2IZ3A

Solution structure of human beta-microseminoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
b'SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Inhibitor
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz3A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz3A02
4WJG2 4J38B 2JGXA 4DJZA 1OJWA 4A5WB 1H2PP 1OK2A 1NWVA 1SS2A 2KRIA 1MD8A 2EHFA 3MQLA 3T5OA 1TPGA 3INBC 3GXEA 1VVCA 2XQWC 4K12A 3ZRZA 2EC3A 2JRAA 1H04P 2B5ID 1QGBA 2O39C 1OK3A 4CSYA 2IZ4A 1C1ZA 3GOVA 1E5GA 2YRAA 2RLQA 3KZJA 2JGWA 4AYIA 1OK9A 3EJHA 1QO6A 1TPMA 1TPNA 1E8BA 4AYEA 3L89M 1LY2A 2KMSA 1GKGA 4C16A 2BZMA 2ERJA 2XWBF 2W81A 5FO8C 1HFHA 1GHQB 3R62A 3IU3I 2QY0A 4LOSA 2XWJI 3RJ3D 1VVDA 4YNXA 1ELVA 2MCZA 1OK1A 2G7IA 4LOTA 3ERBA 1FBRA 2CG6A 1QUBA 2UWNA 3IX0A 3SW0X 5HYUB 1SRZA 3NFPI 4FXGG 1MD7A 3ZD1A 1UOTP 2RKZA 1Q3XA 1G4FA 3O8EB 3OEDC 3TVJA 4ZH1D 1G4GA 2W80A 3OXUD 2RKYA 2XRDA 1HCCA 2CG7A 4IGDA 2RLPA 4AYMA 1Z92B 1GKNA 2V8EA 2A55A 4KKDA 1E88A 2CKUA 4ONTD 5HYPA 1OJYA 4B2SA 4F4OC 1O9AA 2YBYA 4PZ5A 5I0QB 1CKLA 5HZPB 1ZJKA 1U5MA 5JPMG 4MUCA 4JHSA 1H03P 3ZD2A 4AYDA 2LOJA 1GPZA 3KXVA 2WIIC 3OP8A 2XRBA 4B2RA 1H2QP 1HFIA 3CALA 2RL0A 5HYTB 2IZ3A 3M7PA 2MCYA 1OJVA 1PPQA
chains in the Genus database with same CATH superfamily
1YIJZ 4J38B 2JGXA 4DJZA 1JJ2Y 2DE7A 1H2PP 1NWVA 3S14I 4A3BI 1ZB8A 1KQSZ 1MD8A 4MD9A 1VQO1 2JIMA 2QRCB 2VPWA 1VQ4Z 1NUIA 3NDJA 1DL6A 2XQWC 1K83I 2VPZA 5T64A 3ZRZA 2Q51A 1TFIA 1KD12 1H04P 1Q7Y1 1OK3A 4QTTA 3CXCY 1YI2Z 2DE6A 1VQPZ 5C3EI 1YJW1 1QXFA 2JGWA 1X3ZA 1K8A1 3FKII 4E30A 2V3VA 5FLMI 1TPMA 3NFZA 3CCRZ 3VTNA 3L89M 2JIOA 2KMSA 1I50I 3HOYI 1QVGY 3ZLDA 3S16I 3NH8A 4BY7I 3CCU1 5FO8C 1HFHA 2RIQA 3MZKB 2YU9I 1X0TA 4X6AI 5AN9F 1S721 2XWJI 2Q4ZA 2GTHA 1TWCI 1VQOZ 5A2Qb 2JIQA 3IFUA 3WSYA 3I561 1NJI2 5HYUB 5IP9I 1KD11 3CQZI 1TWHI 1M1K1 2ZYCA 3F3FC 1UOTP 2RKZA 3I551 5D1OA 5A2Qf 4A3JI 1FDIA 2QLVB 3CMAZ 3CCVZ 1VLAA 3OEDC 4MSLA 2VPXA 1SIWA 1Q862 4NBEA 4IGDA 4DGLA 4AYMA 1KRLA 2HF1A 1Z92B 1E88A 2CKUA 4ONTD 5HYPA 4E2ZA 4F4OC 3CCUZ 3I07A 2Y8SA 4BBSI 1WW9A 2NVTI 1ZJKA 4A3MI 1VQN1 4MUCA 3H0GI 1USPB 3HOUI 2OOXB 1WZNA 3I56Z 1SFOI 2WIIC 3P5JB 1NJI1 3M4OI 1K9M2 2J6AA 3GTLI 1HFIA 3CPWY 3NDIA 1VQ71 5HYTB 4AYBA 3RZDI 1VQK1 3CC7Z 4NBCA 4EWCA 4HGZA 1OJWA 3KIFA 2GTIA 2QR1B 3D2LA 1Q861 1OK2A 4NBBA 1LQLA 3F3PC 1USPA 2WB1A 1I3QI 1YUKA 3S2DI 3INBC 2P28A 1Z03A 1VQ9Z 2LIYA 4K12A 3ESWA 2QREB 3F6KA 2O39C 3GTMS 3S1QI 2IZ4A 1C1ZA 3VWOA 1RO2A 1E5GA 2WAQA 5C44I 3S1NI 2RLQA 3CCE1 4RV9A 1I6HI 2G2KA 1KQSY 2R7ZI 2JA5I 2H85A 3TDHB 1Q822 2OTJZ 4RVDA 4C16A 3NH4A 1KC82 3VMHA 2ZAEB 4E2YA 2QKDA 3GTOI 4PO7A 5IP7I 3J7A4 1M902 1AA6A 4E2WA 2MCZA 1OK1A 2G7IA 2R93I 3ERBA 4A3EI 4A3KI 1YHQZ 2UWNA 4MRIA 3SW0X 3TE5B 3J81f 1VQ6Z 3NFPI 1MD7A 3ZD1A 4DK1A 1Y1VS 1JJ2Z 4BY1I 2V8IA 