1U5MA

Structure of a chordin-like cysteine-rich repeat (vwc module) from collagen iia
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
73
structure length
73
Chain Sequence
YVEFQEAGSCVQDGQRYNDKDVWKPEPCRICVCDTGTVLCDDIICEDVKDCLSPEIPFGECCPICPADLAAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha 1 type II collagen isoform 1
publication title Solution structure and dynamics of a prototypical chordin-like cysteine-rich repeat (von Willebrand Factor type C module) from collagen IIA
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00093 VWC von Willebrand factor type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1u5mA01
2BZMA 2RL0A 1GHQB 4J38B 1GKGA 2CG7A 1SRZA 3OEDC 1U5MA 1VVDA 2O39C 2WIIC 1QGBA 2A55A 3M7PA 3RJ3D 1OK3A 1G4FA 2XRBA 3T5OA 3OXUD 4YNXA 3O8EB 4CSYA 1H03P 1E88A 5HYPA 1FBRA 2YBYA 2JRAA 4AYMA 4A5WB 3KXVA 1MD8A 1ELVA 4KKDA 4LOTA 1OJVA 5FO8C 1TPNA 2IZ3A 1G4GA 2RKYA 2KRIA 2CG6A 5I0QB 1OJYA 1CKLA 3CALA 4B2SA 1PPQA 1C1ZA 2XWBF 1HFIA 1GPZA 4ZH1D 3ZD1A 2RLQA 2G7IA 3ZD2A 4AYIA 1QO6A 2B5ID 2LOJA 1O9AA 2MCZA 2XQWC 3NFPI 4AYDA 2UWNA 3ZRZA 3OP8A 3SW0X 1OK1A 1H04P 2RKZA 1H2QP 4JHSA 3IX0A 1OK2A 4FXGG 2EC3A 1Z92B 4LOSA 1VVCA 3GXEA 1GKNA 1TPMA 1QUBA 2W80A 2XWJI 1HCCA 1ZJKA 4K12A 2W81A 2EHFA 1OK9A 1UOTP 3EJHA 3IU3I 1MD7A 4IGDA 4MUCA 2KMSA 3MQLA 4F4OC 3R62A 1E5GA 3ERBA 4PZ5A 5HZPB 1NWVA 4WJG2 1SS2A 3GOVA 2IZ4A 4ONTD 2YRAA 4B2RA 3KZJA 4DJZA 2JGXA 4C16A 1E8BA 2ERJA 3L89M 2JGWA 2XRDA 2V8EA 2QY0A 3TVJA 2MCYA 2RLPA 1OJWA 1H2PP 3INBC 5JPMG 1HFHA 1TPGA 4AYEA 5HYTB 1LY2A 1Q3XA 5HYUB 2CKUA
chains in the Genus database with same CATH superfamily
2BZMA 2RL0A 1GHQB 3WSXA 4J38B 1GKGA 2CG7A 1SRZA 3OEDC 3ZLDA 4YIZA 5DN5A 1U5MA 1VVDA 4PO7A 2O39C 2WIIC 1QGBA 2A55A 3M7PA 3RJ3D 1OK3A 1G4FA 2XRBA 3T5OA 3OXUD 4YNXA 3O8EB 4CSYA 2I2LA 1H03P 1E88A 5HYPA 1FBRA 2YBYA 2JRAA 4AYMA 4A5WB 1RLHA 3KXVA 1MD8A 1ELVA 4KKDA 4LOTA 1OJVA 5FO8C 1TPNA 2IZ3A 1G4GA 2RKYA 2KRIA 2CG6A 2Y8TA 5I0QB 1OJYA 1CKLA 3CALA 4B2SA 1PPQA 1C1ZA 2XWBF 1HFIA 1GPZA 4ZH1D 3ZD1A 2RLQA 2G7IA 