2IZ3A

Solution structure of human beta-microseminoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Inhibitor
molecule keywords BETA-MICROSEMINOPROTEIN
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz3A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz3A02
1QO6A 3M7PA 4C16A 1TPGA 5FO8C 2IZ3A 3GXEA 5I0QB 1C1ZA 4J38B 1VVCA 1OK2A 1G4GA 1H04P 3R62A 3NFPI 4JHSA 3OEDC 1OJYA 4AYEA 4DJZA 1H2QP 1GKNA 1OJWA 2RLQA 1SRZA 5JPMG 5HYPA 2CG7A 2EC3A 4IGDA 1U5MA 2RLPA 1FBRA 1H03P 4K12A 4AYIA 1HFHA 3EJHA 2JRAA 4WJG2 2W80A 4A5WB 3ZRZA 1HFIA 4FXGG 1VVDA 1OK3A 2RL0A 4B2RA 1HCCA 2O39C 2KMSA 1GPZA 2EHFA 1ZJKA 1QGBA 3IU3I 1TPNA 3INBC 3SW0X 1OJVA 3OP8A 1GHQB 5HZPB 2QY0A 2LOJA 2RKYA 1QUBA 2CKUA 3O8EB 3TVJA 1MD7A 5HYUB 3ERBA 2MCZA 2ERJA 2XQWC 4B2SA 1OK9A 3KZJA 4KKDA 1CKLA 2RKZA 3L89M 4AYMA 1NWVA 2JGWA 3T5OA 1GKGA 3MQLA 1UOTP 1LY2A 1E8BA 4ONTD 4LOSA 1Z92B 4YNXA 4F4OC 2CG6A 2W81A 2IZ4A 3KXVA 3OXUD 4ZH1D 1E5GA 1E88A 2XWJI 3ZD2A 2YRAA 2KRIA 4CSYA 1ELVA 2WIIC 1MD8A 3ZD1A 4AYDA 2B5ID 1Q3XA 5HYTB 2MCYA 1O9AA 3RJ3D 2V8EA 1PPQA 3IX0A 2JGXA 2XWBF 2XRDA 1H2PP 2XRBA 1G4FA 1TPMA 2G7IA 4LOTA 2UWNA 1SS2A 4PZ5A 2BZMA 4MUCA 1OK1A 3GOVA 2A55A 3CALA 2YBYA
chains in the Genus database with same CATH superfamily
2NAPA 1X0TA 3CCU1 3WSYA 3KIHA 4C16A 3CCQZ 3CPWY 1TWCI 1TPGA 4NFRA 3QWUA 3GTMS 5I0QB 1C1ZA 1YJNZ 2K5RA 4A3LI 3CC2Z 1H04P 3R62A 3OEDC 1OJYA 4AYEA 5IP9I 5C3EI 4E30A 1RNIA 1Q7Y1 2RLQA 2CG7A 4RVGA 3CCQ1 4IGDA 1VQ9Z 2B63I 1VQ81 3S1MI 1P9NA 1QYPA 2AYDA 4K12A 2E2HI 5DN4A 3Q87A 2VUMI 2HF1A 2VF1A 1S7MA 2DE6A 1K9M1 1OK3A 2RL0A 4B2RA 1JWHC 3OW2Z 4RV9A 1GPZA 5T67A 1I6HI 3S14I 4NBEA 2OOXB 3G6E1 3SW0X 3S1RI 1VQLZ 5D1OA 3JAMf 1VQ41 4S1TA 4A3KI 1K8A2 2NVXI 4HGYA 2P3YA 2WAQA 2YU9I 3O8EB 4QTUA 2OZKA 3U50C 3CCV1 4A3CI 3S1QI 2G2KA 4A3II 2NVYI 3S1NI 2XQWC 4APLA 3IR7A 5T64A 1NJI1 1OK9A 3KZJA 1VQ91 1NWVA 2NVQI 2LFUA 3MQLA 2V3VA 3GTJI 1LY2A 2QR1B 3PO2I 4ONTD 1YJ9Z 3CCEZ 1VQM1 4E33A 1YI2Z 2IZ4A 3KXVA 4RVFA 3OXUD 4ZH1D 2M6NA 1E88A 1AA6A 1W2BY 3S16I 2YRAA 2KRIA 2Y8TA 3FGRA 3VMIA 3I4NI 4NBGA 2WIIC 1MD8A 3BG1B 1Z01A 2R7ZI 4NBFA 1RO4A 3D6WA 1N2FA 1O9AA 3RJ3D 3CCJZ 2BJOA 3IX0A 5AN9F 1QVFY 3VTNA 2LEXA 2V8JA 1NJI2 2OTL1 4A3EI 1TPMA 3T4NB 3GOVA 3OW2Y 2GU2A 2W80A 4NBAA 3S17I 1QXFA 4Y52I 3LUSA 4MONA 1VQ7Z 2GTIA 3GTKI 3GTMI 2V8IA 3HOXI 3JAMb 3FQQA 3MZKB 3I561 4BXXI 4DJZA 1K731 2ZYCA 1VQ61 1ZB8A 4EWCA 1GKNA 1OJWA 4HGZA 1SRZA 1YHQ1 3J81b 4A3JI 1YUAA 5C44I 2J6AA 1FBRA 2AKLA 4E2YA 4DGLA 3GKQA 1SFOI 4AYIA 2M48A 4A5WB 1HFIA 4FXGG 1VVDA 1WZNA 1VQ4Z 2YADA 2W04A 5CM2M 1VQ6Z 2KMSA 3FKII 2EHFA 5IT9b 1QGBA 4MD8A 4NBCA 1ZH1A 1YJW1 1Q861 3I55Z 2QA41 1OJVA 2Q51A 1GHQB 1JJ2Y 3HOZI 2QKDA 4E2XA 1VQK1 1YITZ 1VQ5Z 1YI21 1TWHI 1Q822 1VQO1 1MD7A 4A93I 1VQ8Z 3WSXA 2RT9A 4QTTA 2MCZA 2ERJA 