2IZ3A

Solution structure of human beta-microseminoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Inhibitor
molecule keywords BETA-MICROSEMINOPROTEIN
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz3A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz3A02
3SW0X 4FXGG 1OK2A 4ZH1D 1G4FA 1HFHA 4WJG2 2XWJI 4ONTD 2YBYA 2RLPA 1HCCA 1TPNA 4PZ5A 2XRBA 1O9AA 1OK3A 1H2PP 1GKGA 1GHQB 2W81A 4MUCA 2RKZA 3KZJA 3INBC 1HFIA 2JRAA 1C1ZA 2CG6A 5HYTB 2W80A 4B2SA 1OK1A 1OJVA 2XWBF 2RLQA 1OJWA 2CKUA 2MCYA 4KKDA 3IU3I 4F4OC 5HYPA 2JGWA 5I0QB 3CALA 3KXVA 1SRZA 2QY0A 1H03P 4AYDA 1E5GA 2EC3A 1FBRA 2A55A 1CKLA 1QGBA 2EHFA 4IGDA 5HZPB 4K12A 1SS2A 4J38B 4A5WB 1Q3XA 1NWVA 2ERJA 1QUBA 3OEDC 1H2QP 1VVDA 3ZD2A 1MD7A 2XRDA 2CG7A 1VVCA 2IZ4A 3MQLA 2LOJA 1OJYA 2KRIA 3GXEA 1E88A 4LOTA 1QO6A 1Z92B 4CSYA 2YRAA 2UWNA 2O39C 2JGXA 2MCZA 4AYMA 2G7IA 2B5ID 1ELVA 3TVJA 1PPQA 4AYEA 3ERBA 1ZJKA 5FO8C 2XQWC 4AYIA 3RJ3D 3O8EB 3M7PA 3ZRZA 1OK9A 1H04P 3IX0A 4B2RA 2KMSA 2V8EA 4DJZA 3T5OA 1GPZA 3NFPI 3R62A 5JPMG 2IZ3A 4C16A 4JHSA 3EJHA 3L89M 1MD8A 2RL0A 3OP8A 2RKYA 3ZD1A 1LY2A 3OXUD 1TPGA 1TPMA 3GOVA 1GKNA 1UOTP 2BZMA 4YNXA 2WIIC 1E8BA 5HYUB 1G4GA 4LOSA 1U5MA
chains in the Genus database with same CATH superfamily
1ZB8A 3G4SZ 1G4FA 3P5JB 3CXCY 1W2BZ 1Q7Y2 4MH4A 1LQLA 1S72Z 1K83I 2NVXI 3K7AI 5T67A 4APLA 5C4JI 1KC81 2ZAEB 3M4OI 2XRBA 1O9AA 2Y8SA 1VLAA 3D2LA 1VQOZ 3MZLB 1TWAI 3S16I 2RPRA 4MD8A 3CCEZ 3KZJA 2HU9A 3VWOA 4A3MI 2DE7A 3INBC 2Y0SA 3NH4A 2VUMI 1QVGZ 4DGLA 2M6NA 2W03A 5HYTB 1VQP1 1K731 1OK1A 3I4MI 1OJVA 2RT9A 1SFOI 2CKUA 1Q812 2Y8TA 1YJN1 5HYPA 3FGRA 5I0QB 3KXVA 1FDIA 1VQ61 1E5GA 5DN4A 4E32A 4Y7NI 3S1NI 4A3KI 4RVFA 3CCL1 2R7ZI 2JA6I 4J38B 4AYBA 4RVHA 5D1PA 1QVFY 1H2QP 1VQ6Z 2QA4Z 3T4NB 4N7EA 2IZ4A 1WIIA 4QTUA 5T6BA 5A2Qf 1E88A 2QRDB 4LOTA 1R9TI 2E2II 2JIMA 1NJI1 1VQ41 1X0TA 5FLXf 1ZB9A 5A2Qb 3CCS1 3HOWI 2RIQA 3CCR1 1Z03A 3OW2Y 2DE6A 2F4MA 3MONA 3GTMS 1PPQA 4AYEA 1VQ4Z 3S14I 4NH1C 4NFRA 2QEXZ 2XQWC 4AYIA 3RJ3D 3GTPI 3O8EB 3ZRZA 1OK9A 2VF1A 4B2RA 4E2XA 3VTNA 4DJZA 2JR6A 2QR1B 5JPMG 2O4HA 2QKDA 3H3VJ 2YADA 4C16A 2I3CA 4NBGA 2V3VA 1AA6A 2VUGA 4EWCA 2GTHA 1QYPA 1TPMA 3GOVA 4HH4A 3CPWZ 2Q4ZA 1GKNA 3GTMI 2VPZA 2PM9A 2LIYA 3I551 1VQ8Z 1L1OC 2WIIC 1TWGI 2JNYA 5T64A 5IP7I 2M48A 1X3WA 3CCLZ 1G4GA 2JIQA 2B63I 1RLHA 