVBA 1O2UA 3RU4D 4AN7A 1NU7B 1GHBF 1JRSA 2NU3E 3EYDA 2QXJA 1BMNH 1BTPA 1GJ6A 1P05A 1W13U 2QA9E 4Q63A 3VGCC 4AYMA 3QO6A 1SKYE 1W11U 2HWLB 1EAWA 1O2WA 1P12E 1FNIA 3K6ZA 2VH0A 2WPJS 1D3TB 1NBMD 4IN2A 1JIMA 2GMTB 3SU0A 1ZSKA 1TPOA 2FI5E 1GG6B 1LKAA 5KECA 2UUFB 3OY6U 2GCHG 1A0LA 1EZXC 1G36A 2G51A 1BRCE 3RXHA 3ZZ3A 1O3OA 4GPGA 1B0EA 2H1UA 4U30A 4MVNA 1C5QA 1G30B 3KL6A 3ZV9A 1YWUA 2Y8SA 2JDID 1MKWH 3TU7H 2NU4E 1G9IE 5E0JA 2XBWA 4CRCA 2V35A 4MNXA 1KLTA 3SJKA 1CBWC 1GVZA 1O2LA 4ISNA 3E91A 3SGBE 4FXGH 1YCPH 3P6ZB 1FY5A 3EGKH 1XUJA 3M36A 5C1UA 1HFHA 1M9UA 4J38B 1O2MA 2JJ1D 1G2LA 1O37A 5EJZA 1MBMA 2F9UA 4F55A 3UPEA 3A87A 3G01A 4ZAEA 7LPRA 2FX4A 1BT7A 3ATKA 2BDIA 4ABBA 1GGDC 1AB9C 4DG4A 5ESTE 6ESTA 3U28C 1GI6A 1LVBA 4Y10E 1GJ4H 1MTWA 1Z8GA 3OSYA 1TOMH 1CKLA 4YOIA 2ZQ2A 4U01A 1HCCA 3M7PA 3FGTA 3A8CA 4D9QA 1GBBA 3B9FH 1BTZA 3LH3A 3F9HA 1K28D 1GCDA 1QCPA 1TNIA 1D6RA 3A85A 2C8XB 5LPEA 4KKDA 2VWNA 4Q7ZA 1DDJA 4HI3A 2G52A 3BTME 2KRIA 2WV9A 1Y3UA 4LK4A 1FX0B 1NESE 1AVWA 1DUEA 2RLQA 3TPIZ 1YPGH 2F43B 3SJIA 1D6WA 1G3DA 1QA7A 2OCVB 5EQRA 2XRDA 4H6TA 2XQWC 2H9TH 2VIWA 1C1TA 4KELA 2EC9H 4GLYA 1TGCA 1SGDE 1H4WA 3STIA 3OU0A 1QQUA 4ABJA 1OK1A 1ZPBA 3ATWA 4K8BA 3GCHC 3WW7A 2HALA 1TFXA 2BD5A 3TGIE 2ZC9H 3P8OA 3KEEA 2VWMA 3QGJA 1E1RD 2FLRH 3BTDE 2FYRA 2CF9H 4NFFA 4WJG2 1O3HA 5JPMH 1QJ1B 2RFKC 1C9TA 2X2ZA 3ATIA 5C0UA 4CRFA 1HRTH 3RXSA 2LELA 3F6UH 4FUJA 3BN9A 1SRZA 4AFSA 3VB5A 2BDAA 5JBTA 3DSOA 2HRVA 3F0PA 1O5BB 1C1UH 4WMFA 3LIWA 2FTMA 1EB1H 4OS7A 3L6PA 1ANDA 1GHAG 1NFYA 5DGJA 2HGTH 2D1JA 2ZGBH 1NBME 1GBJA 1W7GH 1KTSB 2G5VA 1VGCC 4JZEH 4FUGA 3S0NA 2ANYA 2C4FH 1C1NA 1DVAH 2WV4A 5DN5A 5E0HA 1Z6EA 2ASUB 1C1MA 1HIAA 2ZHEH 2O8LA 4OS1A 3UR6A 1UVTH 2IPQX 1LHDH 3EE0B 4TWWA 2RDLA 3LH1A 2NU1E 1G2MA 2KAIA 4K2YA 2A4QA 2B0FA 3MTYA 4U2WA 2XCNA 