2IZ3A

Solution structure of human beta-microseminoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
b'SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
molecule tags Inhibitor
source organism Homo sapiens
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz3A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz3A02
3MQLA 4CSYA 4LOSA 2W80A 3RJ3D 3CALA 2A55A 1GKNA 3ERBA 2XQWC 1UOTP 2B5ID 5FO8C 1MD7A 1QGBA 2RLQA 1G4GA 2RKZA 4ZH1D 2YRAA 1Z92B 3OEDC 4WJG2 1OJVA 1TPGA 4AYDA 5HYTB 3ZD2A 4PZ5A 3EJHA 2KMSA 1OJYA 2CG7A 2IZ3A 1G4FA 1MD8A 3KXVA 3TVJA 4FXGG 2RKYA 2XRBA 1GHQB 4K12A 3GOVA 1HCCA 1C1ZA 4KKDA 1ZJKA 1ELVA 1Q3XA 2CG6A 4B2RA 4F4OC 5JPMG 2KRIA 1E88A 1QO6A 3KZJA 1O9AA 1H03P 3IU3I 4ONTD 2RL0A 1E5GA 1LY2A 1VVCA 4IGDA 1FBRA 1QUBA 2MCZA 3OXUD 1E8BA 4AYIA 4B2SA 3O8EB 2JGXA 5HZPB 4C16A 1HFHA 4AYEA 4YNXA 2W81A 4AYMA 2XWBF 5I0QB 2EC3A 2QY0A 3ZD1A 4JHSA 2MCYA 2IZ4A 2O39C 1H2QP 2JGWA 1SRZA 3GXEA 1OK1A 2RLPA 2BZMA 3ZRZA 3R62A 1GKGA 2ERJA 1NWVA 1OK9A 1GPZA 1TPMA 1VVDA 3SW0X 1CKLA 2XWJI 4DJZA 4J38B 2LOJA 3NFPI 2CKUA 5HYPA 2UWNA 3OP8A 1H2PP 1OK3A 3INBC 3T5OA 4MUCA 2V8EA 1OK2A 2G7IA 2XRDA 5HYUB 1TPNA 4A5WB 1U5MA 2YBYA 1OJWA 2EHFA 2WIIC 3M7PA 1HFIA 1SS2A 3L89M 3IX0A 2JRAA 4LOTA 1PPQA 1H04P
chains in the Genus database with same CATH superfamily
1YHQ1 1TWGI 4LOSA 3WSYA 3CQZI 4A3KI 4A3EI 2KPIA 2AKLA 3NDJA 2DE5A 3D2LA 3ERBA 2XQWC 3CCEZ 3CCE1 1S7MA 3JAMf 1G4GA 1DL6A 1RO0A 2LIYA 2NAPA 2NVQI 3CCVZ 4WJG2 3GTMS 1KQSZ 4RS4A 1S72Z 2RHBA 1YJ91 3CCUZ 5C4JI 1Z02A 4MXUA 3TVJA 2R6MA 3PO3S 3HOUI 2VPWA 2RBLA 3CD6Z 3NH8A 3Q87A 2RIQA 1VQO1 4DQYB 3WSXA 1ZB8A 4NBDA 3VTNA 3CXCY 4AYBA 1FDOA 2QKDA 2NVYI 1Z01A 2ZYCA 4A3BI 3HOXI 3H3VJ 1E88A 4BWCA 5IP9I 4E33A 3KZJA 1O9AA 3ZLDA 1VQP1 2QRCB 2V8IA 3CCJZ 3IFUA 2K3RA 4AYIA 2JIMA 5D1PA 1VQ6Z 3D6WA 3S1RI 2JA6I 2QA4Z 1RO2A 3CCMZ 4BXXI 4YNXA 5DN4A 1M1K2 2V3VA 3S2DI 3ZD1A 3J80b 2R92I 1X3WA 1AA6A 2BZMA 1N8R1 1I3QI 2W04A 3R62A 2QEXZ 2ERJA 3F6KA 1GPZA 5DN5A 4A3JI 1QVFY 2PM9A 2Y0SA 5D1OB 1VQ81 4DJZA 1W2BY 1K732 3NFPI 1VQK1 1OK3A 1Q812 1RQFA 3S16I 2OZKA 1M901 2JIPA 1Q7Y1 4NBAA 3I4NI 1VQOZ 1TPNA 1SFOI 4NBEA 1S721 4APLA 3EEDA 5FLXb 4E2XA 1SS2A 2VPXA 2W03A 3MONA 1KC81 1NJI1 1NJI2 3CCU1 3G711 2OOXB 4CSYA 4QTTA 1R9TI 1YIJ1 3TE5B 1M1K1 2A55A 1QXFA 4A3MI 4A3FI 1YUAA 2JR6A 2B5ID 2H85A 2LFUA 1QGBA 1WJ2A 3CCS1 5IT9f 3M3YI 2RPRA 2E2HI 2YRAA 3F3FC 5T6BA 5CM2M 2R7ZI 1VQ41 1VQ9Z 3CCSZ 1TWCI 3HKZA 2WB1A 1OJVA 5HYTB 3CPWY 3ZD2A 3CCL1 4E2ZA 3KXVA 4MSLA 4NB9A 4A93I 1YIJZ 1WW9A 1VQNZ 1GHQB 4K12A 3BG0B 3GOVA 1Y1VS 2AYDA 2OTLZ 4E2WA 2Q51A 2P28A 1ZJKA 2GU2A 1ELVA 3PO3I 1Q3XA 1Q16A 1Q861 1Y1VI 4B2RA 4NB8A 1N8R2 2JS4A 1Y1WI 4RVHA 3GTGI 3CCQ1 2JIRA 1JJ2Y 1USPB 1LY2A 1FBRA 3OXUD 3GTJI 2JIQA 5A2Qb 2ZAEB 4C16A 3S14I 1HFHA 2QRDB 2W81A 5I0QB 