4MONA 3NJAA 1U5MA 3CCM1 1NP6A 1OK2A 1VQKZ 1RQFA 3BG0B 1VQNZ 2E9HA 3M3YI 2JIPA 4WJG2 1M1K2 5CM2M 4A3DI 2Y8RA 2YBYA 3J80f 1Q822 3I4NI 1WCMI 1TPNA 2LEXA 3S1QI 2NVTI 4NB8A 1I3QI 3K3TA 4PO7A 1Y1VS 2PK7A 1PFTA 3VMHA 1H2PP 2W81A 3S1RI 4BBSI 3CCJZ 2VPWA 4BWCA 4NOZA 3ESWA 1YJW1 2BJOA 2X2ZA 2JRAA 1C1ZA 3GTQI 2JIOA 2WAQA 2AYDA 2W80A 2YU9I 3KIFA 3G4S1 2QA41 4RV9A 3CD6Z 1OJWA 4A3LI 1QVFZ 3HKZA 4KKDA 3IU3I 2V8IA 1Z02A 1VQO1 1TWHI 3NH8A 4AYDA 1Q7Y1 2EC3A 1RNIA 4X6AI 1JJ2Z 2V8JA 4E2YA 3CCUZ 1M901 1YUKA 4YIZA 4HGZA 1YUAA 1QUBA 3NH5A 3CMEZ 4A3GI 2E7ZA 2JA8I 4NBCA 4A3EI 3CD61 1VQ7Z 2XRDA 1N2FA 4BY1I 1VVCA 1M1K1 3OW2Z 3ZLDA 1VQ51 1VQPZ 3MQLA 3PO3I 1YHQZ 2HF1A 3GXEA 1YJWZ 3GTKI 4CSYA 4NBHA 3U50C 4XX2A 3HOVI 3CC41 4A3FI 1Y1VI 3HOYI 1TWCI 1Y8CA 3CME1 1YI2Z 4NB9A 4MRIA 2B5ID 1ELVA 3TVJA 3CCQZ 1USPB 1DL6A 1JJ2Y 3M7PA 3CC7Z 2ZYCA 5IP9I 3NFPI 1Q862 1N8R2 1I50I 4JHSA 2R6MA 3S1MI 3L89M 3HOUI 1MD8A 1X3ZA 3OP8A 1VQ71 2RKYA 2PMZA 1I6HI 3CMA1 2EGTA 3G6EZ 3OXUD 3S15I 4E33A 2I2LA 1UOTP 2BZMA 4YNXA 3CCE1 2NVQI 3FQMA 1K8A2 4A3II 3CC4Z 2OTLZ 1KD12 1WJ2A 3J80b 3S2DI 1NJI2 4ZH1D 2OTJ1 2RBLA 5IT9b 2VPYA 2JA5I 2R93I 1Q861 1VQ5Z 3LUSA 4NBDA 2WB1A 1P9NA 5IT9f 2RHBA 2QRCB 3RZDI 4MUCA 3GKQA 4TNUA 3G6E1 2OOXB 3CCU1 1K9M1 3VB9A 2CG6A 4Y52I 2P3YA 1VQM1 2JUBA 4A3BI 1VQ9Z 2MCYA 2JGWA 5C44I 4QTTA 2V45A 1H03P 2KPIA 1YI21 2NAPA 3FQQA 1S7MA 3CCJ1 1CKLA 2EHFA 4IGDA 2LFUA 3CXCZ 1W2BY 4E30A 3F3FC 1SS2A 4A5WB 4BXXI 2ERJA 3J81f 3OEDC 3I56Z 2KI7B 3NFZA 3CI0J 3WSXA 3CQZI 3JAMb 1MD7A 5LL6f 3S17I 2F4OA 3CCV1 2JS4A 1Z01A 1NUIA 3F3PC 3GTGI 4A93I 3CC71 2OZKA 1YIT1 1OJYA 2KRIA 3KIHA 1KQSY 2Q51A 2OTJZ 1QVGY 4BBRI 2YRAA 4MSLA 2UWNA 4DQYB 2O39C 3WSYA 4MD7A 4AYMA 2G7IA 2QREB 3J81b 3HOXI 3CMAZ 1KC82 3ERBA 4MXUA 5FO8C 2NVYI 4DK1A 2JIRA 1YITZ 1Q811 1H04P 3QWUA 3Q87A 2KMSA 2V8EA 3T5OA 3GTLI 1GPZA 2V8KA 5DN5A 1S721 1ML8A 1RLYA 2O53A 2OTL1 3BG1B 3EJHA 3ZLEA 3JAMf 2RL0A 1N8R1 1VQK1 1VQN1 3ZD1A 3G711 1LY2A 3CCQ1 4NBEA 2K3RA 3CCSZ 3I07A 2JMOA 4CL1A 5HYUB 2P28A 3HOZI 1Q16A 4S1TA 3S2HI 1YHQ1 3VMIA 4A3JI 1RO2A 4NBAA 3SW0X 4FXGG 1HFHA 2VPXA 3RZOI 5D1OB 2DE5A 2XWJI 4E2ZA 4ONTD 4BY7I 1YIJ1 1YJ91 5C4XI 1RO4A 5FLMI 2RLPA 2E2JI 1HCCA 4PZ5A 1JWHC 1VQL1 1OK3A 1GKGA 1GHQB 1FDOA 1RO0A 2RKZA 4NBFA 1YIJZ 1YJ9Z 3CCRZ 1SIWA 1HFIA 4NBBA 3CPWY 3D9XA 3EERA 4B2SA 2G2KA 