1QVGZ 1VQPZ 5FLMI 1KRLA 4KKDA 3J7A4 3TDHB 1VQOZ 3GCFA 2IV2X 3L89M 1SIWA 1Q16A 2VPZA 3G4S1 1E8BA 4LOSA 4YNXA 4F4OC 4AYBA 3CMAZ 1E5GA 2DE7A 3VMHA 5C4XI 2JNYA 4NB9A 4MRIA 1QVGY 3HKZA 3S2DI 1ZB9A 1VQMZ 3CCE1 1WCMI 1FDOA 1NUIA 3ZLDA 1RO2A 4NBDA 3G6EZ 3GTQI 3NH5A 1RLHA 3RZDI 2B5ID 3CCVZ 1Q7Y2 3GTLI 2V8EA 4RS4A 1G4FA 4DQYB 2PMZA 1Y1VS 3CD61 2UWNA 1SS2A 1I3QI 2BZMA 1M1K2 1PFTA 1R9TI 1OK1A 2A55A 2Y8SA 3CALA 2JUBA 2YBYA 1Y1VI 2E9HA 3VMGA 2F4MA 3ESWA 1N8R2 3PO3I 3M4OI 1X3ZA 2IZ3A 1S721 2EGTA 4J38B 1DL6A 1S72Z 1G4GA 3CCRZ 3K3TA 3NFPI 3VWOA 1I50I 2HU9A 2W03A 2OTJ1 4BBRI 2Y8RA 3CCL1 1H2QP 1WIIA 5C4JI 1TWAI 1U5MA 3ZLEA 4BY7I 2RLPA 3D2LA 5LL6f 3F6KA 4YIZA 3S2HI 2LIYA 2VPWA 2OTJZ 1NP6A 3MZLB 2OOYB 4NBHA 1HFHA 2JRAA 4NB8A 3I4MI 3CCSZ 4WJG2 3EERA 2JA5I 2RBLA 1YIJ1 3HOWI 2O39C 4BY1I 2QEXZ 4A3DI 2ZAEB 1VQNZ 1ZJKA 1Y8CA 3IU3I 3J80f 4NBBA 1X3WA 2Q4ZA 3P5JB 1TWGI 1YJN1 3NDIA 2X2ZA 3F3PC 1M901 2O4HA 2KI7B 4A3FI 3CMEZ 4RVDA 3CCM1 2H85A 2RHBA 2JMOA 4CL1A 2RPRA 3NH8A 3EEDA 3TVJA 1RQFA 4MH4A 5DN5A 3ERBA 2V8KA 4TNUA 2Y0SA 3RZOI 3GTOI 1L1OC 4N7EA 1W2BZ 1RO0A 3G711 1CKLA 3M3YI 2JGWA 2JR6A 4E2ZA 5IP7I 1VQP1 3CCMZ 3CCLZ 4NH1C 3J80b 3CC71 2PM9A 1Q812 1K732 4X6AI 2I2LA 2CG6A 2VUGA 1VQ71 2VPXA 3ZD2A 2K3RA 1ELVA 2PK7A 3VB9A 3K7AI 1YJWZ 1KQSY 2JIMA 2JIPA 5T6BA 2P28A 1Q3XA 3G4SZ 5HYTB 4RVHA 2JA6I 3CCJ1 2QRCB 1PPQA 1VQ51 1YIT1 2JGXA 2E7ZA 1H2PP 2XRBA 2JIRA 1KC81 3KIFA 3HOUI 4LOTA 1QVFZ 4PZ5A 1YUKA 4MUCA 2QLVB 4E2WA 3CCUZ 4A3BI 2JIQA 3CXCY 1QO6A 3NFZA 3M7PA 3CXCZ 1VLAA 3CD6Z 5FO8C 1USPA 1YJ91 1KD12 3GXEA 2GTHA 3I551 3CMA1 1VVCA 2R92I 1OK2A 3GTGI 4JHSA 2JS4A 1LQLA 2VPYA 1WJ2A 3CQZI 2RIQA 3NDJA 5JPMG 1YHQZ 4A3GI 5HYPA 2EC3A 1KQSZ 1USPB 1YIJZ 1KD11 1H03P 4E31A 3EJHA 3ZRZA 3NH4A 5FLXb 5IT9f 3D9XA 3CME1 4BBSI 3CC4Z 2E2II 1FDIA 1Q821 1TWFI 1HCCA 1Q811 4MSLA 3PO3S 3H3VJ 1WW9A 1KC82 3NJAA 1K8A1 2QEX1 1TPNA 3INBC 1Y1WI 2QA4Z 3OP8A 3CI0J 3HOVI 1Q862 3CCR1 5HZPB 2JA8I 2QREB 4HH4A 3MONA 4MD9A 1N8R1 2DE5A 2QY0A 2OTLZ 2NVTI 2LOJA 2JA7I 2RKYA 1QUBA 3FGTA 3IF8A 3J81f 3CPWZ 4Y7NI 2QRDB 2CKUA 3S15I 1K9M2 1M1K1 5HYUB 2V45A 2R6MA 4B2SA 4BWCA 1K83I 3GTPI 1TFIA 3FQMA 2RKZA 4AYMA 3TE5B 1QF8A 3CC21 2KPIA 2O53A 1RLYA 3T5OA 1GKGA 1UOTP 5D1OB 1VQKZ 3I56Z 5D1PA 1Z92B 3CC7Z 2W81A 3I07A 5A2Qf 2R93I 4PO7A 4A3MI 2XWJI 4NOZA 2F4OA 2E2JI 5FLXf 4CSYA 3CC41 4MXUA 2WB1A 3F3FC 3BG0B 5A2Qb 1Z02A 3ZD1A 2I3CA 4AYDA 1ML8A 3IFUA 4XX2A 1VQN1 2MCYA 2JIOA 4MD7A 1M902 3HOYI 1JJ2Z 2XWBF 2XRDA 3G71Z 2G7IA 1VQL1 3CCS1 1Z03A 3H0GI 4DK1A 4E32A
chains in the Genus database with same CATH topology