3CCJZ 1W2BZ 3QWUA 3NJAA 5D1PA 3D6WA 5D1OB 3I4MI 1VQNZ 2R92I 1G4GA 2W80A 1YJN1 4HH4A 3GTPI 4BWCA 3CCS1 3CCL1 1HCCA 3CC41 3GTGI 3CME1 1WJ2A 1Q821 2PK7A 3CD61 2AYDA 2NAPA 1OJYA 3FGRA 2VUGA 1YIT1 4B2SA 5I0QB 5HZPB 2NVYI 1X3WA 2E7ZA 3MZLB 2RPRA 1S7MA 4RVGA 1H03P 5CM2M 1YJWZ 1M901 4XX2A 2LEXA 5FLXf 4NBDA 1YJ91 2B63I 3KXVA 1YUAA 5T67A 4S1TA 2Y8RA 2OZKA 2EGTA 3CALA 4Y52I 1TWFI 3OW2Z 4Y7NI 2R6MA 3M7PA 4DQYB 3T4NB 4QTUA 1OJVA 3G711 1PPQA 4N7EA 3CCSZ 2O4HA 3JAMf 3WSXA 3FQQA 1N8R2 3G6E1 1TWGI 3CC4Z 4E32A 3CMEZ 2KRIA 3Q87A 2JA7I 3S15I 2EHFA 1S72Z 3MQLA 3S1MI 5IT9f 1YITZ 1PFTA 1ZH1A 3GXEA 1QF8A 1RNIA 1VVCA 2EC3A 3NH5A 4CSYA 3G4S1 3GOVA 2M48A 3FQMA 3GTJI 3I55Z 1QVFZ 2OTL1 3GTQI 2JIRA 3HKZA 2P3YA 1OK9A 3EJHA 1TPNA 1E8BA 4HGYA 2GU2A 1FDOA 1WCMI 2YADA 4MD7A 5LL6f 3CC21 3CCM1 4NBFA 1ZB9A 2ERJA 1YIJ1 2RT9A 2IV2X 3G6EZ 1N8R1 2JA8I 1GHQB 3R62A 2VF1A 4YNXA 1ELVA 4LOTA 1P9NA 2I2LA 1FBRA 1RO0A 1VQ41 1RQFA 2CG6A 2LFUA 1QUBA 3IX0A 1VQL1 3J80f 4A3DI 2V45A 4FXGG 1K9M1 4MH4A 1YI21 4NB8A 4E2XA 1VQ7Z 1Q3XA 4A3CI 1G4FA 1VQKZ 3BG1B 3O8EB 2E9HA 4MXUA 3TVJA 4ZH1D 1RLHA 1L1OC 1R9TI 2F4OA 3S17I 3OXUD 2M6NA 2RKYA 1Y8CA 1VQ51 3VMIA 3PO2I 2CG7A 3J81b 2RLPA 3CCMZ 1GKNA 2V8EA 2A55A 3S1RI 2JNYA 1Z02A 2JS4A 2KI7B 1O9AA 2YBYA 1CKLA 1W2BY 3EEDA 5DN4A 2V8JA 4NH1C 4JHSA 2F4MA 3GTMI 5DN5A 3CCEZ 1Q16A 2QRDB 1VQLZ 1GPZA 1Q812 1VQ81 2RHBA 1M1K2 2RBLA 1TWAI 3LUSA 2OOYB 3CCQ1 2RL0A 1N2FA 1WIIA 2K5RA 3CMA1 3D9XA 3CXCZ 2MCYA 3CCV1 3VMGA 4BXXI 3FGTA 1KC81 4WJG2 2BJOA 4NBAA 4A5WB 3MONA 5FLXb 2QA41 1VQ5Z 2DE5A 4A93I 1SS2A 3S2HI 2HU9A 3H3VJ 3T5OA 2E2JI 1TPGA 3HOVI 1NP6A 3OW2Y 1QVGZ 2Y0SA 2JRAA 2B5ID 3PO3S 1QGBA 3M3YI 2W03A 5T6BA 5C4XI 3JAMb 2YRAA 3KZJA 4NFRA 1Y1VI 2KPIA 2V8KA 4A3FI 4AYIA 1VQ8Z 1Q811 2E2HI 4E31A 1YJNZ 5IT9b 1QO6A 1RLYA 3U50C 3CCLZ 4AYEA 2PMZA 1K732 3CCQZ 4NB9A 4TNUA 1LY2A 2Y8TA 3RZOI 1GKGA 3CC71 3CD6Z 2BZMA 2JIPA 2XWBF 2W81A 1Y1WI 4RS4A 3K7AI 2NVXI 2QA4Z 4E33A 3IF8A 1QVFY 3EERA 4YIZA 4BBRI 2NVQI 3IU3I 3CI0J 1Z01A 2QY0A 4LOSA 2X2ZA 4CL1A 3RJ3D 1VVDA 4A3GI 1YJ9Z 2K3RA 4RVHA 1VQ91 2O53A 2W04A 1SRZA 3HOWI 1VQM1 4A3II 3I4NI 3PO3I 1JWHC 2QEX1 4NBHA 3G71Z 1RO4A 2JA6I 2AKLA 2JUBA 3HOZI 2XRDA 1K731 2VUMI 3J80b 2OTJ1 3CPWZ 3K3TA 4KKDA 4A3LI 3GCFA 3GKQA 4PZ5A 4MONA 1Q7Y2 4NOZA 3G4SZ 1U5MA 5JPMG 2JMOA 4MD8A 1ML8A 1VQP1 3ZD2A 5C4JI 2OTLZ 4AYDA 2VPYA 2E2II 2LOJA 4APLA 4NBGA 1K8A2 1YHQ1 2I3CA 3BG0B 3HOXI 3OP8A 1VQ61 2XRBA 1VQMZ 4B2RA 1H2QP 1QYPA 3GTKI 3CCR1 2QEXZ 3CCJ1 2IZ3A 3ZLEA 3KIHA 3VB9A 2JR6A 3CC2Z 3IR7A 4RVFA 2PM9A
chains in the Genus database with same CATH topology