3D6WA 2K5RA 1K9M2 2XWBF 3IF8A 2RLQA 3TDHB 2J6AA 5FLXb 2AKLA 1TWFI 5C3EI 4F4OC 3CCVZ 2JA7I 3CALA 2GU2A 1SRZA 2QY0A 3CC2Z 3FGTA 1M902 1FBRA 2A55A 3MZKB 2W04A 1QGBA 5HZPB 4K12A 3G71Z 1KD11 3GTOI 1USPA 1Q3XA 1NWVA 1WW9A 4MD9A 3J7A4 1VVDA 3EEDA 3ZD2A 3F6KA 1Y1WI 1VQ91 2CG7A 1QXFA 1ZH1A 2IV2X 2LOJA 5AN9F 4A3CI 1QO6A 1Z92B 3GTJI 4E31A 3I55Z 1VQ81 3NDJA 2JGXA 2MCZA 1Q821 5D1OA 3GCFA 3NDIA 1ZJKA 1K732 1KQSZ 3PO3S 1TFIA 2OOYB 3IX0A 2R92I 3TE5B 3PO2I 3R62A 2GTIA 3IR7A 2IZ3A 2QLVB 4HGYA 1KRLA 3CCMZ 1WZNA 3VMGA 4E2WA 4RVGA 1TPGA 3FKII 3H0GI 3IFUA 2QEX1 4RS4A 3I561 1K8A1 3CC21 2H85A 2E2HI 1E8BA 1QF8A 1VQLZ 4RVDA 1YJNZ 4LOSA 1VQMZ
chains in the Genus database with same CATH topology
1ZB8A 3G4SZ 1G4FA 3P5JB 3CXCY 1W2BZ 1Q7Y2 4MH4A 1LQLA 1S72Z 1K83I 2NVXI 3K7AI 5T67A 5C4JI 1KC81 2ZAEB 3M4OI 2XRBA 1O9AA 1VLAA 1VQOZ 3MZLB 1TWAI 3S16I 2RPRA 4MD8A 3CCEZ 3KZJA 2HU9A 4A3MI 2DE7A 3INBC 2Y0SA 3NH4A 2VUMI 1QVGZ 4DGLA 2M6NA 2W03A 5HYTB 1VQP1 1K731 1OK1A 3I4MI 1OJVA 2RT9A 1SFOI 2CKUA 1Q812 1YJN1 5HYPA 5I0QB 3KXVA 1VQ61 1E5GA 4E32A 4Y7NI 3S1NI 4A3KI 4RVFA 3CCL1 2R7ZI 2JA6I 4J38B 4AYBA 4RVHA 5D1PA 1QVFY 1H2QP 1VQ6Z 2QA4Z 3T4NB 5T6BA 2IZ4A 1WIIA 4QTUA 5A2Qf 1E88A 2QRDB 4LOTA 1R9TI 2E2II 1NJI1 1VQ41 1X0TA 5FLXf 1ZB9A 5A2Qb 3CCS1 3HOWI 2RIQA 3CCR1 1Z03A 3OW2Y 2DE6A 2F4MA 3MONA 3GTMS 1PPQA 4AYEA 1VQ4Z 3S14I 4NH1C 4NFRA 2QEXZ 2XQWC 4AYIA 3RJ3D 3GTPI 3O8EB 3ZRZA 1OK9A 2VF1A 4B2RA 4E2XA 3VTNA 4DJZA 2JR6A 2QR1B 5JPMG 2QKDA 2O4HA 3H3VJ 2YADA 4C16A 2I3CA 4NBGA 2VUGA 4EWCA 2GTHA 1QYPA 1TPMA 3GOVA 4HH4A 3CPWZ 2Q4ZA 1GKNA 3GTMI 2PM9A 2LIYA 3I551 1VQ8Z 1L1OC 2WIIC 1TWGI 2JNYA 5T64A 5IP7I 2M48A 1X3WA 3CCLZ 1G4GA 2B63I 4MONA 1U5MA 3CCM1 1NP6A 1OK2A 1VQKZ 1RQFA 3BG0B 1VQNZ 2E9HA 3M3YI 4WJG2 1M1K2 5CM2M 4A3DI 2YBYA 3J80f 1Q822 3I4NI 1WCMI 1TPNA 3S1QI 2NVTI 4NB8A 1I3QI 2PK7A 1Y1VS 1PFTA 3VMHA 1H2PP 2W81A 3S1RI 4BBSI 3CCJZ 4NOZA 3ESWA 1YJW1 2BJOA 2JRAA 1C1ZA 3GTQI 2WAQA 2W80A 2YU9I 3KIFA 3G4S1 2QA41 4RV9A 3CD6Z 1OJWA 4A3LI 1QVFZ 3HKZA 4KKDA 3IU3I 2V8IA 1Z02A 1VQO1 1TWHI 3NH8A 4AYDA 1Q7Y1 2EC3A 1RNIA 4X6AI 1JJ2Z 2V8JA 4E2YA 3CCUZ 1M901 1YUKA 4HGZA 1YUAA 1QUBA 3NH5A 3CMEZ 4A3GI 2JA8I 4NBCA 4A3EI 3CD61 1VQ7Z 2XRDA 1N2FA 4BY1I 1VVCA 1M1K1 3OW2Z 1VQ51 1VQPZ 3MQLA 3PO3I 1YHQZ 2HF1A 3GXEA 1YJWZ 3GTKI 4CSYA 4NBHA 3U50C 4XX2A 3HOVI 