1X0TA 3CCU1 3KIHA 4C16A 3CCQZ 3CPWY 1TWCI 1TPGA 4NFRA 3QWUA 3GTMS 5I0QB 1C1ZA 1YJNZ 2K5RA 4A3LI 3CC2Z 1H04P 3R62A 3OEDC 1OJYA 4AYEA 5IP9I 5C3EI 4E30A 1RNIA 1Q7Y1 2RLQA 2CG7A 4RVGA 3CCQ1 4IGDA 1VQ9Z 2B63I 1VQ81 3S1MI 1P9NA 1QYPA 4K12A 2E2HI 3Q87A 2VUMI 2HF1A 2VF1A 1S7MA 2DE6A 1K9M1 1OK3A 2RL0A 4B2RA 1JWHC 3OW2Z 4RV9A 1GPZA 5T67A 1I6HI 3S14I 4NBEA 2OOXB 3G6E1 3SW0X 3S1RI 1VQLZ 5D1OA 3JAMf 1VQ41 4S1TA 4A3KI 1K8A2 2NVXI 4HGYA 2P3YA 2WAQA 2YU9I 3O8EB 4QTUA 2OZKA 3U50C 3CCV1 4A3CI 3S1QI 2G2KA 4A3II 2NVYI 3S1NI 2XQWC 1NJI1 5T64A 1OK9A 3KZJA 1VQ91 1NWVA 2NVQI 2LFUA 3MQLA 3GTJI 1LY2A 2QR1B 3PO2I 4ONTD 1YJ9Z 3CCEZ 1VQM1 4E33A 1YI2Z 2IZ4A 3KXVA 4RVFA 3OXUD 4ZH1D 2M6NA 1E88A 1W2BY 3S16I 2YRAA 2KRIA 3VMIA 3I4NI 4NBGA 2WIIC 1MD8A 3BG1B 1Z01A 2R7ZI 4NBFA 1RO4A 3D6WA 1N2FA 1O9AA 3RJ3D 3CCJZ 2BJOA 3IX0A 5AN9F 1QVFY 3VTNA 2V8JA 1NJI2 2OTL1 4A3EI 1TPMA 3T4NB 3GOVA 3OW2Y 2GU2A 4NBAA 2W80A 3S17I 4Y52I 3LUSA 4MONA 1VQ7Z 2GTIA 3GTKI 3GTMI 2V8IA 3HOXI 3JAMb 3FQQA 3MZKB 3I561 4BXXI 4DJZA 1K731 1VQ61 1ZB8A 4EWCA 1GKNA 1OJWA 4HGZA 1SRZA 1YHQ1 3J81b 4A3JI 1YUAA 5C44I 2J6AA 1FBRA 2AKLA 4E2YA 4DGLA 3GKQA 1SFOI 4AYIA 2M48A 4A5WB 1HFIA 4FXGG 1VVDA 1VQ4Z 2YADA 2W04A 5CM2M 1VQ6Z 2KMSA 3FKII 2EHFA 5IT9b 1QGBA 4MD8A 4NBCA 1ZH1A 1YJW1 1Q861 3I55Z 2QA41 1OJVA 2Q51A 1GHQB 1JJ2Y 3HOZI 2QKDA 4E2XA 1VQK1 1YITZ 1VQ5Z 1YI21 1TWHI 1Q822 1VQO1 1MD7A 4A93I 1VQ8Z 2RT9A 4QTTA 2MCZA 2ERJA 1QVGZ 1VQPZ 5FLMI 1KRLA 4KKDA 3J7A4 3TDHB 1VQOZ 3GCFA 3L89M 3G4S1 1E8BA 4LOSA 4YNXA 4F4OC 4AYBA 3CMAZ 1E5GA 2DE7A 3VMHA 5C4XI 2JNYA 4NB9A 4MRIA 1QVGY 3HKZA 3S2DI 1ZB9A 1VQMZ 3CCE1 1WCMI 1NUIA 3G6EZ 3GTQI 4NBDA 1RO2A 3NH5A 3RZDI 2B5ID 3CCVZ 1Q7Y2 3GTLI 2V8EA 4RS4A 1G4FA 4DQYB 2PMZA 1Y1VS 3CD61 2UWNA 1SS2A 1I3QI 2BZMA 1M1K2 1PFTA 1R9TI 1OK1A 2A55A 3CALA 2JUBA 2YBYA 1Y1VI 2E9HA 3VMGA 2F4MA 3ESWA 1N8R2 3PO3I 3M4OI 1X3ZA 2IZ3A 1S721 2EGTA 4J38B 1DL6A 1S72Z 1G4GA 3CCRZ 3NFPI 1I50I 2W03A 2HU9A 2OTJ1 4BBRI 3CCL1 1H2QP 1WIIA 5C4JI 1TWAI 1U5MA 4BY7I 2RLPA 5LL6f 3S2HI 2LIYA 2OTJZ 1NP6A 3MZLB 2OOYB 4NBHA 1HFHA 2JRAA 4NB8A 3I4MI 3CCSZ 4WJG2 3EERA 2JA5I 2RBLA 1YIJ1 3HOWI 2O39C 4BY1I 2QEXZ 4A3DI 2ZAEB 1VQNZ 1ZJKA 3IU3I 3J80f 4NBBA 1X3WA 2Q4ZA 3P5JB 1TWGI 1YJN1 3NDIA 1M901 3F3PC 2O4HA 2KI7B 4A3FI 3CMEZ 4RVDA 3CCM1 2H85A 2RHBA 2JMOA 4CL1A 2RPRA 3NH8A 3EEDA 3TVJA 1RQFA 4MH4A 2V8KA 3ERBA 4TNUA 2Y0SA 3RZOI 3GTOI 1L1OC 1W2BZ 1RO0A 3G711 1CKLA 3M3YI 2JGWA 2JR6A 4E2ZA 5IP7I 1VQP1 3CCMZ 3CCLZ 4NH1C 3J80b 3CC71 2PM9A 1Q812 1K732 4X6AI 2CG6A 2VUGA 1VQ71 3ZD2A 2K3RA 1ELVA 2PK7A 3VB9A 3K7AI 1YJWZ 1KQSY 5T6BA 2P28A 1Q3XA 3G4SZ 5HYTB 4RVHA 2JA6I 3CCJ1 2QRCB 1PPQA 1VQ51 1YIT1 2JGXA 1H2PP 2XRBA 1KC81 3KIFA 3HOUI 4LOTA 1QVFZ 4PZ5A 1YUKA 4MUCA 2QLVB 4E2WA 3CCUZ 4A3BI 3CXCY 1QO6A 3NFZA 3M7PA 3CXCZ 1VLAA 3CD6Z 5FO8C 1USPA 1YJ91 1KD12 3GXEA 2GTHA 3I551 3CMA1 1VVCA 2R92I 1OK2A 3GTGI 4JHSA 2JS4A 1LQLA 3CQZI 2RIQA 3NDJA 5JPMG 1YHQZ 4A3GI 5HYPA 2EC3A 1KQSZ 1USPB 1YIJZ 1KD11 1H03P 4E31A 3EJHA 3ZRZA 3NH4A 