2V45A 1Q811 1Q7Y2 2QY0A 1M902 4BY1I 3S17I 1QVGZ 2E9HA 3G6EZ 2IZ4A 1WIIA 1ZH1A 1VQLZ 2K5RA 3I4MI 1YIT1 2E7ZA 4MH4A 1YI21 3J81f 2RLPA 3HOYI 4YIZA 1YJW1 1VQ5Z 3VMIA 1OK9A 4MONA 2QR1B 2P3YA 2YU9I 1P9NA 1NUIA 2V8JA 2CKUA 3FKII 1USPA 2JA7I 2HU9A 1VQ7Z 1I50I 2V8EA 1OK2A 4E30A 2O4HA 1FDIA 3OW2Y 1KD11 1KD12 4BBSI 1RLYA 4A5WB 4N7EA 2YBYA 5IP7I 3IR7A 2WIIC 3M7PA 2WAQA 4RVGA 1HFIA 1K8A1 2R93I 1YHQZ 3CC7Z 4RVFA 4XX2A 1Q821 5FLMI 1TWAI 3G4S1 2Y8SA 2O53A 3I561 3CC41 4E2YA 2OTJ1 1JWHC 4NFRA 2JNYA 2PMZA 4NH1C 3RJ3D 3CALA 1YUKA 5AN9F 3RZOI 1UOTP 1VLAA 2M6NA 4DGLA 3VMHA 3CMAZ 4E32A 5FO8C 2I2LA 4A3II 1K9M2 1Z92B 3OEDC 1K9M1 1RNIA 1VQM1 3NFZA 3G4SZ 3FQQA 3S1NI 3MZLB 1TPGA 4AYDA 4PZ5A 3EJHA 3I55Z 3CCRZ 4RVDA 1OJYA 2JMOA 2IZ3A 3CI0J 2QEX1 2QLVB 1MD8A 4HGYA 3FGTA 1NP6A 2EGTA 2VPZA 2XRBA 2F4OA 3NJAA 5T67A 2J6AA 1HCCA 3K7AI 1C1ZA 5T64A 3J7A4 2NVTI 1ML8A 2VUMI 2JA5I 1KQSY 4BY7I 1VQ51 2CG6A 4Y52I 3HOZI 2KRIA 2JIOA 1QO6A 2VF1A 3GTLI 3S1MI 1H03P 3IU3I 1VQL1 3VB9A 1Q822 3M4OI 1VQ61 2RL0A 2VPYA 1VVCA 2YADA 2MCZA 3HOWI 4QTUA 1VQ91 1VQ71 1VQ4Z 3CXCZ 4AYEA 3K3TA 4PO7A 3P5JB 3CC2Z 2GTIA 4JHSA 1L1OC 1WCMI 2MCYA 2BJOA 2Y8RA 1KRLA 3CMA1 4HGZA 2O39C 2RT9A 1H2QP 3CCQZ 1SRZA 4NBFA 3ESWA 1K8A2 3GXEA 1OK1A 5FLXf 1GKGA 1TWHI 1NWVA 3GTOI 3NH5A 1TPMA 1VVDA 1QYPA 1CKLA 4EWCA 4J38B 2E2II 3FQMA 2VUGA 3I07A 3KIHA 3T5OA 3J80f 3PO2I 1QF8A 3GTPI 1U5MA 1VQPZ 3T4NB 1N2FA 1VQMZ 1JJ2Z 2OTJZ 2PK7A 1Q862 1QVFZ 2E2JI 3L89M 3CCR1 2M48A 4LOTA 2IV2X 1W2BZ 3QWUA 3MQLA 1Z03A 1TWFI 3G71Z 3MZKB 3VMGA 2W80A 1VQN1 3S1QI 1SIWA 3TDHB 1GKNA 2B63I 3I551 3S15I 1MD7A 3JAMb 2RLQA 1LQLA 2RKZA 3CC71 1TFIA 4ZH1D 2DE7A 1WZNA 3GTQI 4TNUA 4MD9A 3CC4Z 3VWOA 2QA41 1X3ZA 4NBHA 3RZDI 4BBRI 3KIFA 4A3DI 2KMSA 3HOVI 2CG7A 3GTMI 1G4FA 5D1OA 2V8KA 2GTHA 4FXGG 3LUSA 3ZLEA 2G2KA 2RKYA 3I56Z 3FGRA 1VQKZ 5C44I 4MD8A 4X6AI 3U50C 4KKDA 2DE6A 4A3GI 5IT9b 1PFTA 2JA8I 1Y8CA 4F4OC 3CCM1 5JPMG 3J81b 1YI2Z 1VQ8Z 5LL6f 4ONTD 3CCLZ 2KI7B 3GTKI 1E5GA 4B2SA 4IGDA 1QUBA 4MRIA 1E8BA 3GCFA 3O8EB 2JGXA 4CL1A 2QREB 5HZPB 3CCV1 1K731 3EERA 2Y8TA 3CMEZ 3D9XA 4AYMA 2XWBF 4A3LI 1I6HI 4NOZA 2EC3A 5C4XI 3G6E1 4RV9A 3CCJ1 1K83I 1YJWZ 3BG1B 2JGWA 3OW2Z 3CD61 3S2HI 2X2ZA 1YITZ 1RLHA 1KC82 3ZRZA 3IF8A 4DK1A 1RO4A 3CC21 2HF1A 3SW0X 5A2Qf 2JUBA 2XWJI 2NVXI 3F3PC 4Y7NI 3CME1 2LOJA 2OOYB 3CPWZ 5HYPA 1QVGY 2UWNA 3OP8A 4A3CI 4NBCA 1H2PP 3NH4A 3INBC 1YJNZ 4MUCA 4HH4A 3H0GI 2LEXA 5C3EI 2G7IA 2XRDA 4MD7A 1YJ9Z 5HYUB 1X0TA 2F4MA 4NBBA 1OJWA 4E31A 4NBGA 2EHFA 1ZB9A 1YJN1 3IX0A 4S1TA 3NDIA 2Q4ZA 2JRAA 1PPQA 3GKQA 1H04P 2OTL1 2I3CA
chains in the Genus database with same CATH topology