3ZD2A 2Y8SA 4AYIA 1QO6A 2B5ID 2LOJA 1O9AA 2MCZA 2XQWC 3NFPI 4AYDA 2UWNA 3ZRZA 3OP8A 3SW0X 1OK1A 1H04P 2RKZA 1H2QP 4JHSA 3IX0A 1OK2A 4FXGG 2EC3A 1Z92B 2X2ZA 1VVCA 4LOSA 3GXEA 1GKNA 1TPMA 4APLA 1QUBA 2W80A 2XWJI 1HCCA 1ZJKA 4K12A 2W81A 2EHFA 1OK9A 1UOTP 3EJHA 3IU3I 1MD7A 4IGDA 4MUCA 3VWOA 4BWCA 2KMSA 3MQLA 4F4OC 3R62A 1E5GA 3ERBA 4PZ5A 5HZPB 1NWVA 4WJG2 1SS2A 3CI0J 3F6KA 3GOVA 2IZ4A 4ONTD 3FGRA 2YRAA 4B2RA 4MSLA 2Y8RA 3KZJA 4DJZA 2JGXA 4C16A 1E8BA 2ERJA 3L89M 3K3TA 3NJAA 2JGWA 2XRDA 4N7EA 3FGTA 2V8EA 2QY0A 3TVJA 2MCYA 3ZLEA 2RLPA 1OJWA 1H2PP 3INBC 5JPMG 1HFHA 1TPGA 5DN4A 4AYEA 2ZYCA 5HYTB 1LY2A 3WSYA 1Q3XA 5HYUB 2CKUA
chains in the Genus database with same CATH topology
2BZMA 2RL0A 1GHQB 4J38B 1GKGA 2CG7A 1SRZA 3OEDC 1U5MA 1VVDA 2O39C 2WIIC 1QGBA 2A55A 3M7PA 3RJ3D 1OK3A 1G4FA 2XRBA 3T5OA 3OXUD 4YNXA 3O8EB 4CSYA 1H03P 1E88A 5HYPA 1FBRA 2YBYA 2JRAA 4AYMA 4A5WB 3KXVA 1MD8A 1ELVA 4KKDA 4LOTA 1OJVA 5FO8C 1TPNA 2IZ3A 1G4GA 2RKYA 2KRIA 2CG6A 5I0QB 1OJYA 1CKLA 3CALA 4B2SA 1PPQA 1C1ZA 2XWBF 1HFIA 1GPZA 4ZH1D 3ZD1A 2RLQA 2G7IA 3ZD2A 4AYIA 1QO6A 2B5ID 2LOJA 1O9AA 2MCZA 2XQWC 3NFPI 4AYDA 2UWNA 3ZRZA 3OP8A 3SW0X 1OK1A 1H04P 2RKZA 1H2QP 4JHSA 3IX0A 1OK2A 4FXGG 2EC3A 1Z92B 4LOSA 1VVCA 3GXEA 1GKNA 1TPMA 1QUBA 2W80A 2XWJI 1HCCA 1ZJKA 4K12A 2W81A 2EHFA 1OK9A 1UOTP 3EJHA 3IU3I 1MD7A 4IGDA 4MUCA 2KMSA 3MQLA 4F4OC 3R62A 1E5GA 3ERBA 4PZ5A 5HZPB 1NWVA 4WJG2 1SS2A 3GOVA 2IZ4A 4ONTD 2YRAA 4B2RA 3KZJA 4DJZA 2JGXA 4C16A 1E8BA 2ERJA 3L89M 2JGWA 2XRDA 2V8EA 2QY0A 3TVJA 2MCYA 2RLPA 1OJWA 1H2PP 3INBC 5JPMG 1HFHA 1TPGA 4AYEA 5HYTB 1LY2A 1Q3XA 5HYUB 2CKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZM A;  2RL0 A;  1GHQ B;  4J38 B;  1GKG A;  2CG7 A;  1SRZ A;  3OED C;  1U5M A;  1VVD A;  2O39 C;  2WII C;  1QGB A;  2A55 A;  3M7P A;  3RJ3 D;  1OK3 A;  1G4F A;  2XRB A;  3T5O A;  3OXU D;  4YNX A;  3O8E B;  4CSY A;  1H03 P;  1E88 A;  5HYP A;  1FBR A;  2YBY A;  2JRA A;  4AYM A;  4A5W B;  3KXV A;  1MD8 A;  1ELV A;  4KKD A;  4LOT A;  1OJV A;  5FO8 C;  1TPN A;  2IZ3 A;  