3SJ9A 5GCHF 1IQJA 3P70B 1O39A 2QXIA 5F03A 3E90B 2EHFA 1PPGE 3PM3A 5IK2D 4AOQA 2SFAA 5I46H 3RXVA 2W6ID 1UHBB 9LPRA 4Z0KA 2P93A 1ELGA 4ZH1D 1A3BH 4FUCA 3MU0A 1TRNA 1SLWB 4E06H 5C2ZA 3TITA 2HPQH 4X2WA 1NRRH 3VG8A 1ZTJA 4H42U 2HVYB 1C4Y2 3VXFH 2WYGA 1WAYB 2BD7A 3MHWU 1F0UA 4Y7AA 3GYLB 2NU0E 4X1RU 1AY6H 2STBE 3EA7A 3QX5H 1O5DH 1SGRE 1ZMJA 2LPRA 4ZKNU 2G00A 1GVKB 2TRMA 1V3XA 3BTQE 1MTVA 5GIBA 1P2MA 2RG3A 2ZKSA 3TJUA 2BZ6H 4X6MA 2XBXA 4A7IB 2FOGA 3F2GA 1QGFA 2CHAC 1ORFA 5ESBA 1YPEH 1C5VA 2A7JA 1P03A 1OWKA 1V2PT 1C1SA 1O34A 1QZ8A 1W0ZU 3TJNA 3UNQA 1RD3B 1HAHH 2UUKB 2ZDKA 3GY5A 2A32A 1HCGA 2ZTYA 1AFQC 4R8TB 2GT8A 5DP4A 1V2JT 1L1GA 3TVJB 1YCPK 3VWOA 4GUXA 1WOFA 1BHXF 2SNVA 2UWPA 4ZXYH 1EAUA 5JBCS 3Q3XA 1EPTA 2VWOA 5A0BA 1O2IA 3L3TA 4D7FA 5C3NA 2BY6X 1S85A 3KNXA 2Q6GA 1GHAF 5C67A 2BYAX 2I2LA 4U32A 1UCYE 1FQ3A 1VZQH 5AFZH 1RS0A 1PFXC 1ESTA 1UTJA 2XC4A 3U1IB 1FY8E 1MCVA 4Y11E 2JETC 4UEHH 4YO9A 1TBQH 4ZHLU 1C1VH 2BHGA 2ZHQH 2KR7A 3P8NA 1TGSZ 3SNAA 5GPIB 3QN7A 1B0FA 3N99A 3U8OH 1IAUA 3D23A 3DD2H 1KXDA 1IHSH 1CA8B 1GJ5H 3M7QA 3STJA 1P2QA 2IJD1 3RXMA 2P59A 2V7QD 4AB8A 1GHZA 2SGPE 1WU1A 4Y0ZE 2OC7A 2ZPQA 3R0FA 3P8GA 3RMMH 3OY5U 1W14U 1UCYH 2LOJA 2PWXA 3SU6A 2GZ9A 1XVOA 4TPYA 2ERJA 3FANA 2M5TA 3LGUA 3TGKE 1GG6C 1Y5UT 2QF4A 1C4V2 2BXUH 2ZECA 4WH8A 5DN4A 2BDGA 5DPAA 3ZZBA 5C1XA 1P9SA 3PLPA 1CT0E 3PO1C 4FVDA 1QY6A 4MPUA 2CKUA 1IQLA 2XOKD 4RT1A 3UFAA 4DJZB 1BMMH 1ABIH 1E8BA 3AVZA 5TCCA 4F4OC 3SJOA 7KMEH 4FU7A 3PWCA 3IX0A 1HAZB 1YY3A 1O2YA 5J4SA 1LHEH 2GZ8A 3T28A 3RXBA 4ZXXH 1ARCA 4UONA 1W10U 2P8OB 4TYDA 3FKSD 3D62A 4JK6A 1IQMA 2FOCA 3BEIB 1YP9A 1HAIH 1TMBH 3AAVA 2AGIX 2ZEBA 4X2VA 1O2ZA 4LOTA 1C2LA 3ZZAA 1CQQA 3T25A 4DVAU 4WXVA 5FCRA 1NS3A 1ZHPA 1FAKH 3BG4B 3F3BA 4AYIA 2XRCA 5DG6A 1O5FH 4ZH8A 5DO4H 1E38B 4Z1MD 2A4RA 