5FLXb 5IT9f 3D9XA 3CME1 4BBSI 3CC4Z 2E2II 1Q821 1TWFI 1HCCA 1Q811 3PO3S 3H3VJ 1WW9A 1KC82 1K8A1 2QEX1 1TPNA 3INBC 1Y1WI 2QA4Z 3OP8A 3HOVI 1Q862 3CCR1 5HZPB 2JA8I 2QREB 4HH4A 3MONA 4MD9A 1N8R1 2DE5A 2QY0A 2OTLZ 2NVTI 2LOJA 2JA7I 2RKYA 1QUBA 3IF8A 3J81f 3CPWZ 4Y7NI 2QRDB 2CKUA 3S15I 1K9M2 1M1K1 5HYUB 2R6MA 4B2SA 1K83I 3GTPI 1TFIA 3FQMA 2RKZA 4AYMA 3TE5B 1QF8A 3CC21 2KPIA 2O53A 1RLYA 3T5OA 1GKGA 1UOTP 5D1OB 1VQKZ 3I56Z 5D1PA 1Z92B 3CC7Z 2W81A 3I07A 5A2Qf 2R93I 4A3MI 2XWJI 4NOZA 2F4OA 2E2JI 5FLXf 4CSYA 3CC41 4MXUA 2WB1A 3BG0B 3F3FC 5A2Qb 1Z02A 3ZD1A 2I3CA 4AYDA 1ML8A 3IFUA 4XX2A 1VQN1 2MCYA 3HOYI 4MD7A 1M902 1JJ2Z 2XWBF 2XRDA 3G71Z 2G7IA 1VQL1 3CCS1 1Z03A 3H0GI 4DK1A 4E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QO6 A;  3M7P A;  4C16 A;  1TPG A;  5FO8 C;  2IZ3 A;  3GXE A;  5I0Q B;  1C1Z A;  4J38 B;  1VVC A;  1OK2 A;  1G4G A;  1H04 P;  3R62 A;  3NFP I;  4JHS A;  3OED C;  1OJY A;  4AYE A;  4DJZ A;  1H2Q P;  1GKN A;  1OJW A;  2RLQ A;  1SRZ A;  5JPM G;  5HYP A;  2CG7 A;  2EC3 A;  4IGD A;  1U5M A;  2RLP A;  1FBR A;  1H03 P;  4K12 A;  4AYI A;  1HFH A;  3EJH A;  2JRA A;  4WJG 2;  2W80 A;  4A5W B;  3ZRZ A;  1HFI A;  4FXG G;  1VVD A;  1OK3 A;  2RL0 A;  4B2R A;  1HCC A;  2O39 C;  2KMS A;  1GPZ A;  2EHF A;  1ZJK A;  1QGB A;  3IU3 I;  1TPN A;  3INB C;  3SW0 X;  1OJV A;  3OP8 A;  1GHQ B;  5HZP B;  2QY0 A;  2LOJ A;  2RKY A;  1QUB A;  2CKU A;  3O8E B;  3TVJ A;  1MD7 A;  5HYU B;  3ERB A;  2MCZ A;  2ERJ A;  2XQW C;  4B2S A;  1OK9 A;  3KZJ A;  4KKD A;  1CKL A;  2RKZ A;  3L89 M;  4AYM A;  1NWV A;  2JGW A;  3T5O A;  1GKG A;  3MQL A;  1UOT P;  1LY2 A;  1E8B A;  4ONT D;  4LOS A;  1Z92 B;  4YNX A;  4F4O C;  2CG6 A;  2W81 A;  2IZ4 A;  3KXV A;  3OXU D;  4ZH1 D;  1E5G A;  1E88 A;  2XWJ I;  3ZD2 A;  2YRA A;  2KRI A;  4CSY A;  1ELV A;  2WII C;  1MD8 A;  3ZD1 A;  4AYD A;  2B5I D;  1Q3X A;  5HYT B;  2MCY A;  1O9A A;  3RJ3 D;  2V8E A;  1PPQ A;  3IX0 A;  2JGX A;  2XWB F;  2XRD A;  1H2P P;  2XRB A;  1G4F A;  1TPM A;  2G7I A;  4LOT A;  2UWN A;  1SS2 A;  4PZ5 A;  2BZM A;  4MUC A;  1OK1 A;  3GOV A;  2A55 A;  3CAL A;  2YBY A; 
#chains in the Genus database with same CATH topology
 2NAP A;  1X0T A;  3CCU 1;  3WSY A;  3KIH A;  4C16 A;  3CCQ Z;  3CPW Y;  1TWC I;  1TPG A;  4NFR A;  3QWU A;  3GTM S;  5I0Q B;  1C1Z A;  1YJN Z;  2K5R A;  4A3L I;  3CC2 Z;  1H04 P;  3R62 A;  3OED C;  1OJY A;  4AYE A;  5IP9 I;  5C3E I;  4E30 A;  1RNI A;  1Q7Y 1;  2RLQ A;  2CG7 A;  4RVG A;  3CCQ 1;  4IGD A;  1VQ9 Z;  2B63 I;  1VQ8 1;  3S1M I;  1P9N A;  1QYP A;  2AYD A;  4K12 A;  2E2H I;  5DN4 A;  3Q87 A;  2VUM I;  2HF1 A;  2VF1 A;  1S7M A;  2DE6 A;  1K9M 1;  1OK3 A;  2RL0 A;  4B2R A;  1JWH C;  3OW2 Z;  4RV9 A;  1GPZ A;  5T67 A;  1I6H I;  3S14 I;  4NBE A;  2OOX B;  