1YHQ1 1TWGI 4LOSA 3CQZI 4A3KI 4A3EI 2KPIA 2AKLA 3NDJA 2DE5A 3ERBA 2XQWC 3CCEZ 3CCE1 1S7MA 3JAMf 1G4GA 1DL6A 1RO0A 2LIYA 2NVQI 3CCVZ 4WJG2 3GTMS 1KQSZ 4RS4A 1S72Z 2RHBA 1YJ91 3CCUZ 5C4JI 1Z02A 4MXUA 3TVJA 2R6MA 3PO3S 3HOUI 2RBLA 3CD6Z 3NH8A 1H04P 2RIQA 1VQO1 4DQYB 1ZB8A 4NBDA 3VTNA 3CXCY 4AYBA 2QKDA 2NVYI 1Z01A 4A3BI 3HOXI 3H3VJ 1E88A 5IP9I 4E33A 3KZJA 1O9AA 1VQP1 2QRCB 2V8IA 3CCJZ 3IFUA 2K3RA 4AYIA 5D1PA 1VQ6Z 3D6WA 3S1RI 2JA6I 2QA4Z 1RO2A 3CCMZ 4BXXI 4YNXA 1M1K2 3S2DI 3ZD1A 3J80b 2R92I 1X3WA 2BZMA 1N8R1 1I3QI 2W04A 3R62A 2QEXZ 2ERJA 1GPZA 4A3JI 1QVFY 2PM9A 2Y0SA 5D1OB 1VQ81 4DJZA 1W2BY 1K732 3NFPI 1VQK1 1OK3A 1Q812 1RQFA 3S16I 2OZKA 1M901 1Q7Y1 4NBAA 3I4NI 1VQOZ 1TPNA 1SFOI 4NBEA 1S721 3EEDA 5FLXb 4E2XA 1SS2A 2W03A 1KC81 3MONA 1NJI1 1NJI2 3CCU1 3G711 2OOXB 4CSYA 4QTTA 1R9TI 1YIJ1 3TE5B 1M1K1 2A55A 4A3MI 4A3FI 1YUAA 2JR6A 2B5ID 2H85A 2LFUA 1QGBA 3CCS1 5IT9f 3M3YI 2RPRA 2E2HI 2YRAA 3F3FC 5T6BA 5CM2M 2R7ZI 1VQ41 1VQ9Z 3CCSZ 1TWCI 3HKZA 2WB1A 1OJVA 5HYTB 3CPWY 3ZD2A 3CCL1 4E2ZA 3KXVA 4NB9A 4A93I 1YIJZ 1WW9A 1VQNZ 1GHQB 4K12A 3BG0B 3GOVA 1Y1VS 2OTLZ 4E2WA 2Q51A 2P28A 1ZJKA 2GU2A 1ELVA 3PO3I 1Q3XA 1Q861 1Y1VI 4B2RA 4NB8A 1N8R2 2JS4A 1Y1WI 4RVHA 3GTGI 3CCQ1 1JJ2Y 1USPB 1LY2A 1FBRA 3OXUD 3GTJI 5A2Qb 2ZAEB 4C16A 3S14I 1HFHA 2QRDB 2W81A 5I0QB 1Q811 1Q7Y2 2QY0A 1M902 4BY1I 3S17I 1QVGZ 2E9HA 3G6EZ 2IZ4A 1WIIA 1ZH1A 1VQLZ 2K5RA 3I4MI 1YIT1 4MH4A 1YI21 3J81f 2RLPA 3HOYI 1YJW1 1VQ5Z 3VMIA 1OK9A 4MONA 2QR1B 2P3YA 2YU9I 1P9NA 1NUIA 2V8JA 2CKUA 3FKII 1USPA 2JA7I 2HU9A 1VQ7Z 1I50I 2V8EA 1OK2A 4E30A 2O4HA 3OW2Y 1KD11 1KD12 4BBSI 1RLYA 4A5WB 2YBYA 5IP7I 2WIIC 3M7PA 2WAQA 4RVGA 1HFIA 1K8A1 2R93I 1YHQZ 3CC7Z 4RVFA 4XX2A 1Q821 5FLMI 1TWAI 3G4S1 2O53A 3I561 3CC41 4E2YA 2OTJ1 1JWHC 4NFRA 2JNYA 2PMZA 4NH1C 3RJ3D 3CALA 1YUKA 5AN9F 3RZOI 1UOTP 1VLAA 2M6NA 4DGLA 3VMHA 3CMAZ 4E32A 5FO8C 4A3II 1K9M2 1Z92B 3OEDC 1K9M1 1RNIA 1VQM1 3NFZA 3G4SZ 3FQQA 3S1NI 3MZLB 1TPGA 4AYDA 4PZ5A 3EJHA 3I55Z 3CCRZ 4RVDA 1OJYA 2JMOA 2IZ3A 2QEX1 2QLVB 1MD8A 4HGYA 1NP6A 2EGTA 2XRBA 2F4OA 5T67A 2J6AA 1HCCA 3K7AI 1C1ZA 5T64A 3J7A4 2NVTI 1ML8A 2VUMI 2JA5I 1KQSY 4BY7I 1VQ51 2CG6A 4Y52I 3HOZI 2KRIA 2VF1A 1QO6A 3GTLI 3S1MI 1H03P 3IU3I 1VQL1 3VB9A 1Q822 3M4OI 1VQ61 2RL0A 1VVCA 2YADA 2MCZA 3HOWI 4QTUA 1VQ91 1VQ71 1VQ4Z 3CXCZ 4AYEA 3P5JB 3CC2Z 2GTIA 4JHSA 1L1OC 1WCMI 2MCYA 2BJOA 1KRLA 3CMA1 4HGZA 2O39C 2RT9A 1H2QP 3CCQZ 1SRZA 4NBFA 3ESWA 1K8A2 3GXEA 1OK1A 5FLXf 1GKGA 1TWHI 1NWVA 3GTOI 3NH5A 1TPMA 1VVDA 1QYPA 1CKLA 4EWCA 4J38B 2E2II 3FQMA 2VUGA 3I07A 3KIHA 3T5OA 3J80f 3PO2I 1QF8A 3GTPI 1U5MA 1VQPZ 3T4NB 1N2FA 1VQMZ 1JJ2Z 2OTJZ 2PK7A 1Q862 1QVFZ 2E2JI 3L89M 3CCR1 2M48A 4LOTA 1W2BZ 3QWUA 3MQLA 1Z03A 1TWFI 3G71Z 3MZKB 3VMGA 2W80A 1VQN1 3S1QI 3TDHB 1GKNA 2B63I 3I551 3S15I 1MD7A 3JAMb 2RLQA 1LQLA 2RKZA 3CC71 1TFIA 4ZH1D 2DE7A 3GTQI 4TNUA 4MD9A 3CC4Z 2QA41 1X3ZA 4NBHA 3RZDI 4BBRI 3KIFA 4A3DI 2KMSA 3HOVI 2CG7A 3GTMI 1G4FA 5D1OA 2V8KA 