3ODDA 1AUJA 3TK5A 1TNHA 3SV9A 2OBOA 4AB9A 5DP9A 2VIOA 4O03A 8GCHF 1KXCA 1QHRB 1ZPCA 2ZGJA 4DIIH 1BB0B 1Z1IA 3SOSA 1GHVH 1MQ5A 2A4GA 2PSYA 3T2NA 3RP2A 1G3BA 1OK9A 1GBKA 1LO6A 3F6KA 1B7XB 1QIXB 1Y59T 3SO3A 2BTCE 2OQUA 1TNLA 4MLFB 3BTWE 6CHAB 1ELEE 2ZDNA 5L30H 3M3VA 3V12A 1CO7E 1HBTH 3UAIC 2QN5T 5CE1A 3GYMA 3ZRZA 3KYGA 2FOAA 3BEFB 3MU1A 3SZEA 1EZQA 4WF8A 4ZKRU 1GI1A 4Y8YA 4DT4A 5C0TA 1CSOE 2ZFSA 2ZNKH 1H9IE 4LXBH 4WMDA 1S5SA 3D49H 3P8FA 2OC8A 4X1PU 3BTFE 3A7YA 3CP7A 1O5EH 1O2HA 1RIWC 4M7GA 3PB1E 1PPEE 1O2PA 1COWD 4JZDH 1CHOF 3URDA 5K7RA 1E36B 3DSPA 4X6NA 2JRAA 3GXEA 2H6MA 5SGAE 1ANEA 3SUDA 1HAVB 1QR3E 1QFKH 4MPVA 3ZZ9A 5JBAS 1F5LA 2F3CE 4NG9H 4X1SU 1AFEH 1Q2WA 2ZFPH 1GCTB 1GMHG 4MNYA 1SOTA 1SMFE 3Q00A 4HGCA 4SGAE 2TGDA 1TNJA 3LGYA 2JKHA 3U69H 5I0QB 2XW9A 1OJWA 2A31A 1K2I1 3BTEE 1SLUB 2BD9A 1UVOA 4Q2KA 1BZXE 2ZFQH 2NWNA 1ZRBA 1LPZB 4YESB 3HPTB 3A8DA 4MTBA 1TX8A 1GBDA 4LZ4B 2HOBA 1GBMA 1FPHH 3SUEA 2ZGCA 2Y7ZA 2VIVA 3VEQB 1THRH 3V13A 2XBVA 2Z3EA 2ZU3A 3V7TA 2FOBA 2TGPZ 4TY6A 1GL1A 3CNRA 2J34A 3MYWA 3E0PB 5AHGH 2J98A 1P8VC 1YGCH 2FP7B 3K9XB 3RXJA 4ZUHA 1VGCB 1E35B 3ZVDA 4OS4A 1K1NA 1KYNA 2BQ6B 3VPKA 4B1TA 1MTUA 3TIUA 2B5TB 3OXUD 1VJ9U 4BOHA 4ABIA 2P16A 1AIXH 2R3YA 1A0HB 1EUFA 1PPQA 4I8KA 2FTLE 5FCKA 5L6NH 3FVFB 3AW1A 3I78A 3UY9A 1HLTH 4O97A 1NTPA 2WPKS 1MBQA 1AU8A 5FHTA 1VKYA 2ZDVH 1OWEA 1EAXA 1KLIH 1TRYA 1LVMA 1V2LT 1XUKA 1ZJKA 2OK5A 2G7IA 1YCPM 4LZ1H 1F92A 3E16B 1E5GA 1IQIA 4K5ZA 2I6QA 2F9VA 1O2OA 4HTCH 4NA8A 2ZGHA 3KIDU 5DP6A 1G4FA 2J38A 5T1VA 3RXOA 4AORA 1W8BH 3UTUH 1IQEA 1GBAA 4NIWA 3F2FA 4MDSA 2O39C 1DY9A 1TPPA 2TGAA 1C5PA 3URCA 2W7SA 1OK3A 2SGQE 2W80A 1AUTC 1PQAA 5HYPA 1DE7H 1EJNA 1NN6A 1FIZA 2WPDD 1Q31A 2J92A 4CR5A 1UO6A 1FY3A 2W5EA 4X8VH 1B5GH 1EFRD 1TOCB 3OEED 1BRBE 2V0BA 3BSQA 8LPRA 4FU8A 4NA7A 