3G6E 1;  3SW0 X;  3S1R I;  1VQL Z;  5D1O A;  3JAM f;  1VQ4 1;  4S1T A;  4A3K I;  1K8A 2;  2NVX I;  4HGY A;  2P3Y A;  2WAQ A;  2YU9 I;  3O8E B;  4QTU A;  2OZK A;  3U50 C;  3CCV 1;  4A3C I;  3S1Q I;  2G2K A;  4A3I I;  2NVY I;  3S1N I;  2XQW C;  4APL A;  3IR7 A;  5T64 A;  1NJI 1;  1OK9 A;  3KZJ A;  1VQ9 1;  1NWV A;  2NVQ I;  2LFU A;  3MQL A;  2V3V A;  3GTJ I;  1LY2 A;  2QR1 B;  3PO2 I;  4ONT D;  1YJ9 Z;  3CCE Z;  1VQM 1;  4E33 A;  1YI2 Z;  2IZ4 A;  3KXV A;  4RVF A;  3OXU D;  4ZH1 D;  2M6N A;  1E88 A;  1AA6 A;  1W2B Y;  3S16 I;  2YRA A;  2KRI A;  2Y8T A;  3FGR A;  3VMI A;  3I4N I;  4NBG A;  2WII C;  1MD8 A;  3BG1 B;  1Z01 A;  2R7Z I;  4NBF A;  1RO4 A;  3D6W A;  1N2F A;  1O9A A;  3RJ3 D;  3CCJ Z;  2BJO A;  3IX0 A;  5AN9 F;  1QVF Y;  3VTN A;  2LEX A;  2V8J A;  1NJI 2;  2OTL 1;  4A3E I;  1TPM A;  3T4N B;  3GOV A;  3OW2 Y;  2GU2 A;  2W80 A;  4NBA A;  3S17 I;  1QXF A;  4Y52 I;  3LUS A;  4MON A;  1VQ7 Z;  2GTI A;  3GTK I;  3GTM I;  2V8I A;  3HOX I;  3JAM b;  3FQQ A;  3MZK B;  3I56 1;  4BXX I;  4DJZ A;  1K73 1;  2ZYC A;  1VQ6 1;  1ZB8 A;  4EWC A;  1GKN A;  1OJW A;  4HGZ A;  1SRZ A;  1YHQ 1;  3J81 b;  4A3J I;  1YUA A;  5C44 I;  2J6A A;  1FBR A;  2AKL A;  4E2Y A;  4DGL A;  3GKQ A;  1SFO I;  4AYI A;  2M48 A;  4A5W B;  1HFI A;  4FXG G;  1VVD A;  1WZN A;  1VQ4 Z;  2YAD A;  2W04 A;  5CM2 M;  1VQ6 Z;  2KMS A;  3FKI I;  2EHF A;  5IT9 b;  1QGB A;  4MD8 A;  4NBC A;  1ZH1 A;  1YJW 1;  1Q86 1;  3I55 Z;  2QA4 1;  1OJV A;  2Q51 A;  1GHQ B;  1JJ2 Y;  3HOZ I;  2QKD A;  4E2X A;  1VQK 1;  1YIT Z;  1VQ5 Z;  1YI2 1;  1TWH I;  1Q82 2;  1VQO 1;  1MD7 A;  4A93 I;  1VQ8 Z;  3WSX A;  2RT9 A;  4QTT A;  2MCZ A;  2ERJ A;  1QVG Z;  1VQP Z;  5FLM I;  1KRL A;  4KKD A;  3J7A 4;  3TDH B;  1VQO Z;  3GCF A;  2IV2 X;  3L89 M;  1SIW A;  1Q16 A;  2VPZ A;  3G4S 1;  1E8B A;  4LOS A;  4YNX A;  4F4O C;  4AYB A;  3CMA Z;  1E5G A;  2DE7 A;  3VMH A;  5C4X I;  2JNY A;  4NB9 A;  4MRI A;  1QVG Y;  3HKZ A;  3S2D I;  1ZB9 A;  1VQM Z;  3CCE 1;  1WCM I;  1FDO A;  1NUI A;  3ZLD A;  1RO2 A;  4NBD A;  3G6E Z;  3GTQ I;  3NH5 A;  1RLH A;  3RZD I;  2B5I D;  3CCV Z;  1Q7Y 2;  3GTL I;  2V8E A;  4RS4 A;  1G4F A;  4DQY B;  2PMZ A;  1Y1V S;  3CD6 1;  2UWN A;  1SS2 A;  1I3Q I;  2BZM A;  1M1K 2;  1PFT A;  1R9T I;  1OK1 A;  2A55 A;  2Y8S A;  3CAL A;  2JUB A;  2YBY A;  1Y1V I;  2E9H A;  3VMG A;  2F4M A;  3ESW A;  1N8R 2;  3PO3 I;  3M4O I;  1X3Z A;  2IZ3 A;  1S72 1;  2EGT A;  4J38 B;  1DL6 A;  1S72 Z;  1G4G A;  3CCR Z;  3K3T A;  3NFP I;  3VWO A;  1I50 I;  2HU9 A;  2W03 A;  2OTJ 1;  4BBR I;  2Y8R A;  3CCL 1;  1H2Q P;  1WII A;  5C4J I;  1TWA I;  1U5M A;  3ZLE A;  4BY7 I;  2RLP A;  3D2L A;  5LL6 f;  3F6K A;  4YIZ A;  3S2H I;  2LIY A;  2VPW A;  2OTJ Z;  1NP6 A;  3MZL B;  2OOY B;  4NBH