1YIJZ 4J38B 2JGXA 4DJZA 1JJ2Y 2DE7A 1H2PP 1NWVA 3S14I 4A3BI 1ZB8A 1KQSZ 1MD8A 4MD9A 1VQO1 2QRCB 1VQ4Z 1NUIA 3NDJA 1DL6A 2XQWC 1K83I 5T64A 3ZRZA 2Q51A 1TFIA 1KD12 1H04P 1Q7Y1 1OK3A 4QTTA 3CXCY 1YI2Z 2DE6A 1VQPZ 5C3EI 1YJW1 2JGWA 1X3ZA 1K8A1 3FKII 4E30A 5FLMI 1TPMA 3NFZA 3CCRZ 3VTNA 3L89M 2KMSA 1I50I 3HOYI 1QVGY 3S16I 3NH8A 4BY7I 3CCU1 5FO8C 1HFHA 2RIQA 3MZKB 2YU9I 1X0TA 4X6AI 5AN9F 1S721 2XWJI 2Q4ZA 2GTHA 1TWCI 1VQOZ 5A2Qb 3IFUA 3I561 1NJI2 5HYUB 5IP9I 1KD11 3CQZI 1TWHI 1M1K1 3F3FC 1UOTP 2RKZA 3I551 5D1OA 5A2Qf 4A3JI 2QLVB 3CMAZ 3CCVZ 1VLAA 3OEDC 1Q862 4NBEA 4IGDA 4DGLA 4AYMA 1KRLA 2HF1A 1Z92B 1E88A 2CKUA 4ONTD 5HYPA 4E2ZA 4F4OC 3CCUZ 3I07A 4BBSI 1WW9A 2NVTI 1ZJKA 4A3MI 1VQN1 4MUCA 3H0GI 1USPB 3HOUI 2OOXB 3I56Z 1SFOI 2WIIC 3P5JB 1NJI1 3M4OI 1K9M2 2J6AA 3GTLI 1HFIA 3CPWY 3NDIA 1VQ71 5HYTB 4AYBA 3RZDI 1VQK1 3CC7Z 4NBCA 4EWCA 4HGZA 1OJWA 3KIFA 2GTIA 2QR1B 1Q861 1OK2A 4NBBA 1LQLA 3F3PC 1USPA 2WB1A 1I3QI 1YUKA 3S2DI 3INBC 2P28A 1Z03A 1VQ9Z 2LIYA 4K12A 3ESWA 2QREB 2O39C 3GTMS 3S1QI 2IZ4A 1C1ZA 1RO2A 1E5GA 2WAQA 5C44I 3S1NI 2RLQA 3CCE1 4RV9A 1I6HI 2G2KA 1KQSY 2R7ZI 2JA5I 2H85A 3TDHB 1Q822 2OTJZ 4RVDA 4C16A 3NH4A 1KC82 3VMHA 2ZAEB 4E2YA 2QKDA 3GTOI 5IP7I 3J7A4 1M902 4E2WA 2MCZA 1OK1A 2G7IA 2R93I 3ERBA 4A3EI 4A3KI 1YHQZ 2UWNA 4MRIA 3SW0X 3TE5B 3J81f 1VQ6Z 3NFPI 1MD7A 3ZD1A 4DK1A 1Y1VS 1JJ2Z 4BY1I 2V8IA 3CCJZ 1W2BZ 3QWUA 5D1PA 3D6WA 5D1OB 3I4MI 1VQNZ 2R92I 1G4GA 2W80A 1YJN1 4HH4A 3GTPI 3CCS1 3CCL1 1HCCA 3CC41 3GTGI 3CME1 1Q821 2PK7A 3CD61 1OJYA 1YIT1 2VUGA 4B2SA 5I0QB 5HZPB 2NVYI 1X3WA 3MZLB 2RPRA 1S7MA 4RVGA 1H03P 5CM2M 1YJWZ 1M901 4XX2A 5FLXf 4NBDA 1YJ91 2B63I 3KXVA 1YUAA 5T67A 4S1TA 4Y52I 2OZKA 2EGTA 3CALA 1TWFI 3OW2Z 4Y7NI 2R6MA 3M7PA 4DQYB 3T4NB 4QTUA 1OJVA 3G711 1PPQA 3CCSZ 2O4HA 3JAMf 3FQQA 1N8R2 3G6E1 1TWGI 3CC4Z 4E32A 3CMEZ 2KRIA 3Q87A 2JA7I 3S15I 2EHFA 1S72Z 3MQLA 3S1MI 5IT9f 1YITZ 1PFTA 1ZH1A 3GXEA 1QF8A 1RNIA 1VVCA 2EC3A 3NH5A 4CSYA 3G4S1 3GOVA 2M48A 3FQMA 3GTJI 3I55Z 1QVFZ 2OTL1 3GTQI 3HKZA 2P3YA 1OK9A 3EJHA 1TPNA 1E8BA 4HGYA 2GU2A 1WCMI 2YADA 4MD7A 5LL6f 3CC21 3CCM1 4NBFA 1ZB9A 2ERJA 1YIJ1 2RT9A 3G6EZ 1N8R1 2JA8I 1GHQB 3R62A 2VF1A 4YNXA 1ELVA 4LOTA 1P9NA 1RO0A 1FBRA 1VQ41 1RQFA 2CG6A 2LFUA 1QUBA 3IX0A 1VQL1 3J80f 4A3DI 4FXGG 1K9M1 4MH4A 1YI21 4NB8A 4E2XA 1VQ7Z 1Q3XA 4A3CI 1G4FA 1VQKZ 3BG1B 3O8EB 2E9HA 4MXUA 3TVJA 4ZH1D 1L1OC 1R9TI 2F4OA 3S17I 3OXUD 2M6NA 2RKYA 1VQ51 3VMIA 3PO2I 2CG7A 3J81b 2RLPA 3CCMZ 1GKNA 2V8EA 2A55A 3S1RI 1Z02A 2JNYA 2JS4A 2KI7B 1O9AA 2YBYA 1CKLA 1W2BY 3EEDA 2V8JA 4NH1C 4JHSA 2F4MA 3GTMI 3CCEZ 2QRDB 1VQLZ 1GPZA 1Q812 1VQ81 2RHBA 1M1K2 2RBLA 1TWAI 3LUSA 2OOYB 3CCQ1 2RL0A 1N2FA 1WIIA 2K5RA 3CMA1 3D9XA 3CXCZ 2MCYA 3CCV1 3VMGA 4BXXI 1KC81 4WJG2 2BJOA 4NBAA 4A5WB 3MONA 5FLXb 2QA41 1VQ5Z 2DE5A 4A93I 1SS2A 3S2HI 2HU9A 3H3VJ 3T5OA 2E2JI 1TPGA 3HOVI 1NP6A 3OW2Y 1QVGZ 2Y0SA 2JRAA 2B5ID 3PO3S 1QGBA 3M3YI 2W03A 5T6BA 5C4XI 3JAMb 2YRAA 3KZJA 4NFRA 1Y1VI 2KPIA 2V8KA 4A3FI 4AYIA 