1GL0E 1H03P 2XNDD 4K69A 5FX5A 1BIOA 3H7OA 4B6FA 4O9VA 4GSOA 2JH5D 2BVSH 2Z3DA 2SGFE 1C1PA 1V2ST 2AMPA 1C5YB 3OTPA 3KZJA 2ZCHP 1SGNE 4K1EA 3PV2A 3RXQA 1DM4B 2QF3A 3DHKH 2O8UA 1Z6JH 1H1BA 2VJ1A 1Z1JA 1P2NA 2AGEX 1S6FA 1AZ8A 2ZCKP 4AZ2B 4MQAA 4I32A 1AFQB 3ATMA 3S69A 2B5ID 3BV9B 1EX3A 3RJ3D 1MKXK 3SGAE 2JH6D 3SHCH 5LH8A 2YMSC 1BJVA 1PPHE 3BTGE 4BAHB 1S0RA 1GBTA 2GCTB 3GY8A 4UFFH 3GCNA 1UMAH 1O2XA 5EPYA 1ESBA 1GKGA 5HKKD 2A4OA 4F48B 1N6YA 1A3EH 2OUAA 1IHTH 1A5IA 1J9CH 2FEQH 2FMJA 3M5LA 4B6EA 1ZOMA 2JGXA 4CHAB 2F9BH 4A1TA 1MD8A 2CK3D 1TAWA 5JDUB 4Q80A 2P3TB 2QXGA 4IS5A 3DFJA 1DWEH 1HIAB 4ONTD 1OS8A 4WWYA 1SGIB 2P8OC 3KHVA 3CS0A 2KAIB 1QBOA 3RC6A 3KCGH 2Y80A 2Z9IA 3GOVA 1U5MA 3DCLA 1A7SA 1VVDA 1QL8A 5AF9H 2PTNA 1Z7KA 3ZZ8A 3BG4C 2XTTB 6LPRA 4PO7A 1WQSA 5EJLA 3RMOH 3ZVCA 3HATH 4APLA 1C9PA 1H8HD 7GCHF 2BB4A 1JIRA 3M37A 4XOJA 1EP6A 1INCA 1ZHMA 1DT2A 3QK1A 2EI6A 1O3FA 1VCWA 3PO1B 1X7AC 1CE5A 5GNDA 4K8YA 5A0CA 5DKMA 5L2YH 5HM9A 5EW2H 5DN6D 1TQ0B 1OKXA 3L33A 2O8MA 2C8ZB 4JZ1A 1EKBB 3RXFA 2A55A 3H09A 5F6MA 1MTSA 1SQTA 5E2OA 1XKBC 2JIZD 2D8WA 6CHAC 1A5HA 1BITA 4JHSA 3HKJB 3SNBA 5EGMA 3GCTF 3QDZB 3GS9A 3R3GB 1GI7B 4AC9A 4AG1A 4OGYA 1TNGA 4AYYB 1MMJN 2ZFTA 4JZIA 1F7ZA 1LHCH 2VIPA 3GDUA 1P57B 2Y8TA 1DLEA 5EPNA 3TJOA 1C2DA 2BY5X 3A89A 4ZKSU 1S84A 1C4U2 2GKVE 2ULLA 2ZGXH 2V8EA 5K0HA 4Y71A 3LPRA 3SW2B 1MABB 3TNTA 5FPYA 1FXYA 3C27B 2A7HA 2JJ2D 5EOKA 5JBBS 1T8LA 5EU8A 1P10A 4RI0A 3TNSA 1S81A 2TBSA 3MNXA 4I8GA 2BZMA 1TGBA 4OGXA 1NU9A 4FUDA 4XRNA 1VITG 1IOEA 1EPTB 1O3PB 3NUMA 1ESAA 2H5CA 1NM6A 3RXIA 3N7DA 2F4LA 4BWCA 3SGQE 3SV6A 1GCTC 1UVUH 1RRKA 2PFEA 1UK4A 3F9EA 2J95A 4K1SA 4YNXA 4YZUA 3SU1A 1NY22 1H9LB 1J14A 2VVCA 1YPMH 4B75A 2ZTZA 2ZDAH 1GMDG 2CMYA 3SHAH 5T6GA 1EOLA 1U6QA 2XWBF 5LPRA 5C94A 1IQKA 1SGYE 2OBQA 3QLPH 