3CC41 4A3FI 1Y1VI 3HOYI 1TWCI 3CME1 1YI2Z 4NB9A 4MRIA 2B5ID 1ELVA 3TVJA 3CCQZ 1USPB 1DL6A 1JJ2Y 3M7PA 3CC7Z 5IP9I 3NFPI 1Q862 1N8R2 1I50I 4JHSA 2R6MA 3S1MI 3L89M 3HOUI 1MD8A 1X3ZA 3OP8A 1VQ71 2RKYA 2PMZA 1I6HI 3CMA1 2EGTA 3G6EZ 3OXUD 3S15I 4E33A 1UOTP 2BZMA 4YNXA 3CCE1 2NVQI 3FQMA 1K8A2 4A3II 3CC4Z 2OTLZ 1KD12 3J80b 3S2DI 1NJI2 4ZH1D 2OTJ1 2RBLA 5IT9b 2JA5I 2R93I 1Q861 1VQ5Z 3LUSA 4NBDA 2WB1A 1P9NA 5IT9f 2RHBA 2QRCB 3RZDI 4MUCA 3GKQA 4TNUA 3G6E1 2OOXB 3CCU1 1K9M1 3VB9A 2CG6A 4Y52I 2P3YA 1VQM1 2JUBA 4A3BI 1VQ9Z 2MCYA 2JGWA 5C44I 4QTTA 1H03P 2KPIA 1YI21 3FQQA 1S7MA 3CCJ1 1CKLA 2EHFA 4IGDA 2LFUA 3CXCZ 1W2BY 4E30A 3F3FC 1SS2A 4A5WB 4BXXI 2ERJA 3J81f 3OEDC 3I56Z 2KI7B 3NFZA 3S17I 3CQZI 3JAMb 1MD7A 5LL6f 2F4OA 3CCV1 2JS4A 1Z01A 1NUIA 3F3PC 3GTGI 4A93I 3CC71 2OZKA 1YIT1 1OJYA 2KRIA 3KIHA 1KQSY 2Q51A 2OTJZ 1QVGY 4BBRI 2YRAA 2UWNA 4DQYB 2O39C 4MD7A 4AYMA 2G7IA 2QREB 3J81b 3HOXI 3CMAZ 1KC82 3ERBA 4MXUA 5FO8C 2NVYI 4DK1A 1YITZ 1Q811 1H04P 3QWUA 3Q87A 2KMSA 2V8EA 3T5OA 3GTLI 1GPZA 2V8KA 1S721 1ML8A 1RLYA 2O53A 2OTL1 3BG1B 3EJHA 3JAMf 2RL0A 1N8R1 1VQK1 1VQN1 3ZD1A 3G711 1LY2A 3CCQ1 4NBEA 2K3RA 3CCSZ 3I07A 2JMOA 4CL1A 5HYUB 2P28A 3HOZI 4S1TA 3S2HI 1YHQ1 3VMIA 4A3JI 1RO2A 4NBAA 3SW0X 4FXGG 1HFHA 3RZOI 5D1OB 2DE5A 2XWJI 4E2ZA 4ONTD 4BY7I 1YIJ1 1YJ91 5C4XI 1RO4A 5FLMI 2RLPA 2E2JI 1HCCA 4PZ5A 1JWHC 1VQL1 1OK3A 1GKGA 1GHQB 1RO0A 2RKZA 4NBFA 1YIJZ 1YJ9Z 3CCRZ 1HFIA 4NBBA 3CPWY 3D9XA 3EERA 4B2SA 2G2KA 3D6WA 2K5RA 1K9M2 2XWBF 3IF8A 2RLQA 3TDHB 2J6AA 5FLXb 2AKLA 1TWFI 5C3EI 4F4OC 3CCVZ 2JA7I 3CALA 2GU2A 1SRZA 2QY0A 3CC2Z 1M902 1FBRA 2A55A 3MZKB 2W04A 1QGBA 5HZPB 4K12A 3G71Z 1KD11 3GTOI 4MD9A 1USPA 1Q3XA 1NWVA 1WW9A 3J7A4 1VVDA 3EEDA 3ZD2A 1Y1WI 1VQ91 2CG7A 1ZH1A 2LOJA 5AN9F 4A3CI 1QO6A 1Z92B 3GTJI 4E31A 3I55Z 1VQ81 3NDJA 2JGXA 2MCZA 1Q821 5D1OA 3GCFA 3NDIA 1ZJKA 1K732 1KQSZ 3PO3S 1TFIA 2OOYB 3IX0A 2R92I 3TE5B 3PO2I 3R62A 2GTIA 2IZ3A 2QLVB 4HGYA 1KRLA 3CCMZ 3VMGA 4E2WA 4RVGA 1TPGA 3FKII 3H0GI 3IFUA 2QEX1 4RS4A 3I561 1K8A1 3CC21 2H85A 2E2HI 1E8BA 1QF8A 1VQLZ 4RVDA 1YJNZ 4LOSA 1VQMZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW0 X;  4FXG G;  1OK2 A;  4ZH1 D;  1G4F A;  1HFH A;  4WJG 2;  2XWJ I;  4ONT D;  2YBY A;  2RLP A;  1HCC A;  1TPN A;  4PZ5 A;  2XRB A;  1O9A A;  1OK3 A;  1H2P P;  1GKG