1VQ8Z 1Q811 2E2HI 4E31A 1YJNZ 5IT9b 1QO6A 1RLYA 3U50C 3CCLZ 4AYEA 2PMZA 1K732 3CCQZ 4NB9A 4TNUA 1LY2A 3RZOI 1GKGA 3CC71 3CD6Z 2BZMA 2XWBF 2W81A 1Y1WI 4RS4A 3K7AI 2NVXI 2QA4Z 4E33A 3IF8A 1QVFY 3EERA 4BBRI 2NVQI 3IU3I 1Z01A 2QY0A 4LOSA 4CL1A 3RJ3D 1VVDA 4A3GI 1YJ9Z 2K3RA 4RVHA 1VQ91 2O53A 2W04A 1SRZA 3HOWI 1VQM1 4A3II 3I4NI 3PO3I 1JWHC 2QEX1 4NBHA 3G71Z 1RO4A 2JA6I 2AKLA 2JUBA 3HOZI 2XRDA 1K731 2VUMI 3J80b 2OTJ1 3CPWZ 4KKDA 4A3LI 3GCFA 3GKQA 4PZ5A 4MONA 1Q7Y2 4NOZA 3G4SZ 1U5MA 5JPMG 2JMOA 4MD8A 1ML8A 1VQP1 3ZD2A 5C4JI 2OTLZ 4AYDA 2E2II 2LOJA 4NBGA 1K8A2 1YHQ1 2I3CA 3BG0B 3HOXI 3OP8A 1VQ61 2XRBA 1VQMZ 4B2RA 1H2QP 1QYPA 3GTKI 3CCR1 2QEXZ 3CCJ1 2IZ3A 3KIHA 3VB9A 2JR6A 3CC2Z 4RVFA 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJG 2;  4J38 B;  2JGX A;  4DJZ A;  1OJW A;  4A5W B;  1H2P P;  1OK2 A;  1NWV A;  1SS2 A;  2KRI A;  1MD8 A;  2EHF A;  3MQL A;  3T5O A;  1TPG A;  3INB C;  3GXE A;  1VVC A;  2XQW C;  4K12 A;  3ZRZ A;  2EC3 A;  2JRA A;  1H04 P;  2B5I D;  1QGB A;  2O39 C;  1OK3 A;  4CSY A;  2IZ4 A;  1C1Z A;  3GOV A;  1E5G A;  2YRA A;  2RLQ A;  3KZJ A;  2JGW A;  4AYI A;  1OK9 A;  3EJH A;  1QO6 A;  1TPM A;  1TPN A;  1E8B A;  4AYE A;  3L89 M;  1LY2 A;  2KMS A;  1GKG A;  4C16 A;  2BZM A;  2ERJ A;  2XWB F;  2W81 A;  5FO8 C;  1HFH A;  1GHQ B;  3R62 A;  3IU3 I;  2QY0 A;  4LOS A;  2XWJ I;  3RJ3 D;  1VVD A;  4YNX A;  1ELV A;  2MCZ A;  1OK1 A;  2G7I A;  4LOT A;  3ERB A;  1FBR A;  2CG6 A;  1QUB A;  2UWN A;  3IX0 A;  3SW0 X;  5HYU B;  1SRZ A;  3NFP I;  4FXG G;  1MD7 A;  3ZD1 A;  1UOT P;  2RKZ A;  1Q3X A;  1G4F A;  3O8E B;  3OED C;  3TVJ A;  4ZH1 D;  1G4G A;  2W80 A;  3OXU D;  2RKY A;  2XRD A;  1HCC A;  2CG7 A;  4IGD A;  2RLP A;  4AYM A;  1Z92 B;  1GKN A;  2V8E A;  2A55 A;  4KKD A;  1E88 A;  2CKU A;  4ONT D;  5HYP A;  1OJY A;  4B2S A;  4F4O C;  1O9A A;  2YBY A;  4PZ5 A;  5I0Q B;  1CKL A;  5HZP B;  1ZJK A;  1U5M A;  5JPM G;  4MUC A;  4JHS A;  1H03 P;  3ZD2 A;  4AYD A;  2LOJ A;  1GPZ A;  3KXV A;  2WII C;  3OP8 A;  2XRB A;  4B2R A;  1H2Q P;  1HFI A;  3CAL A;  2RL0 A;  5HYT B;  2IZ3 A;  3M7P A;  2MCY A;  1OJV A;  1PPQ A; 
#chains in the Genus database with same CATH topology
 1YIJ Z;  4J38 B;  2JGX A;  4DJZ A;  1JJ2 Y;  2DE7 A;  1H2P P;  1NWV A;  3S14 I;  4A3B I;  1ZB8 A;  1KQS Z;  1MD8 A;  4MD9 A;  1VQO 1;  2JIM A;  2QRC B;  2VPW A;  1VQ4 Z;  1NUI A;  3NDJ A;  1DL6 A;  2XQW C;  1K83 I;  2VPZ A;  5T64 A;  3ZRZ A;  2Q51 A;  1TFI A;  1KD1 2;  1H04 P;  1Q7Y 1;  1OK3 A;  4QTT A;  3CXC Y;  1YI2 Z;  2DE6 A;  1VQP Z;  5C3E I;  1YJW 1;  1QXF A;  2JGW A;  1X3Z A;  1K8A 1;  3FKI I;  4E30 A;  2V3V A;  5FLM I;  1TPM A;  3NFZ A;  3CCR Z;  3VTN A;  3L89 M;  2JIO A;  2KMS A;  1I50 I;  3HOY I;  1QVG Y;  3ZLD A;  3S16 I;  3NH8 A;  4BY7 I;  