1C5MD 3RU4E 3ELAH 3RXPA 3MO6A 4NSYA 1RIWB 3MQLA 4D9RA 3TJVA 4Q7YA 3JZ1B 5FPTA 1RGQA 1RLHA 2EEKA 2OTVA 1QGBA 2YOLA 2KCPA 1EQ9A 1EATA 3S9AA 1YPLH 4XBBA 1RTLA 1DOJA 1P2KA 2G4TA 4DT7B 2YNAA 2GCHF 2B7DH 3MH7A 2LP6A 1UW7A 1OXGA 4A5TS 1H2PP 1DSTA 1SGTA 2WUCA 4XFQA 3OE7D 1GBLA 4X0WU 3S7HB 1ZMNA 5I25A 5IDKA 1GPZA 2VH6A 3RXCA 1UTKA 3SZNA 1SLVB 1ZLRA 2RDEA 5A8ZA 2OP9A 1QJ6B 3E6PH 2MCYA 2J9NA 3UUZA 1EOJA 1TMTH 1BMLA 5EQQA 3C1KA 1QB1A 4NWLA 2KZ4A 3PV4A 4FXGG 4ACAA 5HGGA 1S6LA 3MOCA 4PROA 5TCAA 1O3JA 3T62A 1BQYA 4YOJA 1K1IA 2BY7X 2FOEA 3OP8A 3MNCA 2BLQA 4ASHA 1O30A 4NIXA 5E2PA 1E79D 3RXGA 1OJYA 2A2XH 1TPSA 1HFDA 2F9PA 3KYFA 3A7WA 1NO9H 4NWKA 4RKJB 3PWBA 1Y5BT 4YTAA 4KTSA 2HVXA 3ZZDA 1FN8A 5DK1A 1XUIA 1ELTA 1C5LH 2OXSA 4AYDA 2FI4E 3ZVEA 2BXTH 4INKA 1SB1H 3A7XA 3LGIA 4FUHA 2AH4X 4VGCC 2AS9A 2AFQB 5E8EH 5GWZA 2Y6TA 3RUOA 1C2GA 3ZVGA 2G5NA 1ETSH 4XBCA 1O3KA 2LNCA 2W7UA 2Y5HA 1TPMA 2GD4B 4MG3A 3SJ8A 1TPAE 1QA0A 1SGQE 3SV7A 1OK2A 4P00A 2PUXB 1DWBH 2FI3E 1XXFA 3O8DA 3M3TA 1P0SH 1L0ZA 1TRMA 4BXWA 3RXEA 1IQHA 2Q6FA 3R62A 1O3CA 1GMDF 1ZTKA 2PKAA 4HFPB 3QWCH 2A5AA 1UTOA 1NZQH 2OQ5A 4AX9H 2HPPH 1UTNA 1F0RA 1C5ZB 5BPEA 4NGAH 1Y3XA 2F9OA 5DP3A 1BTXA 1BHXB 1G4GA 1MAYA 2OC1A 1LVYA
chains in the Genus database with same CATH topology
1CU1A 1FAXA 1T31A 5JYIA 3RXUA 3GCOA 3RXKA 2GCTC 2CV3A 2GGVB 1PPFE 4K1TA 1ELCA 2Y5FA 1P9UA 1HXFH 2XC5A 1OYTH 1P2JA 3EA9A 4UFEH 2GT7A 2FS9A 1SG8B 4FUEA 3MH6A 6GCHG 2PGQB 4CHAC 2BLWA 4CH2B 1C5RA 2O8WA 1P04A 1SHYA 1GI5A 4BNRA 4UDWH 1G3EA 1TA2A 2FOHA 4FU9A 1FV9A 1TGTA 2EI7A 4AGKA 4MNWA 1LQDB 1DXPA 2FPZA 1BRAA 2ZF0H 1UJ1A 4X8UH 5PTPA 3RLWH 3H7TA 1AO5A 1W3CA 2XCFA 3S7KB 2ANMH 1F0SA 1O5AB 3FAOA 1HUTH 2F9NA 2C8WB 1BA8B 2BVXH 1WQVH 1OP0A 3O8RA 3ZZCA 4GHTA 1O2GH 2VNTA 1ARBA 1WV7H 1CGHA 2V3HH 1FY1A 2IPHA 1ANCA 