1G4G A;  2RKY A;  2KRI A;  2CG6 A;  5I0Q B;  1OJY A;  1CKL A;  3CAL A;  4B2S A;  1PPQ A;  1C1Z A;  2XWB F;  1HFI A;  1GPZ A;  4ZH1 D;  3ZD1 A;  2RLQ A;  2G7I A;  3ZD2 A;  4AYI A;  1QO6 A;  2B5I D;  2LOJ A;  1O9A A;  2MCZ A;  2XQW C;  3NFP I;  4AYD A;  2UWN A;  3ZRZ A;  3OP8 A;  3SW0 X;  1OK1 A;  1H04 P;  2RKZ A;  1H2Q P;  4JHS A;  3IX0 A;  1OK2 A;  4FXG G;  2EC3 A;  1Z92 B;  4LOS A;  1VVC A;  3GXE A;  1GKN A;  1TPM A;  1QUB A;  2W80 A;  2XWJ I;  1HCC A;  1ZJK A;  4K12 A;  2W81 A;  2EHF A;  1OK9 A;  1UOT P;  3EJH A;  3IU3 I;  1MD7 A;  4IGD A;  4MUC A;  2KMS A;  3MQL A;  4F4O C;  3R62 A;  1E5G A;  3ERB A;  4PZ5 A;  5HZP B;  1NWV A;  4WJG 2;  1SS2 A;  3GOV A;  2IZ4 A;  4ONT D;  2YRA A;  4B2R A;  3KZJ A;  4DJZ A;  2JGX A;  4C16 A;  1E8B A;  2ERJ A;  3L89 M;  2JGW A;  2XRD A;  2V8E A;  2QY0 A;  3TVJ A;  2MCY A;  2RLP A;  1OJW A;  1H2P P;  3INB C;  5JPM G;  1HFH A;  1TPG A;  4AYE A;  5HYT B;  1LY2 A;  1Q3X A;  5HYU B;  2CKU A; 
#chains in the Genus database with same CATH topology
 2BZM A;  2RL0 A;  1GHQ B;  3WSX A;  4J38 B;  1GKG A;  2CG7 A;  1SRZ A;  3OED C;  3ZLD A;  4YIZ A;  5DN5 A;  1U5M A;  1VVD A;  4PO7 A;  2O39 C;  2WII C;  1QGB A;  2A55 A;  3M7P A;  3RJ3 D;  1OK3 A;  1G4F A;  2XRB A;  3T5O A;  3OXU D;  4YNX A;  3O8E B;  4CSY A;  2I2L A;  1H03 P;  1E88 A;  5HYP A;  1FBR A;  2YBY A;  2JRA A;  4AYM A;  4A5W B;  1RLH A;  3KXV A;  1MD8 A;  1ELV A;  4KKD A;  4LOT A;  1OJV A;  5FO8 C;  1TPN A;  2IZ3 A;  1G4G A;  2RKY A;  2KRI A;  2CG6 A;  2Y8T A;  5I0Q B;  1OJY A;  1CKL A;  3CAL A;  4B2S A;  1PPQ A;  1C1Z A;  2XWB F;  1HFI A;  1GPZ A;  4ZH1 D;  3ZD1 A;  2RLQ A;  2G7I A;  3ZD2 A;  2Y8S A;  4AYI A;  1QO6 A;  2B5I D;  2LOJ A;  1O9A A;  2MCZ A;  2XQW C;  3NFP I;  4AYD A;  2UWN A;  3ZRZ A;  3OP8 A;  3SW0 X;  1OK1 A;  1H04 P;  2RKZ A;  1H2Q P;  4JHS A;  3IX0 A;  1OK2 A;  4FXG G;  2EC3 A;  1Z92 B;  2X2Z A;  1VVC A;  4LOS A;  3GXE A;  1GKN A;  1TPM A;  4APL A;  1QUB A;  2W80 A;  2XWJ I;  1HCC A;  1ZJK A;  4K12 A;  2W81 A;  2EHF A;  1OK9 A;  1UOT P;  