2GTHA 4FXGG 3LUSA 2G2KA 2RKYA 3I56Z 1VQKZ 5C44I 4MD8A 4X6AI 3U50C 4KKDA 2DE6A 4A3GI 5IT9b 1PFTA 2JA8I 4F4OC 3CCM1 5JPMG 3J81b 1YI2Z 1VQ8Z 5LL6f 4ONTD 3CCLZ 2KI7B 3GTKI 1E5GA 4B2SA 4IGDA 1QUBA 4MRIA 1E8BA 3GCFA 3O8EB 2JGXA 4CL1A 2QREB 5HZPB 3CCV1 1K731 3EERA 3CMEZ 3D9XA 4AYMA 2XWBF 4A3LI 1I6HI 4NOZA 2EC3A 5C4XI 3G6E1 4RV9A 3CCJ1 1K83I 1YJWZ 3BG1B 2JGWA 3OW2Z 3CD61 3S2HI 1YITZ 1KC82 3ZRZA 3IF8A 4DK1A 1RO4A 3CC21 2HF1A 3SW0X 5A2Qf 2JUBA 2XWJI 2NVXI 3F3PC 4Y7NI 3CME1 2LOJA 2OOYB 3CPWZ 5HYPA 1QVGY 2UWNA 3OP8A 4A3CI 4NBCA 1H2PP 3NH4A 3INBC 1YJNZ 4MUCA 4HH4A 3H0GI 5C3EI 2G7IA 2XRDA 4MD7A 1YJ9Z 5HYUB 1X0TA 2F4MA 4NBBA 1OJWA 4E31A 4NBGA 2EHFA 1ZB9A 1YJN1 3IX0A 4S1TA 3NDIA 2Q4ZA 2JRAA 1PPQA 3GKQA 3Q87A 2OTL1 2I3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQL A;  4CSY A;  4LOS A;  2W80 A;  3RJ3 D;  3CAL A;  2A55 A;  1GKN A;  3ERB A;  2XQW C;  1UOT P;  2B5I D;  5FO8 C;  1MD7 A;  1QGB A;  2RLQ A;  1G4G A;  2RKZ A;  4ZH1 D;  2YRA A;  1Z92 B;  3OED C;  4WJG 2;  1OJV A;  1TPG A;  4AYD A;  5HYT B;  3ZD2 A;  4PZ5 A;  3EJH A;  2KMS A;  1OJY A;  2CG7 A;  2IZ3 A;  1G4F A;  1MD8 A;  3KXV A;  3TVJ A;  4FXG G;  2RKY A;  2XRB A;  1GHQ B;  4K12 A;  3GOV A;  1HCC A;  1C1Z A;  4KKD A;  1ZJK A;  1ELV A;  1Q3X A;  2CG6 A;  4B2R A;  4F4O C;  5JPM G;  2KRI A;  1E88 A;  1QO6 A;  3KZJ A;  1O9A A;  1H03 P;  3IU3 I;  4ONT D;  2RL0 A;  1E5G A;  1LY2 A;  1VVC A;  4IGD A;  1FBR A;  1QUB A;  2MCZ A;  3OXU D;  1E8B A;  4AYI A;  4B2S A;  3O8E B;  2JGX A;  5HZP B;  4C16 A;  1HFH A;  4AYE A;  4YNX A;  2W81 A;  4AYM A;  2XWB F;  5I0Q B;  2EC3 A;  2QY0 A;  3ZD1 A;  4JHS A;  2MCY A;  2IZ4 A;  2O39 C;  1H2Q P;  2JGW A;  1SRZ A;  3GXE A;  1OK1 A;  2RLP A;  2BZM A;  3ZRZ A;  3R62 A;  1GKG A;  2ERJ A;  1NWV A;  1OK9 A;  1GPZ A;  1TPM A;  1VVD A;  3SW0 X;  1CKL A;  2XWJ I;  4DJZ A;  4J38 B;  2LOJ A;  3NFP I;  2CKU A;  5HYP A;  2UWN A;  3OP8 A;  1H2P P;  1OK3 A;  3INB C;  3T5O A;  4MUC A;  2V8E A;  1OK2 A;  2G7I A;  2XRD A;  5HYU B;  1TPN A;  4A5W B;  1U5M A;  2YBY A;  1OJW A;  2EHF A;  2WII C;  3M7P A;  1HFI A;  1SS2 A;  3L89 M;  3IX0 A;  2JRA A;  4LOT A;  1PPQ A;  1H04 P; 
#chains in the Genus database with same CATH topology
 1YHQ 1;  1TWG I;  4LOS A;  3WSY A;  3CQZ I;  4A3K I;  4A3E I;  2KPI A;  2AKL A;  3NDJ A;  2DE5 A;  3D2L A;  3ERB A;  2XQW C;  3CCE Z;  3CCE 1;  1S7M A;  3JAM f;  1G4G A;  1DL6 A;  1RO0 A;  2LIY A;  2NAP A;  2NVQ I;  3CCV Z;  4WJG 2;  3GTM S;  1KQS Z;  4RS4 A;  1S72 Z;  2RHB A;  1YJ9 1;  3CCU Z;  5C4J I;  1Z02 A;  4MXU A;  3TVJ A;  2R6M A;  3PO3 S;  3HOU I;  2VPW A;  2RBL A;  3CD6 Z;  3NH8 A;  3Q87 A;  2RIQ A;  1VQO 1;  4DQY B;  3WSX A;  1ZB8 A;  4NBD A;  3VTN A;  3CXC Y;  4AYB A;  1FDO A;  2QKD A;  2NVY I;  1Z01 A;  2ZYC A;  4A3B