1DSUA 4D76A 4O3UA 1AQ7A 1C5WB 4NSVA 4KTCA 4B2CA 1LPKB 1F5RA 1N8OC 2FS8A 2Z9LA 3KXVA 1MZDA 2XXLA 1KXAA 1HAOH 3LJOA 1UTMA 3L89M 2A1DB 1GMCG 1EAIA 3LONA 3ODFA 3RMNH 1MQ6A 1ZTLA 1C1WH 2Z7FE 2G55A 4XBDA 1T8OA 5C5OA 2ZFFH 1UOTP 4IBLH 2I6SA 1A1RA 2ZPSA 3W94A 3T5FH 4XE4A 1Y5AT 3TLOA 1TE0A 3HKIB 1HJAC 2RLPA 1BCUH 5C20A 3HGPA 2V6NA 1GJCB 3A82A 3E0NB 1EPTC 2AIPA 4A92A 1YBWA 1CHGA 3SU2A 1ETRH 3BIUH 4UFDH 2J4IA 1AKSA 1P2IA 2Q6DA 3M61U 1FZZA 2FYQA 2CXVA 4LOYH 1D3DB 1T32A 3UOUA 1MKXH 4J2YB 5C5NA 4INHA 1C2HA 1GVLA 1LKBA 2CGAA 2DUCA 1J17T 3TK6A 1FDPA 1WTGH 1FMGA 1NC6A 3LC3A 1GI4A 3VB6A 1KXEA 2ZU2A 2ANWA 3LC5A 2GDDA 4GCHG 1ZPZA 1TNKA 4GHQA 3PMHB 4UD9H 1SFIA 1GBEA 4ISHH 1GBIA 1LMWB 1V2RT 1Z8JB 2ZWLH 1NRPH 4MUCA 3INBC 3SU5A 2BX4A 1O3AA 3I29A 3A8AA 1ZYOA 3BG8A 5GJ4B 2GP9B 3FZZA 1V2QT 3NZIA 2CG6A 1G3CA 3LGTA 1GBCA 2PV9B 2YRAA 3M35A 3QTOH 4Y7BA 2ANKH 1C2FA 3NK8A 2ZU5A 2ZIQH 3I77A 1ELFA 1WBGB 4PZ5A 1O35A 3A7VA 1WSSH 2K1QA 4ZMAH 2WPLS 3F9FA 3QZQA 4TPIZ 5T3HA 3OX7U 3K65B 1IQGA 5CHAC 2BOHB 1OX1A 1S82A 3ZV8A 2VVVA 1O2VA 1O3DA 1FBRA 1W12U 1XX9A 3P92A 2R0KA 7ESTE 1TPNA 5JB9S 1GWAA 3GY6A 5LGOA 2F83A 1F2SE 1BUIA 3PMAB 2O9QA 3PTNA 2P94A 4NZQA 5GDSH 3SI3H 2ZQ1A 1O3EA 3SNCA 2QGRA 2ALVA 3LJJA 1D4PB 2FDAA 4DOQA 4ABAA 2CF8H 2O8TA 1H9HE 1ZZZA 2ZU4A 1QB6A 3DA9B 1OOKB 2UUJB 4XSKU 3GY3A 5CMXH 3ZVAA 2JGWA 1P01A 1KY9A 2Z3CA 4H6SB 1O33A 1PYTC 5EODA 2THFB 1T4VH 2R9PA 2IZ3A 1GDUA 1CVWH 4K3JA 3UREA 1KIGH 4K12A 3M5OA 1F5KU 2R2WU 3E1XB 4GCHF 1TQ7B 2DE9A 4NIYA 2YNBA 3TH3H 3NWUA 3SORA 1GHBG 1ANBA 1HV7A 4ABEA 3M7TA 3MFJA 4I31A 1THSH 4WH6A 2FM2A 5L2ZH 1QQ4A 2Z6BD 1V2OT 2DE8A 4A1XA 2Y81A 2ZG0H 4VGCB 2W3KA 3UNRA 2QIQA 1E0FD 2FWWA 1OPHB 2R0LA 1F0TA 1HFIA 1ELBA 3DT0H 1A5GH 3F1SB 4ZROA 1C2JA 1C2IA 2WPIS 1UTQA 1K1LA 3HK3B 1GHQB 1YPHE 2FO9A 1ZR0A 1GMHF 2CG7A 