A;  1HFH A;  2JRA A;  4NB8 A;  3I4M I;  3CCS Z;  4WJG 2;  3EER A;  2JA5 I;  2RBL A;  1YIJ 1;  3HOW I;  2O39 C;  4BY1 I;  2QEX Z;  4A3D I;  2ZAE B;  1VQN Z;  1ZJK A;  1Y8C A;  3IU3 I;  3J80 f;  4NBB A;  1X3W A;  2Q4Z A;  3P5J B;  1TWG I;  1YJN 1;  3NDI A;  2X2Z A;  3F3P C;  1M90 1;  2O4H A;  2KI7 B;  4A3F I;  3CME Z;  4RVD A;  3CCM 1;  2H85 A;  2RHB A;  2JMO A;  4CL1 A;  2RPR A;  3NH8 A;  3EED A;  3TVJ A;  1RQF A;  4MH4 A;  5DN5 A;  3ERB A;  2V8K A;  4TNU A;  2Y0S A;  3RZO I;  3GTO I;  1L1O C;  4N7E A;  1W2B Z;  1RO0 A;  3G71 1;  1CKL A;  3M3Y I;  2JGW A;  2JR6 A;  4E2Z A;  5IP7 I;  1VQP 1;  3CCM Z;  3CCL Z;  4NH1 C;  3J80 b;  3CC7 1;  2PM9 A;  1Q81 2;  1K73 2;  4X6A I;  2I2L A;  2CG6 A;  2VUG A;  1VQ7 1;  2VPX A;  3ZD2 A;  2K3R A;  1ELV A;  2PK7 A;  3VB9 A;  3K7A I;  1YJW Z;  1KQS Y;  2JIM A;  2JIP A;  5T6B A;  2P28 A;  1Q3X A;  3G4S Z;  5HYT B;  4RVH A;  2JA6 I;  3CCJ 1;  2QRC B;  1PPQ A;  1VQ5 1;  1YIT 1;  2JGX A;  2E7Z A;  1H2P P;  2XRB A;  2JIR A;  1KC8 1;  3KIF A;  3HOU I;  4LOT A;  1QVF Z;  4PZ5 A;  1YUK A;  4MUC A;  2QLV B;  4E2W A;  3CCU Z;  4A3B I;  2JIQ A;  3CXC Y;  1QO6 A;  3NFZ A;  3M7P A;  3CXC Z;  1VLA A;  3CD6 Z;  5FO8 C;  1USP A;  1YJ9 1;  1KD1 2;  3GXE A;  2GTH A;  3I55 1;  3CMA 1;  1VVC A;  2R92 I;  1OK2 A;  3GTG I;  4JHS A;  2JS4 A;  1LQL A;  2VPY A;  1WJ2 A;  3CQZ I;  2RIQ A;  3NDJ A;  5JPM G;  1YHQ Z;  4A3G I;  5HYP A;  2EC3 A;  1KQS Z;  1USP B;  1YIJ Z;  1KD1 1;  1H03 P;  4E31 A;  3EJH A;  3ZRZ A;  3NH4 A;  5FLX b;  5IT9 f;  3D9X A;  3CME 1;  4BBS I;  3CC4 Z;  2E2I I;  1FDI A;  1Q82 1;  1TWF I;  1HCC A;  1Q81 1;  4MSL A;  3PO3 S;  3H3V J;  1WW9 A;  1KC8 2;  3NJA A;  1K8A 1;  2QEX 1;  1TPN A;  3INB C;  1Y1W I;  2QA4 Z;  3OP8 A;  3CI0 J;  3HOV I;  1Q86 2;  3CCR 1;  5HZP B;  2JA8 I;  2QRE B;  4HH4 A;  3MON A;  4MD9 A;  1N8R 1;  2DE5 A;  2QY0 A;  2OTL Z;  2NVT I;  2LOJ A;  2JA7 I;  2RKY A;  1QUB A;  3FGT A;  3IF8 A;  3J81 f;  3CPW Z;  4Y7N I;  2QRD B;  2CKU A;  3S15 I;  1K9M 2;  1M1K 1;  5HYU B;  2V45 A;  2R6M A;  4B2S A;  4BWC A;  1K83 I;  3GTP I;  1TFI A;  3FQM A;  2RKZ A;  4AYM A;  3TE5 B;  1QF8 A;  3CC2 1;  2KPI A;  2O53 A;  1RLY A;  3T5O A;  1GKG A;  1UOT P;  5D1O B;  1VQK Z;  3I56 Z;  5D1P A;  1Z92 B;  3CC7 Z;  2W81 A;  3I07 A;  5A2Q f;  2R93 I;  4PO7 A;  4A3M I;  2XWJ I;  4NOZ A;  2F4O A;  2E2J I;  5FLX f;  4CSY A;  3CC4 1;  4MXU A;  2WB1 A;  3F3F C;  3BG0 B;  5A2Q b;  1Z02 A;  3ZD1 A;  2I3C A;  4AYD A;  1ML8 A;  3IFU A;  4XX2 A;  1VQN 1;  2MCY A;  2JIO A;  4MD7 A;  1M90 2;  3HOY I;  1JJ2 Z;  2XWB F;  2XRD A;  3G71 Z;  2G7I A;  1VQL 1;  3CCS 1;  1Z03 A;  3H0G I;  4DK1 A;  4E32 A; 
#chains in the Genus database with same CATH homology