I;  3HOX I;  3H3V J;  1E88 A;  4BWC A;  5IP9 I;  4E33 A;  3KZJ A;  1O9A A;  3ZLD A;  1VQP 1;  2QRC B;  2V8I A;  3CCJ Z;  3IFU A;  2K3R A;  4AYI A;  2JIM A;  5D1P A;  1VQ6 Z;  3D6W A;  3S1R I;  2JA6 I;  2QA4 Z;  1RO2 A;  3CCM Z;  4BXX I;  4YNX A;  5DN4 A;  1M1K 2;  2V3V A;  3S2D I;  3ZD1 A;  3J80 b;  2R92 I;  1X3W A;  1AA6 A;  2BZM A;  1N8R 1;  1I3Q I;  2W04 A;  3R62 A;  2QEX Z;  2ERJ A;  3F6K A;  1GPZ A;  5DN5 A;  4A3J I;  1QVF Y;  2PM9 A;  2Y0S A;  5D1O B;  1VQ8 1;  4DJZ A;  1W2B Y;  1K73 2;  3NFP I;  1VQK 1;  1OK3 A;  1Q81 2;  1RQF A;  3S16 I;  2OZK A;  1M90 1;  2JIP A;  1Q7Y 1;  4NBA A;  3I4N I;  1VQO Z;  1TPN A;  1SFO I;  4NBE A;  1S72 1;  4APL A;  3EED A;  5FLX b;  4E2X A;  1SS2 A;  2VPX A;  2W03 A;  3MON A;  1KC8 1;  1NJI 1;  1NJI 2;  3CCU 1;  3G71 1;  2OOX B;  4CSY A;  4QTT A;  1R9T I;  1YIJ 1;  3TE5 B;  1M1K 1;  2A55 A;  1QXF A;  4A3M I;  4A3F I;  1YUA A;  2JR6 A;  2B5I D;  2H85 A;  2LFU A;  1QGB A;  1WJ2 A;  3CCS 1;  5IT9 f;  3M3Y I;  2RPR A;  2E2H I;  2YRA A;  3F3F C;  5T6B A;  5CM2 M;  2R7Z I;  1VQ4 1;  1VQ9 Z;  3CCS Z;  1TWC I;  3HKZ A;  2WB1 A;  1OJV A;  5HYT B;  3CPW Y;  3ZD2 A;  3CCL 1;  4E2Z A;  3KXV A;  4MSL A;  4NB9 A;  4A93 I;  1YIJ Z;  1WW9 A;  1VQN Z;  1GHQ B;  4K12 A;  3BG0 B;  3GOV A;  1Y1V S;  2AYD A;  2OTL Z;  4E2W A;  2Q51 A;  2P28 A;  1ZJK A;  2GU2 A;  1ELV A;  3PO3 I;  1Q3X A;  1Q16 A;  1Q86 1;  1Y1V I;  4B2R A;  4NB8 A;  1N8R 2;  2JS4 A;  1Y1W I;  4RVH A;  3GTG I;  3CCQ 1;  2JIR A;  1JJ2 Y;  1USP B;  1LY2 A;  1FBR A;  3OXU D;  3GTJ I;  2JIQ A;  5A2Q b;  2ZAE B;  4C16 A;  3S14 I;  1HFH A;  2QRD B;  2W81 A;  5I0Q B;  2V45 A;  1Q81 1;  1Q7Y 2;  2QY0 A;  1M90 2;  4BY1 I;  3S17 I;  1QVG Z;  2E9H A;  3G6E Z;  2IZ4 A;  1WII A;  1ZH1 A;  1VQL Z;  2K5R A;  3I4M I;  1YIT 1;  2E7Z A;  4MH4 A;  1YI2 1;  3J81 f;  2RLP A;  3HOY I;  4YIZ A;  1YJW 1;  1VQ5 Z;  3VMI A;  1OK9 A;  4MON A;  2QR1 B;  2P3Y A;  2YU9 I;  1P9N A;  1NUI A;  2V8J A;  2CKU A;  3FKI I;  1USP A;  2JA7 I;  2HU9 A;  1VQ7 Z;  1I50 I;  2V8E A;  1OK2 A;  4E30 A;  2O4H A;  1FDI A;  3OW2 Y;  1KD1 1;  1KD1 2;  4BBS I;  1RLY A;  4A5W B;  4N7E A;  2YBY A;  5IP7 I;  3IR7 A;  2WII C;  3M7P A;  2WAQ A;  4RVG A;  1HFI A;  1K8A 1;  2R93 I;  1YHQ Z;  3CC7 Z;  4RVF A;  4XX2 A;  1Q82 1;  5FLM I;  1TWA I;  3G4S 1;  2Y8S A;  2O53 A;  3I56 1;  3CC4 1;  4E2Y A;  2OTJ 1;  1JWH C;  4NFR A;  2JNY A;  2PMZ A;  4NH1 C;  3RJ3 D;  3CAL A;  1YUK A;  5AN9 F;  3RZO I;  1UOT P;  1VLA A;  2M6N A;  4DGL A;  3VMH A;  3CMA Z;  4E32 A;  5FO8 C;  2I2L A;  4A3I I;  1K9M 2;  1Z92 B;  3OED C;  1K9M 1;  1RNI A;  1VQM 1;  3NFZ A;  3G4S Z;  3FQQ A;  3S1N I;  3MZL B;  1TPG A;  4AYD A;  4PZ5 A;  3EJH A;  3I55 Z;  3CCR Z;  4RVD A;  1OJY A;  2JMO A;  2IZ3 A;  3CI0 J;  2QEX 1;  