2A7CA 1HB0B 3V0XA 3M5MA 3GICB 2QY0A 1BBRK 5FXLA 3SUFA 1UVSH 1DLKB 1D9IA 4I33A 2P3FH 5A09A 3UR9A 2BDYA 4CR9A 1BTWA 4ESTE 1LTOA 2KMSA 1YKTA 3K6YA 4ABFA 1G32B 5T6FA 2BLVA 2A2QH 3ZZ7A 2ZCLP 4H4FA 2BY9X 1TWXB 4CRBA 3EJHA 1SS2A 1UK3A 2D2DA 1IQFA 1GHWH 5ABWA 1XXDA 1EZSC 3A7ZA 4CH8B 2A45B 3T5OA 3UWIA 1CA0C 3Q3KA 5AFYH 1NFWA 1ZSJA 1K22H 4SGBE 1THPB 3MNBA 4X1QU 4D7GA 3EAJA 1MTNB 4NIVA 1QJ7B 5H4IB 4AFZA 1VITH 2AGGX 3GY7A 1LY2A 4B2RA 1HPGA 1LHFH 4Y8ZA 2PKSB 3IU3I 5HYTB 3E8LA 3ATLA 1TPGA 3UNSA 2ZO3H 2ZZUH 1EJMA 3U98H 1OJVA 3MU8A 4MPWA 2FESH 2VWLA 4CRGA 2Y7XA 1VCPA 3DUXH 3F68H 2B8OH 1C5SA 1O2NA 2QYIA 1YLDA 1UTPA 1ELAA 3SBKA 2ZHDA 4BAKB 3ERBA 1A2CH 2QXHA 1MUEB 2BVRH 2VGCC 1O3GA 3FP7E 4FVBA 3T29A 1TX6A 4FUFA 1OYQA 1ELDE 4MPXA 4JYVH 5ETXA 3BIVH 3GDSA 5F8TA 1KDQA 1TBZH 4TY7A 4YM9A 2HNTF 1V2VT 2BDBA 1O3IA 1A46H 2A5IA 4Q7XA 1N8OB 3SU3A 1DWCH 5HMAA 1C1ZA 1O5GH 4AG2A 1T7CA 1A4WH 1P3CA 1V2UT 1V2KT 2PSXA 1EJAA 1O36A 4JYUH 1P09A 4AFUA 1DPOA 5HYUB 1S6HA 4ABDA 2BY8X 1KLJH 1TMUH 1LQEA 2OC0A 2W81A 4O3TA 1LDTT 4YT6H 1C1QA 2FODA 4CSYA 1CGJE 1HNEE 2ODPA 3MI4A 2OINA 1O3NA 1A0JA 2BDCA 2C3SA 3T27A 2PKAB 1LCYA 4IMQA 8KME2 1L1JA 1O2TA 3VB7A 1GBFA 8ESTE 1CGIE 5GCHG 3IITA 3A84A 1OP8A 4R0IA 2ILNA 1QBVH 1NT1A 1HJAB 5EQSA 2WV5A 3U9AH 4D8NA 1ID5H 4CRAA 1T8NA 2ZA5A 2AMQA 2G8TA 1DWDH 3TH4H 2BQ7B 2HLCA 1QNJA 2EI8A 1QRXA 4A6LA 3MO9A 1AVGH 2XRBA 3SN8A 1YPKH 1WCZA 2ZU1A 1ZJDA 3GY2A 4ZHMU 2RCEA 4ZHAA 3A83A 3RXAA 3LDXH 1QURH 1FN6A 2CN0H 4KP0A 1J16A 2FIRH 1MD7A 4IW4E 2OLGA 5DP8A 4Z6AH 2A5KA 2WIIC 1V6DA 1GKNA 3ZYEA 2PW8H 4AYVB 3RM0H 1QB9A 1FY4A 3BTTE 3RC4A 3NFPI 1Q3XA 1O3BA 3MH5A 1FLEE 1TA6A 4A5WB 3RMLH 1QRWA 1IQNA 3A80A 1OWJA 1TGNA 4B2SA 1LVOA 2WUBA 2IN2A 3A88A 1FI8A 1SQAA 1O0DH 3NXPA 4YOGA 3SNEA 1L1NA 1G37A 5HZPB 3NKKA 4INLA 5J4QA 1GJBB 1CT4E 