3CCU 1;  5FO8 C;  1HFH A;  2RIQ A;  3MZK B;  2YU9 I;  1X0T A;  4X6A I;  5AN9 F;  1S72 1;  2XWJ I;  2Q4Z A;  2GTH A;  1TWC I;  1VQO Z;  5A2Q b;  2JIQ A;  3IFU A;  3WSY A;  3I56 1;  1NJI 2;  5HYU B;  5IP9 I;  1KD1 1;  3CQZ I;  1TWH I;  1M1K 1;  2ZYC A;  3F3F C;  1UOT P;  2RKZ A;  3I55 1;  5D1O A;  5A2Q f;  4A3J I;  1FDI A;  2QLV B;  3CMA Z;  3CCV Z;  1VLA A;  3OED C;  4MSL A;  2VPX A;  1SIW A;  1Q86 2;  4NBE A;  4IGD A;  4DGL A;  4AYM A;  1KRL A;  2HF1 A;  1Z92 B;  1E88 A;  2CKU A;  4ONT D;  5HYP A;  4E2Z A;  4F4O C;  3CCU Z;  3I07 A;  2Y8S A;  4BBS I;  1WW9 A;  2NVT I;  1ZJK A;  4A3M I;  1VQN 1;  4MUC A;  3H0G I;  1USP B;  3HOU I;  2OOX B;  1WZN A;  3I56 Z;  1SFO I;  2WII C;  3P5J B;  1NJI 1;  3M4O I;  1K9M 2;  2J6A A;  3GTL I;  1HFI A;  3CPW Y;  3NDI A;  1VQ7 1;  5HYT B;  4AYB A;  3RZD I;  1VQK 1;  3CC7 Z;  4NBC A;  4EWC A;  4HGZ A;  1OJW A;  3KIF A;  2GTI A;  2QR1 B;  3D2L A;  1Q86 1;  1OK2 A;  4NBB A;  1LQL A;  3F3P C;  1USP A;  2WB1 A;  1I3Q I;  1YUK A;  3S2D I;  3INB C;  2P28 A;  1Z03 A;  1VQ9 Z;  2LIY A;  4K12 A;  3ESW A;  2QRE B;  3F6K A;  2O39 C;  3GTM S;  3S1Q I;  2IZ4 A;  1C1Z A;  3VWO A;  1RO2 A;  1E5G A;  2WAQ A;  5C44 I;  3S1N I;  2RLQ A;  3CCE 1;  4RV9 A;  1I6H I;  2G2K A;  1KQS Y;  2R7Z I;  2JA5 I;  2H85 A;  3TDH B;  1Q82 2;  2OTJ Z;  4RVD A;  4C16 A;  3NH4 A;  1KC8 2;  3VMH A;  2ZAE B;  4E2Y A;  2QKD A;  3GTO I;  4PO7 A;  5IP7 I;  3J7A 4;  1M90 2;  1AA6 A;  4E2W A;  2MCZ A;  1OK1 A;  2G7I A;  2R93 I;  3ERB A;  4A3E I;  4A3K I;  1YHQ Z;  2UWN A;  4MRI A;  3SW0 X;  3TE5 B;  3J81 f;  1VQ6 Z;  3NFP I;  1MD7 A;  3ZD1 A;  4DK1 A;  1Y1V S;  1JJ2 Z;  4BY1 I;  2V8I A;  3CCJ Z;  1W2B Z;  3QWU A;  3NJA A;  5D1P A;  3D6W A;  5D1O B;  3I4M I;  1VQN Z;  2R92 I;  1G4G A;  2W80 A;  1YJN 1;  4HH4 A;  3GTP I;  4BWC A;  3CCS 1;  3CCL 1;  1HCC A;  3CC4 1;  3GTG I;  3CME 1;  1WJ2 A;  1Q82 1;  2PK7 A;  3CD6 1;  2AYD A;  2NAP A;  1OJY A;  3FGR A;  2VUG A;  1YIT 1;  4B2S A;  5I0Q B;  5HZP B;  2NVY I;  1X3W A;  2E7Z A;  3MZL B;  2RPR A;  1S7M A;  4RVG A;  1H03 P;  5CM2 M;  1YJW Z;  1M90 1;  4XX2 A;  2LEX A;  5FLX f;  4NBD A;  1YJ9 1;  2B63 I;  3KXV A;  1YUA A;  5T67 A;  4S1T A;  2Y8R A;  2OZK A;  2EGT A;  3CAL A;  4Y52 I;  1TWF I;  3OW2 Z;  4Y7N I;  2R6M A;  3M7P A;  4DQY B;  3T4N B;  4QTU A;  1OJV A;  3G71 1;  1PPQ A;  4N7E A;  3CCS Z;  2O4H A;  3JAM f;  3WSX A;  3FQQ A;  1N8R 2;  3G6E 1;  1TWG I;  3CC4 Z;  4E32 A;  3CME Z;  2KRI A;  3Q87 A;  2JA7 I;  3S15 I;  2EHF A;  1S72 Z;  3MQL A;  3S1M I;  5IT9 f;  1YIT Z;  1PFT A;  1ZH1 A;  3GXE A;  1QF8 A;  1RNI A;  1VVC A;  2EC3 A;  3NH5 A;  4CSY A;  3G4S 1;  3GOV A;  2M48 A;  3FQM A;  3GTJ I;  3I55 Z;  1QVF Z;  2OTL 1;  3GTQ I;  2JIR A;  3HKZ A;  2P3Y A;  1OK9 A;  3EJH