A;  1GHQ B;  2W81 A;  4MUC A;  2RKZ A;  3KZJ A;  3INB C;  1HFI A;  2JRA A;  1C1Z A;  2CG6 A;  5HYT B;  2W80 A;  4B2S A;  1OK1 A;  1OJV A;  2XWB F;  2RLQ A;  1OJW A;  2CKU A;  2MCY A;  4KKD A;  3IU3 I;  4F4O C;  5HYP A;  2JGW A;  5I0Q B;  3CAL A;  3KXV A;  1SRZ A;  2QY0 A;  1H03 P;  4AYD A;  1E5G A;  2EC3 A;  1FBR A;  2A55 A;  1CKL A;  1QGB A;  2EHF A;  4IGD A;  5HZP B;  4K12 A;  1SS2 A;  4J38 B;  4A5W B;  1Q3X A;  1NWV A;  2ERJ A;  1QUB A;  3OED C;  1H2Q P;  1VVD A;  3ZD2 A;  1MD7 A;  2XRD A;  2CG7 A;  1VVC A;  2IZ4 A;  3MQL A;  2LOJ A;  1OJY A;  2KRI A;  3GXE A;  1E88 A;  4LOT A;  1QO6 A;  1Z92 B;  4CSY A;  2YRA A;  2UWN A;  2O39 C;  2JGX A;  2MCZ A;  4AYM A;  2G7I A;  2B5I D;  1ELV A;  3TVJ A;  1PPQ A;  4AYE A;  3ERB A;  1ZJK A;  5FO8 C;  2XQW C;  4AYI A;  3RJ3 D;  3O8E B;  3M7P A;  3ZRZ A;  1OK9 A;  1H04 P;  3IX0 A;  4B2R A;  2KMS A;  2V8E A;  4DJZ A;  3T5O A;  1GPZ A;  3NFP I;  3R62 A;  5JPM G;  2IZ3 A;  4C16 A;  4JHS A;  3EJH A;  3L89 M;  1MD8 A;  2RL0 A;  3OP8 A;  2RKY A;  3ZD1 A;  1LY2 A;  3OXU D;  1TPG A;  1TPM A;  3GOV A;  1GKN A;  1UOT P;  2BZM A;  4YNX A;  2WII C;  1E8B A;  5HYU B;  1G4G A;  4LOS A;  1U5M A; 
#chains in the Genus database with same CATH topology
 1ZB8 A;  3G4S Z;  1G4F A;  3P5J B;  3CXC Y;  1W2B Z;  1Q7Y 2;  4MH4 A;  1LQL A;  1S72 Z;  1K83 I;  2NVX I;  3K7A I;  5T67 A;  4APL A;  5C4J I;  1KC8 1;  2ZAE B;  3M4O I;  2XRB A;  1O9A A;  2Y8S A;  1VLA A;  3D2L A;  1VQO Z;  3MZL B;  1TWA I;  3S16 I;  2RPR A;  4MD8 A;  3CCE Z;  3KZJ A;  2HU9 A;  3VWO A;  4A3M I;  2DE7 A;  3INB C;  2Y0S A;  3NH4 A;  2VUM I;  1QVG Z;  4DGL A;  2M6N A;  2W03 A;  5HYT B;  1VQP 1;  1K73 1;  1OK1 A;  3I4M I;  1OJV A;  2RT9 A;  1SFO I;  2CKU A;  1Q81 2;  2Y8T A;  1YJN 1;  5HYP A;  3FGR A;  5I0Q B;  3KXV A;  1FDI A;  1VQ6 1;  1E5G A;  5DN4 A;  4E32 A;  4Y7N I;  3S1N I;  4A3K I;  4RVF A;  3CCL 1;  2R7Z I;  2JA6 I;  4J38 B;  4AYB A;  4RVH A;  5D1P A;  1QVF Y;  1H2Q P;  1VQ6 Z;  2QA4 Z;  3T4N B;  4N7E A;  2IZ4 A;  1WII A;  4QTU A;  5T6B A;  5A2Q f;  1E88 A;  2QRD B;  4LOT A;  1R9T I;  2E2I I;  2JIM A;  1NJI 1;  1VQ4 1;  1X0T A;  5FLX f;  1ZB9 A;  5A2Q b;  3CCS 1;  3HOW I;  2RIQ A;  3CCR 1;  1Z03 A;  3OW2 Y;  2DE6 A;  2F4M A;  3MON A;  3GTM S;  1PPQ A;  4AYE A;  1VQ4 Z;  3S14 I;  