 1X0T A;  3CCU 1;  3KIH A;  4C16 A;  3CCQ Z;  3CPW Y;  1TWC I;  1TPG A;  4NFR A;  3QWU A;  3GTM S;  5I0Q B;  1C1Z A;  1YJN Z;  2K5R A;  4A3L I;  3CC2 Z;  1H04 P;  3R62 A;  3OED C;  1OJY A;  4AYE A;  5IP9 I;  5C3E I;  4E30 A;  1RNI A;  1Q7Y 1;  2RLQ A;  2CG7 A;  4RVG A;  3CCQ 1;  4IGD A;  1VQ9 Z;  2B63 I;  1VQ8 1;  3S1M I;  1P9N A;  1QYP A;  4K12 A;  2E2H I;  3Q87 A;  2VUM I;  2HF1 A;  2VF1 A;  1S7M A;  2DE6 A;  1K9M 1;  1OK3 A;  2RL0 A;  4B2R A;  1JWH C;  3OW2 Z;  4RV9 A;  1GPZ A;  5T67 A;  1I6H I;  3S14 I;  4NBE A;  2OOX B;  3G6E 1;  3SW0 X;  3S1R I;  1VQL Z;  5D1O A;  3JAM f;  1VQ4 1;  4S1T A;  4A3K I;  1K8A 2;  2NVX I;  4HGY A;  2P3Y A;  2WAQ A;  2YU9 I;  3O8E B;  4QTU A;  2OZK A;  3U50 C;  3CCV 1;  4A3C I;  3S1Q I;  2G2K A;  4A3I I;  2NVY I;  3S1N I;  2XQW C;  1NJI 1;  5T64 A;  1OK9 A;  3KZJ A;  1VQ9 1;  1NWV A;  2NVQ I;  2LFU A;  3MQL A;  3GTJ I;  1LY2 A;  2QR1 B;  3PO2 I;  4ONT D;  1YJ9 Z;  3CCE Z;  1VQM 1;  4E33 A;  1YI2 Z;  2IZ4 A;  3KXV A;  4RVF A;  3OXU D;  4ZH1 D;  2M6N A;  1E88 A;  1W2B Y;  3S16 I;  2YRA A;  2KRI A;  3VMI A;  3I4N I;  4NBG A;  2WII C;  1MD8 A;  3BG1 B;  1Z01 A;  2R7Z I;  4NBF A;  1RO4 A;  3D6W A;  1N2F A;  1O9A A;  3RJ3 D;  3CCJ Z;  2BJO A;  3IX0 A;  5AN9 F;  1QVF Y;  3VTN A;  2V8J A;  1NJI 2;  2OTL 1;  4A3E I;  1TPM A;  3T4N B;  3GOV A;  3OW2 Y;  2GU2 A;  4NBA A;  2W80 A;  3S17 I;  4Y52 I;  3LUS A;  4MON A;  1VQ7 Z;  2GTI A;  3GTK I;  3GTM I;  2V8I A;  3HOX I;  3JAM b;  3FQQ A;  3MZK B;  3I56 1;  4BXX I;  4DJZ A;  1K73 1;  1VQ6 1;  1ZB8 A;  4EWC A;  1GKN A;  1OJW A;  4HGZ A;  1SRZ A;  1YHQ 1;  3J81 b;  4A3J I;  1YUA A;  5C44 I;  2J6A A;  1FBR A;  2AKL A;  4E2Y A;  4DGL A;  3GKQ A;  1SFO I;  4AYI A;  2M48 A;  4A5W B;  1HFI A;  4FXG G;  1VVD A;  1VQ4 Z;  2YAD A;  2W04 A;  5CM2 M;  1VQ6 Z;  2KMS A;  3FKI I;  2EHF A;  5IT9 b;  1QGB A;  4MD8 A;  4NBC A;  1ZH1 A;  1YJW 1;  1Q86 1;  3I55 Z;  2QA4 1;  1OJV A;  2Q51 A;  1GHQ B;  1JJ2 Y;  3HOZ I;  2QKD A;  4E2X A;  1VQK 1;  1YIT Z;  1VQ5 Z;  1YI2 1;  1TWH I;  1Q82 2;  1VQO 1;  1MD7 A;  4A93 I;  1VQ8 Z;  2RT9 A;  4QTT A;  2MCZ A;  2ERJ A;  1QVG Z;  1VQP Z;  5FLM I;  1KRL A;  4KKD A;  3J7A 4;  3TDH B;  1VQO Z;  3GCF A;  3L89 M;  3G4S 1;  1E8B A;  4LOS A;  4YNX A;  4F4O C;  4AYB A;  3CMA Z;  1E5G A;  2DE7 A;  3VMH A;  5C4X I;  2JNY A;  4NB9 A;  4MRI A;  1QVG Y;  3HKZ A;  3S2D I;  1ZB9 A;  1VQM Z;  3CCE 1;  1WCM I;  1NUI A;  3G6E Z;  3GTQ I;  4NBD A;  1RO2 A;  3NH5 A;  3RZD I;  2B5I D;  3CCV Z;  1Q7Y 2;  3GTL I;  2V8E A;  4RS4 A;  1G4F A;  4DQY B;  2PMZ A;  1Y1V S;  3CD6 1;  2UWN A;  1SS2 A;  1I3Q I;  2BZM A;  1M1K 2;  1PFT A;  1R9T I;  1OK1 A;  2A55 A;  3CAL A;  2JUB A;  2YBY A;  1Y1V I;  2E9H A;  3VMG A;  2F4M A;  3ESW A;  1N8R 2;  3PO3 I;  3M4O I;  1X3Z A;  2IZ3 A;  1S72 1;  