A;  1TPN A;  1E8B A;  4HGY A;  2GU2 A;  1FDO A;  1WCM I;  2YAD A;  4MD7 A;  5LL6 f;  3CC2 1;  3CCM 1;  4NBF A;  1ZB9 A;  2ERJ A;  1YIJ 1;  2RT9 A;  2IV2 X;  3G6E Z;  1N8R 1;  2JA8 I;  1GHQ B;  3R62 A;  2VF1 A;  4YNX A;  1ELV A;  4LOT A;  1P9N A;  2I2L A;  1FBR A;  1RO0 A;  1VQ4 1;  1RQF A;  2CG6 A;  2LFU A;  1QUB A;  3IX0 A;  1VQL 1;  3J80 f;  4A3D I;  2V45 A;  4FXG G;  1K9M 1;  4MH4 A;  1YI2 1;  4NB8 A;  4E2X A;  1VQ7 Z;  1Q3X A;  4A3C I;  1G4F A;  1VQK Z;  3BG1 B;  3O8E B;  2E9H A;  4MXU A;  3TVJ A;  4ZH1 D;  1RLH A;  1L1O C;  1R9T I;  2F4O A;  3S17 I;  3OXU D;  2M6N A;  2RKY A;  1Y8C A;  1VQ5 1;  3VMI A;  3PO2 I;  2CG7 A;  3J81 b;  2RLP A;  3CCM Z;  1GKN A;  2V8E A;  2A55 A;  3S1R I;  2JNY A;  1Z02 A;  2JS4 A;  2KI7 B;  1O9A A;  2YBY A;  1CKL A;  1W2B Y;  3EED A;  5DN4 A;  2V8J A;  4NH1 C;  4JHS A;  2F4M A;  3GTM I;  5DN5 A;  3CCE Z;  1Q16 A;  2QRD B;  1VQL Z;  1GPZ A;  1Q81 2;  1VQ8 1;  2RHB A;  1M1K 2;  2RBL A;  1TWA I;  3LUS A;  2OOY B;  3CCQ 1;  2RL0 A;  1N2F A;  1WII A;  2K5R A;  3CMA 1;  3D9X A;  3CXC Z;  2MCY A;  3CCV 1;  3VMG A;  4BXX I;  3FGT A;  1KC8 1;  4WJG 2;  2BJO A;  4NBA A;  4A5W B;  3MON A;  5FLX b;  2QA4 1;  1VQ5 Z;  2DE5 A;  4A93 I;  1SS2 A;  3S2H I;  2HU9 A;  3H3V J;  3T5O A;  2E2J I;  1TPG A;  3HOV I;  1NP6 A;  3OW2 Y;  1QVG Z;  2Y0S A;  2JRA A;  2B5I D;  3PO3 S;  1QGB A;  3M3Y I;  2W03 A;  5T6B A;  5C4X I;  3JAM b;  2YRA A;  3KZJ A;  4NFR A;  1Y1V I;  2KPI A;  2V8K A;  4A3F I;  4AYI A;  1VQ8 Z;  1Q81 1;  2E2H I;  4E31 A;  1YJN Z;  5IT9 b;  1QO6 A;  1RLY A;  3U50 C;  3CCL Z;  4AYE A;  2PMZ A;  1K73 2;  3CCQ Z;  4NB9 A;  4TNU A;  1LY2 A;  2Y8T A;  3RZO I;  1GKG A;  3CC7 1;  3CD6 Z;  2BZM A;  2JIP A;  2XWB F;  2W81 A;  1Y1W I;  4RS4 A;  3K7A I;  2NVX I;  2QA4 Z;  4E33 A;  3IF8 A;  1QVF Y;  3EER A;  4YIZ A;  4BBR I;  2NVQ I;  3IU3 I;  3CI0 J;  1Z01 A;  2QY0 A;  4LOS A;  2X2Z A;  4CL1 A;  3RJ3 D;  1VVD A;  4A3G I;  1YJ9 Z;  2K3R A;  4RVH A;  1VQ9 1;  2O53 A;  2W04 A;  1SRZ A;  3HOW I;  1VQM 1;  4A3I I;  3I4N I;  3PO3 I;  1JWH C;  2QEX 1;  4NBH A;  3G71 Z;  1RO4 A;  2JA6 I;  2AKL A;  2JUB A;  3HOZ I;  2XRD A;  1K73 1;  2VUM I;  3J80 b;  2OTJ 1;  3CPW Z;  3K3T A;  4KKD A;  4A3L I;  3GCF A;  3GKQ A;  4PZ5 A;  4MON A;  1Q7Y 2;  4NOZ A;  3G4S Z;  1U5M A;  5JPM G;  2JMO A;  4MD8 A;  1ML8 A;  1VQP 1;  3ZD2 A;  5C4J I;  2OTL Z;  4AYD A;  2VPY A;  2E2I I;  2LOJ A;  4APL A;  4NBG A;  1K8A 2;  1YHQ 1;  2I3C A;  3BG0 B;  3HOX I;  3OP8 A;  1VQ6 1;  2XRB A;  1VQM Z;  4B2R A;  1H2Q P;  1QYP A;  3GTK I;  3CCR 1;  2QEX Z;  3CCJ 1;  2IZ3 A;  3ZLE A;  3KIH A;  3VB9 A;  2JR6 A;  3CC2 Z;  3IR7 A;  4RVF A;  2PM9 A; 
#chains in the Genus database with same CATH homology