4NH1 C;  4NFR A;  2QEX Z;  2XQW C;  4AYI A;  3RJ3 D;  3GTP I;  3O8E B;  3ZRZ A;  1OK9 A;  2VF1 A;  4B2R A;  4E2X A;  3VTN A;  4DJZ A;  2JR6 A;  2QR1 B;  5JPM G;  2O4H A;  2QKD A;  3H3V J;  2YAD A;  4C16 A;  2I3C A;  4NBG A;  2V3V A;  1AA6 A;  2VUG A;  4EWC A;  2GTH A;  1QYP A;  1TPM A;  3GOV A;  4HH4 A;  3CPW Z;  2Q4Z A;  1GKN A;  3GTM I;  2VPZ A;  2PM9 A;  2LIY A;  3I55 1;  1VQ8 Z;  1L1O C;  2WII C;  1TWG I;  2JNY A;  5T64 A;  5IP7 I;  2M48 A;  1X3W A;  3CCL Z;  1G4G A;  2JIQ A;  2B63 I;  1RLH A;  4MON A;  3NJA A;  1U5M A;  3CCM 1;  1NP6 A;  1OK2 A;  1VQK Z;  1RQF A;  3BG0 B;  1VQN Z;  2E9H A;  3M3Y I;  2JIP A;  4WJG 2;  1M1K 2;  5CM2 M;  4A3D I;  2Y8R A;  2YBY A;  3J80 f;  1Q82 2;  3I4N I;  1WCM I;  1TPN A;  2LEX A;  3S1Q I;  2NVT I;  4NB8 A;  1I3Q I;  3K3T A;  4PO7 A;  1Y1V S;  2PK7 A;  1PFT A;  3VMH A;  1H2P P;  2W81 A;  3S1R I;  4BBS I;  3CCJ Z;  2VPW A;  4BWC A;  4NOZ A;  3ESW A;  1YJW 1;  2BJO A;  2X2Z A;  2JRA A;  1C1Z A;  3GTQ I;  2JIO A;  2WAQ A;  2AYD A;  2W80 A;  2YU9 I;  3KIF A;  3G4S 1;  2QA4 1;  4RV9 A;  3CD6 Z;  1OJW A;  4A3L I;  1QVF Z;  3HKZ A;  4KKD A;  3IU3 I;  2V8I A;  1Z02 A;  1VQO 1;  1TWH I;  3NH8 A;  4AYD A;  1Q7Y 1;  2EC3 A;  1RNI A;  4X6A I;  1JJ2 Z;  2V8J A;  4E2Y A;  3CCU Z;  1M90 1;  1YUK A;  4YIZ A;  4HGZ A;  1YUA A;  1QUB A;  3NH5 A;  3CME Z;  4A3G I;  2E7Z A;  2JA8 I;  4NBC A;  4A3E I;  3CD6 1;  1VQ7 Z;  2XRD A;  1N2F A;  4BY1 I;  1VVC A;  1M1K 1;  3OW2 Z;  3ZLD A;  1VQ5 1;  1VQP Z;  3MQL A;  3PO3 I;  1YHQ Z;  2HF1 A;  3GXE A;  1YJW Z;  3GTK I;  4CSY A;  4NBH A;  3U50 C;  4XX2 A;  3HOV I;  3CC4 1;  4A3F I;  1Y1V I;  3HOY I;  1TWC I;  1Y8C A;  3CME 1;  1YI2 Z;  4NB9 A;  4MRI A;  2B5I D;  1ELV A;  3TVJ A;  3CCQ Z;  1USP B;  1DL6 A;  1JJ2 Y;  3M7P A;  3CC7 Z;  2ZYC A;  5IP9 I;  3NFP I;  1Q86 2;  1N8R 2;  1I50 I;  4JHS A;  2R6M A;  3S1M I;  3L89 M;  3HOU I;  1MD8 A;  1X3Z A;  3OP8 A;  1VQ7 1;  2RKY A;  2PMZ A;  1I6H I;  3CMA 1;  2EGT A;  3G6E Z;  3OXU D;  3S15 I;  4E33 A;  2I2L A;  1UOT P;  2BZM A;  4YNX A;  3CCE 1;  2NVQ I;  3FQM A;  1K8A 2;  4A3I I;  3CC4 Z;  2OTL Z;  1KD1 2;  1WJ2 A;  3J80 b;  3S2D I;  1NJI 2;  4ZH1 D;  2OTJ 1;  2RBL A;  5IT9 b;  2VPY A;  2JA5 I;  2R93 I;  1Q86 1;  1VQ5 Z;  3LUS A;  4NBD A;  2WB1 A;  1P9N A;  5IT9 f;  2RHB A;  