2QLV B;  1MD8 A;  4HGY A;  3FGT A;  1NP6 A;  2EGT A;  2VPZ A;  2XRB A;  2F4O A;  3NJA A;  5T67 A;  2J6A A;  1HCC A;  3K7A I;  1C1Z A;  5T64 A;  3J7A 4;  2NVT I;  1ML8 A;  2VUM I;  2JA5 I;  1KQS Y;  4BY7 I;  1VQ5 1;  2CG6 A;  4Y52 I;  3HOZ I;  2KRI A;  2JIO A;  1QO6 A;  2VF1 A;  3GTL I;  3S1M I;  1H03 P;  3IU3 I;  1VQL 1;  3VB9 A;  1Q82 2;  3M4O I;  1VQ6 1;  2RL0 A;  2VPY A;  1VVC A;  2YAD A;  2MCZ A;  3HOW I;  4QTU A;  1VQ9 1;  1VQ7 1;  1VQ4 Z;  3CXC Z;  4AYE A;  3K3T A;  4PO7 A;  3P5J B;  3CC2 Z;  2GTI A;  4JHS A;  1L1O C;  1WCM I;  2MCY A;  2BJO A;  2Y8R A;  1KRL A;  3CMA 1;  4HGZ A;  2O39 C;  2RT9 A;  1H2Q P;  3CCQ Z;  1SRZ A;  4NBF A;  3ESW A;  1K8A 2;  3GXE A;  1OK1 A;  5FLX f;  1GKG A;  1TWH I;  1NWV A;  3GTO I;  3NH5 A;  1TPM A;  1VVD A;  1QYP A;  1CKL A;  4EWC A;  4J38 B;  2E2I I;  3FQM A;  2VUG A;  3I07 A;  3KIH A;  3T5O A;  3J80 f;  3PO2 I;  1QF8 A;  3GTP I;  1U5M A;  1VQP Z;  3T4N B;  1N2F A;  1VQM Z;  1JJ2 Z;  2OTJ Z;  2PK7 A;  1Q86 2;  1QVF Z;  2E2J I;  3L89 M;  3CCR 1;  2M48 A;  4LOT A;  2IV2 X;  1W2B Z;  3QWU A;  3MQL A;  1Z03 A;  1TWF I;  3G71 Z;  3MZK B;  3VMG A;  2W80 A;  1VQN 1;  3S1Q I;  1SIW A;  3TDH B;  1GKN A;  2B63 I;  3I55 1;  3S15 I;  1MD7 A;  3JAM b;  2RLQ A;  1LQL A;  2RKZ A;  3CC7 1;  1TFI A;  4ZH1 D;  2DE7 A;  1WZN A;  3GTQ I;  4TNU A;  4MD9 A;  3CC4 Z;  3VWO A;  2QA4 1;  1X3Z A;  4NBH A;  3RZD I;  4BBR I;  3KIF A;  4A3D I;  2KMS A;  3HOV I;  2CG7 A;  3GTM I;  1G4F A;  5D1O A;  2V8K A;  2GTH A;  4FXG G;  3LUS A;  3ZLE A;  2G2K A;  2RKY A;  3I56 Z;  3FGR A;  1VQK Z;  5C44 I;  4MD8 A;  4X6A I;  3U50 C;  4KKD A;  2DE6 A;  4A3G I;  5IT9 b;  1PFT A;  2JA8 I;  1Y8C A;  4F4O C;  3CCM 1;  5JPM G;  3J81 b;  1YI2 Z;  1VQ8 Z;  5LL6 f;  4ONT D;  3CCL Z;  2KI7 B;  3GTK I;  1E5G A;  4B2S A;  4IGD A;  1QUB A;  4MRI A;  1E8B A;  3GCF A;  3O8E B;  2JGX A;  4CL1 A;  2QRE B;  5HZP B;  3CCV 1;  1K73 1;  3EER A;  2Y8T A;  3CME Z;  3D9X A;  4AYM A;  2XWB F;  4A3L I;  1I6H I;  4NOZ A;  2EC3 A;  5C4X I;  3G6E 1;  4RV9 A;  3CCJ 1;  1K83 I;  1YJW Z;  3BG1 B;  2JGW A;  3OW2 Z;  3CD6 1;  3S2H I;  2X2Z A;  1YIT Z;  1RLH A;  1KC8 2;  3ZRZ A;  3IF8 A;  4DK1 A;  1RO4 A;  3CC2 1;  2HF1 A;  3SW0 X;  5A2Q f;  2JUB A;  2XWJ I;  2NVX I;  3F3P C;  4Y7N I;  3CME 1;  2LOJ A;  2OOY B;  3CPW Z;  5HYP A;  1QVG Y;  2UWN A;  3OP8 A;  4A3C I;  4NBC A;  1H2P P;  3NH4 A;  3INB C;  1YJN Z;  4MUC A;  4HH4 A;  3H0G I;  2LEX A;  5C3E I;  2G7I A;  2XRD A;  4MD7 A;  1YJ9 Z;  5HYU B;  1X0T A;  2F4M A;  4NBB A;  1OJW A;  4E31 A;  4NBG A;  2EHF A;  1ZB9 A;  1YJN 1;  3IX0 A;  4S1T A;  3NDI A;  2Q4Z A;  2JRA A;  1PPQ A;  3GKQ A;  1H04 P;  2OTL 1;  2I3C A; 
#chains in the Genus database with same CATH homology