 1YIJ Z;  4J38 B;  2JGX A;  4DJZ A;  1JJ2 Y;  2DE7 A;  1H2P P;  1NWV A;  3S14 I;  4A3B I;  1ZB8 A;  1KQS Z;  1MD8 A;  4MD9 A;  1VQO 1;  2QRC B;  1VQ4 Z;  1NUI A;  3NDJ A;  1DL6 A;  2XQW C;  1K83 I;  5T64 A;  3ZRZ A;  2Q51 A;  1TFI A;  1KD1 2;  1H04 P;  1Q7Y 1;  1OK3 A;  4QTT A;  3CXC Y;  1YI2 Z;  2DE6 A;  1VQP Z;  5C3E I;  1YJW 1;  2JGW A;  1X3Z A;  1K8A 1;  3FKI I;  4E30 A;  5FLM I;  1TPM A;  3NFZ A;  3CCR Z;  3VTN A;  3L89 M;  2KMS A;  1I50 I;  3HOY I;  1QVG Y;  3S16 I;  3NH8 A;  4BY7 I;  3CCU 1;  5FO8 C;  1HFH A;  2RIQ A;  3MZK B;  2YU9 I;  1X0T A;  4X6A I;  5AN9 F;  1S72 1;  2XWJ I;  2Q4Z A;  2GTH A;  1TWC I;  1VQO Z;  5A2Q b;  3IFU A;  3I56 1;  1NJI 2;  5HYU B;  5IP9 I;  1KD1 1;  3CQZ I;  1TWH I;  1M1K 1;  3F3F C;  1UOT P;  2RKZ A;  3I55 1;  5D1O A;  5A2Q f;  4A3J I;  2QLV B;  3CMA Z;  3CCV Z;  1VLA A;  3OED C;  1Q86 2;  4NBE A;  4IGD A;  4DGL A;  4AYM A;  1KRL A;  2HF1 A;  1Z92 B;  1E88 A;  2CKU A;  4ONT D;  5HYP A;  4E2Z A;  4F4O C;  3CCU Z;  3I07 A;  4BBS I;  1WW9 A;  2NVT I;  1ZJK A;  4A3M I;  1VQN 1;  4MUC A;  3H0G I;  1USP B;  3HOU I;  2OOX B;  3I56 Z;  1SFO I;  2WII C;  3P5J B;  1NJI 1;  3M4O I;  1K9M 2;  2J6A A;  3GTL I;  1HFI A;  3CPW Y;  3NDI A;  1VQ7 1;  5HYT B;  4AYB A;  3RZD I;  1VQK 1;  3CC7 Z;  4NBC A;  4EWC A;  4HGZ A;  1OJW A;  3KIF A;  2GTI A;  2QR1 B;  1Q86 1;  1OK2 A;  4NBB A;  1LQL A;  3F3P C;  1USP A;  2WB1 A;  1I3Q I;  1YUK A;  3S2D I;  3INB C;  2P28 A;  1Z03 A;  1VQ9 Z;  2LIY A;  4K12 A;  3ESW A;  2QRE B;  2O39 C;  3GTM S;  3S1Q I;  2IZ4 A;  1C1Z A;  1RO2 A;  1E5G A;  2WAQ A;  5C44 I;  3S1N I;  2RLQ A;  3CCE 1;  4RV9 A;  1I6H I;  2G2K A;  1KQS Y;  2R7Z I;  2JA5 I;  2H85 A;  3TDH B;  1Q82 2;  2OTJ Z;  4RVD A;  4C16 A;  3NH4 A;  1KC8 2;  3VMH A;  2ZAE B;  4E2Y A;  2QKD A;  3GTO I;  5IP7 I;  3J7A 4;  1M90 2;  4E2W A;  2MCZ A;  1OK1 A;  2G7I A;  2R93 I;  3ERB A;  4A3E I;  4A3K I;  1YHQ Z;  2UWN A;  4MRI A;  3SW0 X;  3TE5 B;  3J81 f;  1VQ6 Z;  3NFP I;  1MD7 A;  3ZD1 A;  4DK1 A;  1Y1V S;  1JJ2 Z;  4BY1 I;  2V8I A;  3CCJ Z;  1W2B Z;  3QWU A;  5D1P A;  3D6W A;  5D1O B;  3I4M I;  1VQN Z;  2R92 I;  1G4G A;  2W80 A;  1YJN 1;  4HH4 A;  3GTP I;  3CCS 1;  3CCL 1;  1HCC A;  3CC4 1;  3GTG I;  3CME 1;  1Q82 1;  2PK7 A;  3CD6 1;  1OJY A;  1YIT 1;  2VUG A;  4B2S A;  5I0Q B;  5HZP B;  2NVY I;  1X3W A;  3MZL B;  2RPR A;  1S7M A;  4RVG A;  1H03 P;  5CM2 M;  1YJW Z;  1M90 1;  4XX2 A;  5FLX f;  4NBD A;  1YJ9 1;  2B63 I;  3KXV A;  1YUA A;  5T67 A;  4S1T A;  4Y52 I;  2OZK A;  2EGT A;  3CAL A;  1TWF I;  3OW2 Z;  4Y7N I;  2R6M A;  3M7P A;  4DQY B;  3T4N B;  4QTU A;  1OJV A;  3G71 1;  1PPQ A;  3CCS Z;  2O4H A;  3JAM f;  3FQQ A;  1N8R 2;  3G6E 1;  1TWG I;  3CC4 Z;  4E32 A;  3CME Z;  2KRI A;  3Q87 A;  2JA7 I;  3S15 I;  2EHF A;  1S72 Z;  3MQL