1Z71A 2TGTA 1NFXA 5E0GA 1H8DH 3PROA 4NCYA 5A2MH 1VR1H 2QC2A 1EB2A 2AMDA 4ZKOU 2FXRA 1GBHA 4UFGH 1Y3YA 2FOFA 3E3TA 5CHAB 3S9CA 5FBIA 1YF4A 3FFGA 4E05H 4JYTA 2XNIA 1T4UH 2OD3B 1XUHA 1C5XB 4FUIA 4NA9H 2Y5GA 4ISIH 2Z9GA 3QTVH 2G81E 5FBEA 1O5CB 3H5CB 1AE8H 4LOSA 3KQDA 3RC5A 3PMBB 4AFQA 2F91A 1SGPE 1AE5A 1Z92B 1AI8H 1DY8A 1P11E 2BD3A 1KXBA 3UIRA 1V2TT 1PPCE 5FX6A 3JZ2B 3SQEE 1BJUA 1GI0A 1QBNA 2W26A 4E7RG 3UOPA 3A8BA 3UQOA 2Z9KA 2TPIZ 4JZFH 1YPJH 1VITF 3PLBA 3MMGA 1AN1E 4DURA 1HAXB 2MCZA 1ABJH 3CS7A 4C16A 1A61H 1O2RA 4B74A 2R2MB 1AKSB 1ZGIA 1FIWA 3CALA 4E7NA 1C5OH 2C93B 3P17H 4UE7H 3B8JA 2Y82A 4B73A 2AIQA 1P2OA 2VIDA 1WUNH 3NPSA 4IGDA 3V3MA 4BTTB 3LT3A 9ESTA 2XWAA 3RXDA 1MZAA 2Z9JA 5T6DA 1E34B 3EA8A 4WMEA 5A8XA 3BTHE 5JPMG 1SGEE 1SGFG 3ENSB 2C90B 1GHYH 3A81A 2J94A 1SBWA 2B9LA 1O31A 3ITIA 5BRRE 3SU4A 2PTCE 5FAHA 3VXEH 2TIOA 1MAXA 4J1YA 2IZ4A 1P02A 1MKWK 3U1JB 3SV2H 1CT2E 5GXPA 1TONA 2P95A 3RDZA 1XMNB 1ELVA 2C8YB 3OEDC 5TJXA 3TGJE 4HZHA 2SNWA 2P3UB 1JOUB 4KTUA 1T8MA 3LKWA 1MTNC 2ZHFH 1Y3WA 4DY7B 1OWIA 3A86A 3ZD1A 1RTKA 8GCHG 1FONA 2AEIH 2QAAA 1EXFA 4I8HA 2PKSC 2RKYA 1AD8H 3ESTA 3RXLA 4F49A 2XWJI 1NPMA 1GJ7B 4FUBA 3M5NA 2BMGB 1JWTA 3U8TH 4IC6A 2BQWB 3VB4A 1AVXA 1AHTH 4BAQB 2RKZA 5EXMA 3IG6B 2UWLA 1HDTH 1P06A 1SL3A 5HXFA 1SLXB 1C2KA 2FZZA 4IC5A 4GVUA 3ZZ4A 5IYTA 3SW0X 2QF0A 3FP6E 1K1PA 4K60A 1PPZA 4DIHH 1DS2E 1UK2A 1C5NH 3MWIU 2HNTC 1O3MA 3SV8A 1CA0B 3MNSA 2Z94A 1GDNA 3PTBA 1CHOG 1BRUP 2GMTC 2ZPRA 2G4UA 1QO6A 3LGWA 3MH4A 5C1YA 2BDHA 1Z8IB 4MNVA 2BM2A 1O38A 1BBRE 1C2EA 1PQ7A 4ABGA 3ZZ6A 3KQEA 1HJ9A 4X8SH 1S83A 1RTFB 1DICA 1AWHB 2AYWA 4I8LA 2ZFRH 1NRSH 4BTIB 4BANB 1FUJA 1MU6B 4RKOB 1JRTA 1SI5H 1XUFA 2PGBB 1NWVA 3O8BA 4NFEA 1TB6H 1ZSLA 1H04P 3HK6B 4B71A 4BXSA 3SUGA 3BEUA 1OP2A 4Y0YE 4AYEA 2VGCB 2ZHWH 3VGCB 3T26A