 1YHQ 1;  1TWG I;  4LOS A;  3CQZ I;  4A3K I;  4A3E I;  2KPI A;  2AKL A;  3NDJ A;  2DE5 A;  3ERB A;  2XQW C;  3CCE Z;  3CCE 1;  1S7M A;  3JAM f;  1G4G A;  1DL6 A;  1RO0 A;  2LIY A;  2NVQ I;  3CCV Z;  4WJG 2;  3GTM S;  1KQS Z;  4RS4 A;  1S72 Z;  2RHB A;  1YJ9 1;  3CCU Z;  5C4J I;  1Z02 A;  4MXU A;  3TVJ A;  2R6M A;  3PO3 S;  3HOU I;  2RBL A;  3CD6 Z;  3NH8 A;  1H04 P;  2RIQ A;  1VQO 1;  4DQY B;  1ZB8 A;  4NBD A;  3VTN A;  3CXC Y;  4AYB A;  2QKD A;  2NVY I;  1Z01 A;  4A3B I;  3HOX I;  3H3V J;  1E88 A;  5IP9 I;  4E33 A;  3KZJ A;  1O9A A;  1VQP 1;  2QRC B;  2V8I A;  3CCJ Z;  3IFU A;  2K3R A;  4AYI A;  5D1P A;  1VQ6 Z;  3D6W A;  3S1R I;  2JA6 I;  2QA4 Z;  1RO2 A;  3CCM Z;  4BXX I;  4YNX A;  1M1K 2;  3S2D I;  3ZD1 A;  3J80 b;  2R92 I;  1X3W A;  2BZM A;  1N8R 1;  1I3Q I;  2W04 A;  3R62 A;  2QEX Z;  2ERJ A;  1GPZ A;  4A3J I;  1QVF Y;  2PM9 A;  2Y0S A;  5D1O B;  1VQ8 1;  4DJZ A;  1W2B Y;  1K73 2;  3NFP I;  1VQK 1;  1OK3 A;  1Q81 2;  1RQF A;  3S16 I;  2OZK A;  1M90 1;  1Q7Y 1;  4NBA A;  3I4N I;  1VQO Z;  1TPN A;  1SFO I;  4NBE A;  1S72 1;  3EED A;  5FLX b;  4E2X A;  1SS2 A;  2W03 A;  1KC8 1;  3MON A;  1NJI 1;  1NJI 2;  3CCU 1;  3G71 1;  2OOX B;  4CSY A;  4QTT A;  1R9T I;  1YIJ 1;  3TE5 B;  1M1K 1;  2A55 A;  4A3M I;  4A3F I;  1YUA A;  2JR6 A;  2B5I D;  2H85 A;  2LFU A;  1QGB A;  3CCS 1;  5IT9 f;  3M3Y I;  2RPR A;  2E2H I;  2YRA A;  3F3F C;  5T6B A;  5CM2 M;  2R7Z I;  1VQ4 1;  1VQ9 Z;  3CCS Z;  1TWC I;  3HKZ A;  2WB1 A;  1OJV A;  5HYT B;  3CPW Y;  3ZD2 A;  3CCL 1;  4E2Z A;  3KXV A;  4NB9 A;  4A93 I;  1YIJ Z;  1WW9 A;  1VQN Z;  1GHQ B;  4K12 A;  3BG0 B;  3GOV A;  1Y1V S;  2OTL Z;  4E2W A;  2Q51 A;  2P28 A;  1ZJK A;  2GU2 A;  1ELV A;  3PO3 I;  1Q3X A;  1Q86 1;  1Y1V I;  4B2R A;  4NB8 A;  1N8R 2;  2JS4 A;  1Y1W I;  4RVH A;  3GTG I;  3CCQ 1;  1JJ2 Y;  1USP B;  1LY2 A;  1FBR A;  3OXU D;  3GTJ I;  5A2Q b;  2ZAE B;  4C16 A;  3S14 I;  1HFH A;  2QRD B;  2W81 A;  5I0Q B;  1Q81 1;  1Q7Y 2;  2QY0 A;  1M90 2;  4BY1 I;  3S17 I;  1QVG Z;  2E9H A;  3G6E Z;  2IZ4 A;  1WII A;  1ZH1 A;  1VQL Z;  2K5R A;  3I4M I;  1YIT 1;  4MH4 A;  1YI2 1;  3J81 f;  2RLP A;  3HOY I;  1YJW 1;  1VQ5 Z;  3VMI A;  1OK9 A;  4MON A;  2QR1 B;  2P3Y A;  2YU9 I;  1P9N A;  1NUI A;  2V8J A;  2CKU A;  3FKI I;  1USP A;  2JA7 I;  2HU9 A;  1VQ7 Z;  1I50 I;  2V8E A;  1OK2 A;  4E30 A;  2O4H A;  3OW2 Y;  1KD1 1;  1KD1 2;  4BBS I;  1RLY A;  4A5W B;  2YBY A;  5IP7 I;  2WII C;  3M7P A;  2WAQ A;  4RVG A;  1HFI A;  1K8A 1;  2R93 I;  1YHQ Z;  3CC7 Z;  4RVF A;  4XX2 A;  1Q82 1;  5FLM I;  1TWA I;  3G4S 1;  2O53 A;  3I56 1;  3CC4 1;  4E2Y A;  2OTJ 1;  1JWH C;  4NFR A;  2JNY A;  2PMZ A;  4NH1 C;  3RJ3 D;  3CAL A;  1YUK A;  5AN9 F;  3RZO I;  1UOT P;  1VLA A;  2M6N A;  4DGL A;  3VMH A;  3CMA Z;  4E32 A;  5FO8 C;  4A3I