A;  3S1M I;  5IT9 f;  1YIT Z;  1PFT A;  1ZH1 A;  3GXE A;  1QF8 A;  1RNI A;  1VVC A;  2EC3 A;  3NH5 A;  4CSY A;  3G4S 1;  3GOV A;  2M48 A;  3FQM A;  3GTJ I;  3I55 Z;  1QVF Z;  2OTL 1;  3GTQ I;  3HKZ A;  2P3Y A;  1OK9 A;  3EJH A;  1TPN A;  1E8B A;  4HGY A;  2GU2 A;  1WCM I;  2YAD A;  4MD7 A;  5LL6 f;  3CC2 1;  3CCM 1;  4NBF A;  1ZB9 A;  2ERJ A;  1YIJ 1;  2RT9 A;  3G6E Z;  1N8R 1;  2JA8 I;  1GHQ B;  3R62 A;  2VF1 A;  4YNX A;  1ELV A;  4LOT A;  1P9N A;  1RO0 A;  1FBR A;  1VQ4 1;  1RQF A;  2CG6 A;  2LFU A;  1QUB A;  3IX0 A;  1VQL 1;  3J80 f;  4A3D I;  4FXG G;  1K9M 1;  4MH4 A;  1YI2 1;  4NB8 A;  4E2X A;  1VQ7 Z;  1Q3X A;  4A3C I;  1G4F A;  1VQK Z;  3BG1 B;  3O8E B;  2E9H A;  4MXU A;  3TVJ A;  4ZH1 D;  1L1O C;  1R9T I;  2F4O A;  3S17 I;  3OXU D;  2M6N A;  2RKY A;  1VQ5 1;  3VMI A;  3PO2 I;  2CG7 A;  3J81 b;  2RLP A;  3CCM Z;  1GKN A;  2V8E A;  2A55 A;  3S1R I;  1Z02 A;  2JNY A;  2JS4 A;  2KI7 B;  1O9A A;  2YBY A;  1CKL A;  1W2B Y;  3EED A;  2V8J A;  4NH1 C;  4JHS A;  2F4M A;  3GTM I;  3CCE Z;  2QRD B;  1VQL Z;  1GPZ A;  1Q81 2;  1VQ8 1;  2RHB A;  1M1K 2;  2RBL A;  1TWA I;  3LUS A;  2OOY B;  3CCQ 1;  2RL0 A;  1N2F A;  1WII A;  2K5R A;  3CMA 1;  3D9X A;  3CXC Z;  2MCY A;  3CCV 1;  3VMG A;  4BXX I;  1KC8 1;  4WJG 2;  2BJO A;  4NBA A;  4A5W B;  3MON A;  5FLX b;  2QA4 1;  1VQ5 Z;  2DE5 A;  4A93 I;  1SS2 A;  3S2H I;  2HU9 A;  3H3V J;  3T5O A;  2E2J I;  1TPG A;  3HOV I;  1NP6 A;  3OW2 Y;  1QVG Z;  2Y0S A;  2JRA A;  2B5I D;  3PO3 S;  1QGB A;  3M3Y I;  2W03 A;  5T6B A;  5C4X I;  3JAM b;  2YRA A;  3KZJ A;  4NFR A;  1Y1V I;  2KPI A;  2V8K A;  4A3F I;  4AYI A;  1VQ8 Z;  1Q81 1;  2E2H I;  4E31 A;  1YJN Z;  5IT9 b;  1QO6 A;  1RLY A;  3U50 C;  3CCL Z;  4AYE A;  2PMZ A;  1K73 2;  3CCQ Z;  4NB9 A;  4TNU A;  1LY2 A;  3RZO I;  1GKG A;  3CC7 1;  3CD6 Z;  2BZM A;  2XWB F;  2W81 A;  1Y1W I;  4RS4 A;  3K7A I;  2NVX I;  2QA4 Z;  4E33 A;  3IF8 A;  1QVF Y;  3EER A;  4BBR I;  2NVQ I;  3IU3 I;  1Z01 A;  2QY0 A;  4LOS A;  4CL1 A;  3RJ3 D;  1VVD A;  4A3G I;  1YJ9 Z;  2K3R A;  4RVH A;  1VQ9 1;  2O53 A;  2W04 A;  1SRZ A;  3HOW I;  1VQM 1;  4A3I I;  3I4N I;  3PO3 I;  1JWH C;  2QEX 1;  4NBH A;  3G71 Z;  1RO4 A;  2JA6 I;  2AKL A;  2JUB A;  3HOZ I;  2XRD A;  1K73 1;  2VUM I;  3J80 b;  2OTJ 1;  3CPW Z;  4KKD A;  4A3L I;  3GCF A;  3GKQ A;  4PZ5 A;  4MON A;  1Q7Y 2;  4NOZ A;  3G4S Z;  1U5M A;  5JPM G;  2JMO A;  4MD8 A;  1ML8 A;  1VQP 1;  3ZD2 A;  5C4J I;  2OTL Z;  4AYD A;  2E2I I;  2LOJ A;  4NBG A;  1K8A 2;  1YHQ 1;  2I3C A;  3BG0 B;  3HOX I;  3OP8 A;  1VQ6 1;  2XRB A;  1VQM Z;  4B2R A;  1H2Q P;  1QYP A;  3GTK I;  3CCR 1;  2QEX Z;  3CCJ 1;  2IZ3 A;  3KIH A;  3VB9 A;  2JR6 A;  3CC2 Z;  4RVF A;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...