2QRC B;  3RZD I;  4MUC A;  3GKQ A;  4TNU A;  3G6E 1;  2OOX B;  3CCU 1;  1K9M 1;  3VB9 A;  2CG6 A;  4Y52 I;  2P3Y A;  1VQM 1;  2JUB A;  4A3B I;  1VQ9 Z;  2MCY A;  2JGW A;  5C44 I;  4QTT A;  2V45 A;  1H03 P;  2KPI A;  1YI2 1;  2NAP A;  3FQQ A;  1S7M A;  3CCJ 1;  1CKL A;  2EHF A;  4IGD A;  2LFU A;  3CXC Z;  1W2B Y;  4E30 A;  3F3F C;  1SS2 A;  4A5W B;  4BXX I;  2ERJ A;  3J81 f;  3OED C;  3I56 Z;  2KI7 B;  3NFZ A;  3CI0 J;  3WSX A;  3CQZ I;  3JAM b;  1MD7 A;  5LL6 f;  3S17 I;  2F4O A;  3CCV 1;  2JS4 A;  1Z01 A;  1NUI A;  3F3P C;  3GTG I;  4A93 I;  3CC7 1;  2OZK A;  1YIT 1;  1OJY A;  2KRI A;  3KIH A;  1KQS Y;  2Q51 A;  2OTJ Z;  1QVG Y;  4BBR I;  2YRA A;  4MSL A;  2UWN A;  4DQY B;  2O39 C;  3WSY A;  4MD7 A;  4AYM A;  2G7I A;  2QRE B;  3J81 b;  3HOX I;  3CMA Z;  1KC8 2;  3ERB A;  4MXU A;  5FO8 C;  2NVY I;  4DK1 A;  2JIR A;  1YIT Z;  1Q81 1;  1H04 P;  3QWU A;  3Q87 A;  2KMS A;  2V8E A;  3T5O A;  3GTL I;  1GPZ A;  2V8K A;  5DN5 A;  1S72 1;  1ML8 A;  1RLY A;  2O53 A;  2OTL 1;  3BG1 B;  3EJH A;  3ZLE A;  3JAM f;  2RL0 A;  1N8R 1;  1VQK 1;  1VQN 1;  3ZD1 A;  3G71 1;  1LY2 A;  3CCQ 1;  4NBE A;  2K3R A;  3CCS Z;  3I07 A;  2JMO A;  4CL1 A;  5HYU B;  2P28 A;  3HOZ I;  1Q16 A;  4S1T A;  3S2H I;  1YHQ 1;  3VMI A;  4A3J I;  1RO2 A;  4NBA A;  3SW0 X;  4FXG G;  1HFH A;  2VPX A;  3RZO I;  5D1O B;  2DE5 A;  2XWJ I;  4E2Z A;  4ONT D;  4BY7 I;  1YIJ 1;  1YJ9 1;  5C4X I;  1RO4 A;  5FLM I;  2RLP A;  2E2J I;  1HCC A;  4PZ5 A;  1JWH C;  1VQL 1;  1OK3 A;  1GKG A;  1GHQ B;  1FDO A;  1RO0 A;  2RKZ A;  4NBF A;  1YIJ Z;  1YJ9 Z;  3CCR Z;  1SIW A;  1HFI A;  4NBB A;  3CPW Y;  3D9X A;  3EER A;  4B2S A;  2G2K A;  3D6W A;  2K5R A;  1K9M 2;  2XWB F;  3IF8 A;  2RLQ A;  3TDH B;  2J6A A;  5FLX b;  2AKL A;  1TWF I;  5C3E I;  4F4O C;  3CCV Z;  2JA7 I;  3CAL A;  2GU2 A;  1SRZ A;  2QY0 A;  3CC2 Z;  3FGT A;  1M90 2;  1FBR A;  2A55 A;  3MZK B;  2W04 A;  1QGB A;  5HZP B;  4K12 A;  3G71 Z;  1KD1 1;  3GTO I;  1USP A;  1Q3X A;  1NWV A;  1WW9 A;  4MD9 A;  3J7A 4;  1VVD A;  3EED A;  3ZD2 A;  3F6K A;  1Y1W I;  1VQ9 1;  2CG7 A;  1QXF A;  1ZH1 A;  2IV2 X;  2LOJ A;  5AN9 F;  4A3C I;  1QO6 A;  1Z92 B;  3GTJ I;  4E31 A;  3I55 Z;  1VQ8 1;  3NDJ A;  2JGX A;  2MCZ A;  1Q82 1;  5D1O A;  3GCF A;  3NDI A;  1ZJK A;  1K73 2;  1KQS Z;  3PO3 S;  1TFI A;  2OOY B;  3IX0 A;  2R92 I;  3TE5 B;  3PO2 I;  3R62 A;  2GTI A;  3IR7 A;  2IZ3 A;  2QLV B;  4HGY A;  1KRL A;  3CCM Z;  1WZN A;  3VMG A;  4E2W A;  4RVG A;  1TPG A;  3FKI I;  3H0G I;  3IFU A;  2QEX 1;  4RS4 A;  3I56 1;  1K8A 1;  3CC2 1;  2H85 A;  2E2H I;  1E8B A;  1QF8 A;  1VQL Z;  4RVD A;  1YJN Z;  4LOS A;  1VQM Z; 