I;  1K9M 2;  1Z92 B;  3OED C;  1K9M 1;  1RNI A;  1VQM 1;  3NFZ A;  3G4S Z;  3FQQ A;  3S1N I;  3MZL B;  1TPG A;  4AYD A;  4PZ5 A;  3EJH A;  3I55 Z;  3CCR Z;  4RVD A;  1OJY A;  2JMO A;  2IZ3 A;  2QEX 1;  2QLV B;  1MD8 A;  4HGY A;  1NP6 A;  2EGT A;  2XRB A;  2F4O A;  5T67 A;  2J6A A;  1HCC A;  3K7A I;  1C1Z A;  5T64 A;  3J7A 4;  2NVT I;  1ML8 A;  2VUM I;  2JA5 I;  1KQS Y;  4BY7 I;  1VQ5 1;  2CG6 A;  4Y52 I;  3HOZ I;  2KRI A;  2VF1 A;  1QO6 A;  3GTL I;  3S1M I;  1H03 P;  3IU3 I;  1VQL 1;  3VB9 A;  1Q82 2;  3M4O I;  1VQ6 1;  2RL0 A;  1VVC A;  2YAD A;  2MCZ A;  3HOW I;  4QTU A;  1VQ9 1;  1VQ7 1;  1VQ4 Z;  3CXC Z;  4AYE A;  3P5J B;  3CC2 Z;  2GTI A;  4JHS A;  1L1O C;  1WCM I;  2MCY A;  2BJO A;  1KRL A;  3CMA 1;  4HGZ A;  2O39 C;  2RT9 A;  1H2Q P;  3CCQ Z;  1SRZ A;  4NBF A;  3ESW A;  1K8A 2;  3GXE A;  1OK1 A;  5FLX f;  1GKG A;  1TWH I;  1NWV A;  3GTO I;  3NH5 A;  1TPM A;  1VVD A;  1QYP A;  1CKL A;  4EWC A;  4J38 B;  2E2I I;  3FQM A;  2VUG A;  3I07 A;  3KIH A;  3T5O A;  3J80 f;  3PO2 I;  1QF8 A;  3GTP I;  1U5M A;  1VQP Z;  3T4N B;  1N2F A;  1VQM Z;  1JJ2 Z;  2OTJ Z;  2PK7 A;  1Q86 2;  1QVF Z;  2E2J I;  3L89 M;  3CCR 1;  2M48 A;  4LOT A;  1W2B Z;  3QWU A;  3MQL A;  1Z03 A;  1TWF I;  3G71 Z;  3MZK B;  3VMG A;  2W80 A;  1VQN 1;  3S1Q I;  3TDH B;  1GKN A;  2B63 I;  3I55 1;  3S15 I;  1MD7 A;  3JAM b;  2RLQ A;  1LQL A;  2RKZ A;  3CC7 1;  1TFI A;  4ZH1 D;  2DE7 A;  3GTQ I;  4TNU A;  4MD9 A;  3CC4 Z;  2QA4 1;  1X3Z A;  4NBH A;  3RZD I;  4BBR I;  3KIF A;  4A3D I;  2KMS A;  3HOV I;  2CG7 A;  3GTM I;  1G4F A;  5D1O A;  2V8K A;  2GTH A;  4FXG G;  3LUS A;  2G2K A;  2RKY A;  3I56 Z;  1VQK Z;  5C44 I;  4MD8 A;  4X6A I;  3U50 C;  4KKD A;  2DE6 A;  4A3G I;  5IT9 b;  1PFT A;  2JA8 I;  4F4O C;  3CCM 1;  5JPM G;  3J81 b;  1YI2 Z;  1VQ8 Z;  5LL6 f;  4ONT D;  3CCL Z;  2KI7 B;  3GTK I;  1E5G A;  4B2S A;  4IGD A;  1QUB A;  4MRI A;  1E8B A;  3GCF A;  3O8E B;  2JGX A;  4CL1 A;  2QRE B;  5HZP B;  3CCV 1;  1K73 1;  3EER A;  3CME Z;  3D9X A;  4AYM A;  2XWB F;  4A3L I;  1I6H I;  4NOZ A;  2EC3 A;  5C4X I;  3G6E 1;  4RV9 A;  3CCJ 1;  1K83 I;  1YJW Z;  3BG1 B;  2JGW A;  3OW2 Z;  3CD6 1;  3S2H I;  1YIT Z;  1KC8 2;  3ZRZ A;  3IF8 A;  4DK1 A;  1RO4 A;  3CC2 1;  2HF1 A;  3SW0 X;  5A2Q f;  2JUB A;  2XWJ I;  2NVX I;  3F3P C;  4Y7N I;  3CME 1;  2LOJ A;  2OOY B;  3CPW Z;  5HYP A;  1QVG Y;  2UWN A;  3OP8 A;  4A3C I;  4NBC A;  1H2P P;  3NH4 A;  3INB C;  1YJN Z;  4MUC A;  4HH4 A;  3H0G I;  5C3E I;  2G7I A;  2XRD A;  4MD7 A;  1YJ9 Z;  5HYU B;  1X0T A;  2F4M A;  4NBB A;  1OJW A;  4E31 A;  4NBG A;  2EHF A;  1ZB9 A;  1YJN 1;  3IX0 A;  4S1T A;  3NDI A;  2Q4Z A;  2JRA A;  1PPQ A;  3GKQ A;  3Q87 A;  2OTL 1;  2I3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...