2EGT A;  4J38 B;  1DL6 A;  1S72 Z;  1G4G A;  3CCR Z;  3NFP I;  1I50 I;  2W03 A;  2HU9 A;  2OTJ 1;  4BBR I;  3CCL 1;  1H2Q P;  1WII A;  5C4J I;  1TWA I;  1U5M A;  4BY7 I;  2RLP A;  5LL6 f;  3S2H I;  2LIY A;  2OTJ Z;  1NP6 A;  3MZL B;  2OOY B;  4NBH A;  1HFH A;  2JRA A;  4NB8 A;  3I4M I;  3CCS Z;  4WJG 2;  3EER A;  2JA5 I;  2RBL A;  1YIJ 1;  3HOW I;  2O39 C;  4BY1 I;  2QEX Z;  4A3D I;  2ZAE B;  1VQN Z;  1ZJK A;  3IU3 I;  3J80 f;  4NBB A;  1X3W A;  2Q4Z A;  3P5J B;  1TWG I;  1YJN 1;  3NDI A;  1M90 1;  3F3P C;  2O4H A;  2KI7 B;  4A3F I;  3CME Z;  4RVD A;  3CCM 1;  2H85 A;  2RHB A;  2JMO A;  4CL1 A;  2RPR A;  3NH8 A;  3EED A;  3TVJ A;  1RQF A;  4MH4 A;  2V8K A;  3ERB A;  4TNU A;  2Y0S A;  3RZO I;  3GTO I;  1L1O C;  1W2B Z;  1RO0 A;  3G71 1;  1CKL A;  3M3Y I;  2JGW A;  2JR6 A;  4E2Z A;  5IP7 I;  1VQP 1;  3CCM Z;  3CCL Z;  4NH1 C;  3J80 b;  3CC7 1;  2PM9 A;  1Q81 2;  1K73 2;  4X6A I;  2CG6 A;  2VUG A;  1VQ7 1;  3ZD2 A;  2K3R A;  1ELV A;  2PK7 A;  3VB9 A;  3K7A I;  1YJW Z;  1KQS Y;  5T6B A;  2P28 A;  1Q3X A;  3G4S Z;  5HYT B;  4RVH A;  2JA6 I;  3CCJ 1;  2QRC B;  1PPQ A;  1VQ5 1;  1YIT 1;  2JGX A;  1H2P P;  2XRB A;  1KC8 1;  3KIF A;  3HOU I;  4LOT A;  1QVF Z;  4PZ5 A;  1YUK A;  4MUC A;  2QLV B;  4E2W A;  3CCU Z;  4A3B I;  3CXC Y;  1QO6 A;  3NFZ A;  3M7P A;  3CXC Z;  1VLA A;  3CD6 Z;  5FO8 C;  1USP A;  1YJ9 1;  1KD1 2;  3GXE A;  2GTH A;  3I55 1;  3CMA 1;  1VVC A;  2R92 I;  1OK2 A;  3GTG I;  4JHS A;  2JS4 A;  1LQL A;  3CQZ I;  2RIQ A;  3NDJ A;  5JPM G;  1YHQ Z;  4A3G I;  5HYP A;  2EC3 A;  1KQS Z;  1USP B;  1YIJ Z;  1KD1 1;  1H03 P;  4E31 A;  3EJH A;  3ZRZ A;  3NH4 A;  5FLX b;  5IT9 f;  3D9X A;  3CME 1;  4BBS I;  3CC4 Z;  2E2I I;  1Q82 1;  1TWF I;  1HCC A;  1Q81 1;  3PO3 S;  3H3V J;  1WW9 A;  1KC8 2;  1K8A 1;  2QEX 1;  1TPN A;  3INB C;  1Y1W I;  2QA4 Z;  3OP8 A;  3HOV I;  1Q86 2;  3CCR 1;  5HZP B;  2JA8 I;  2QRE B;  4HH4 A;  3MON A;  4MD9 A;  1N8R 1;  2DE5 A;  2QY0 A;  2OTL Z;  2NVT I;  2LOJ A;  2JA7 I;  2RKY A;  1QUB A;  3IF8 A;  3J81 f;  3CPW Z;  4Y7N I;  2QRD B;  2CKU A;  3S15 I;  1K9M 2;  1M1K 1;  5HYU B;  2R6M A;  4B2S A;  1K83 I;  3GTP I;  1TFI A;  3FQM A;  2RKZ A;  4AYM A;  3TE5 B;  1QF8 A;  3CC2 1;  2KPI A;  2O53 A;  1RLY A;  3T5O A;  1GKG A;  1UOT P;  5D1O B;  1VQK Z;  3I56 Z;  5D1P A;  1Z92 B;  3CC7 Z;  2W81 A;  3I07 A;  5A2Q f;  2R93 I;  4A3M I;  2XWJ I;  4NOZ A;  2F4O A;  2E2J I;  5FLX f;  4CSY A;  3CC4 1;  4MXU A;  2WB1 A;  3BG0 B;  3F3F C;  5A2Q b;  1Z02 A;  3ZD1 A;  2I3C A;  4AYD A;  1ML8 A;  3IFU A;  4XX2 A;  1VQN 1;  2MCY A;  3HOY I;  4MD7 A;  1M90 2;  1JJ2 Z;  2XWB F;  2XRD A;  3G71 Z;  2G7I A;  1VQL 1;  3CCS 1;  1Z03 A;  3H0G I;  4DK1 A;  4E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...