3EJH A;  3IU3 I;  1MD7 A;  4IGD A;  4MUC A;  3VWO A;  4BWC A;  2KMS A;  3MQL A;  4F4O C;  3R62 A;  1E5G A;  3ERB A;  4PZ5 A;  5HZP B;  1NWV A;  4WJG 2;  1SS2 A;  3CI0 J;  3F6K A;  3GOV A;  2IZ4 A;  4ONT D;  3FGR A;  2YRA A;  4B2R A;  4MSL A;  2Y8R A;  3KZJ A;  4DJZ A;  2JGX A;  4C16 A;  1E8B A;  2ERJ A;  3L89 M;  3K3T A;  3NJA A;  2JGW A;  2XRD A;  4N7E A;  3FGT A;  2V8E A;  2QY0 A;  3TVJ A;  2MCY A;  3ZLE A;  2RLP A;  1OJW A;  1H2P P;  3INB C;  5JPM G;  1HFH A;  1TPG A;  5DN4 A;  4AYE A;  2ZYC A;  5HYT B;  1LY2 A;  3WSY A;  1Q3X A;  5HYU B;  2CKU A; 
#chains in the Genus database with same CATH homology
 2BZM A;  2RL0 A;  1GHQ B;  4J38 B;  1GKG A;  2CG7 A;  1SRZ A;  3OED C;  1U5M A;  1VVD A;  2O39 C;  2WII C;  1QGB A;  2A55 A;  3M7P A;  3RJ3 D;  1OK3 A;  1G4F A;  2XRB A;  3T5O A;  3OXU D;  4YNX A;  3O8E B;  4CSY A;  1H03 P;  1E88 A;  5HYP A;  1FBR A;  2YBY A;  2JRA A;  4AYM A;  4A5W B;  3KXV A;  1MD8 A;  1ELV A;  4KKD A;  4LOT A;  1OJV A;  5FO8 C;  1TPN A;  2IZ3 A;  1G4G A;  2RKY A;  2KRI A;  2CG6 A;  5I0Q B;  1OJY A;  1CKL A;  3CAL A;  4B2S A;  1PPQ A;  1C1Z A;  2XWB F;  1HFI A;  1GPZ A;  4ZH1 D;  3ZD1 A;  2RLQ A;  2G7I A;  3ZD2 A;  4AYI A;  1QO6 A;  2B5I D;  2LOJ A;  1O9A A;  2MCZ A;  2XQW C;  3NFP I;  4AYD A;  2UWN A;  3ZRZ A;  3OP8 A;  3SW0 X;  1OK1 A;  1H04 P;  2RKZ A;  1H2Q P;  4JHS A;  3IX0 A;  1OK2 A;  4FXG G;  2EC3 A;  1Z92 B;  4LOS A;  1VVC A;  3GXE A;  1GKN A;  1TPM A;  1QUB A;  2W80 A;  2XWJ I;  1HCC A;  1ZJK A;  4K12 A;  2W81 A;  2EHF A;  1OK9 A;  1UOT P;  3EJH A;  3IU3 I;  1MD7 A;  4IGD A;  4MUC A;  2KMS A;  3MQL A;  4F4O C;  3R62 A;  1E5G A;  3ERB A;  4PZ5 A;  5HZP B;  1NWV A;  4WJG 2;  1SS2 A;  3GOV A;  2IZ4 A;  4ONT D;  2YRA A;  4B2R A;  3KZJ A;  4DJZ A;  2JGX A;  4C16 A;  1E8B A;  2ERJ A;  3L89 M;  2JGW A;  2XRD A;  2V8E A;  2QY0 A;  3TVJ A;  2MCY A;  2RLP A;  1OJW A;  1H2P P;  3INB C;  5JPM G;  1HFH A;  1TPG A;  4AYE A;  5HYT B;  1LY2 A;  1Q3X A;  5HYU B;  2CKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...