#chains in the Genus database with same CATH homology
 1ZB8 A;  3G4S Z;  1G4F A;  3P5J B;  3CXC Y;  1W2B Z;  1Q7Y 2;  4MH4 A;  1LQL A;  1S72 Z;  1K83 I;  2NVX I;  3K7A I;  5T67 A;  5C4J I;  1KC8 1;  2ZAE B;  3M4O I;  2XRB A;  1O9A A;  1VLA A;  1VQO Z;  3MZL B;  1TWA I;  3S16 I;  2RPR A;  4MD8 A;  3CCE Z;  3KZJ A;  2HU9 A;  4A3M I;  2DE7 A;  3INB C;  2Y0S A;  3NH4 A;  2VUM I;  1QVG Z;  4DGL A;  2M6N A;  2W03 A;  5HYT B;  1VQP 1;  1K73 1;  1OK1 A;  3I4M I;  1OJV A;  2RT9 A;  1SFO I;  2CKU A;  1Q81 2;  1YJN 1;  5HYP A;  5I0Q B;  3KXV A;  1VQ6 1;  1E5G A;  4E32 A;  4Y7N I;  3S1N I;  4A3K I;  4RVF A;  3CCL 1;  2R7Z I;  2JA6 I;  4J38 B;  4AYB A;  4RVH A;  5D1P A;  1QVF Y;  1H2Q P;  1VQ6 Z;  2QA4 Z;  3T4N B;  5T6B A;  2IZ4 A;  1WII A;  4QTU A;  5A2Q f;  1E88 A;  2QRD B;  4LOT A;  1R9T I;  2E2I I;  1NJI 1;  1VQ4 1;  1X0T A;  5FLX f;  1ZB9 A;  5A2Q b;  3CCS 1;  3HOW I;  2RIQ A;  3CCR 1;  1Z03 A;  3OW2 Y;  2DE6 A;  2F4M A;  3MON A;  3GTM S;  1PPQ A;  4AYE A;  1VQ4 Z;  3S14 I;  4NH1 C;  4NFR A;  2QEX Z;  2XQW C;  4AYI A;  3RJ3 D;  3GTP I;  3O8E B;  3ZRZ A;  1OK9 A;  2VF1 A;  4B2R A;  4E2X A;  3VTN A;  4DJZ A;  2JR6 A;  2QR1 B;  5JPM G;  2QKD A;  2O4H A;  3H3V J;  2YAD A;  4C16 A;  2I3C A;  4NBG A;  2VUG A;  4EWC A;  2GTH A;  1QYP A;  1TPM A;  3GOV A;  4HH4 A;  3CPW Z;  2Q4Z A;  1GKN A;  3GTM I;  2PM9 A;  2LIY A;  3I55 1;  1VQ8 Z;  1L1O C;  2WII C;  1TWG I;  2JNY A;  5T64 A;  5IP7 I;  2M48 A;  1X3W A;  3CCL Z;  1G4G A;  2B63 I;  4MON A;  1U5M A;  3CCM 1;  1NP6 A;  1OK2 A;  1VQK Z;  1RQF A;  3BG0 B;  1VQN Z;  2E9H A;  3M3Y I;  4WJG 2;  1M1K 2;  5CM2 M;  4A3D I;  2YBY A;  3J80 f;  1Q82 2;  3I4N I;  1WCM I;  1TPN A;  3S1Q I;  2NVT I;  4NB8 A;  1I3Q I;  2PK7 A;  1Y1V S;  1PFT A;  3VMH A;  1H2P P;  2W81 A;  3S1R I;  4BBS I;  3CCJ Z;  4NOZ A;  3ESW A;  1YJW 1;  2BJO A;  2JRA A;  1C1Z A;  3GTQ I;  2WAQ A;  2W80 A;  2YU9 I;  3KIF A;  3G4S 1;  2QA4 1;  4RV9 A;  3CD6 Z;  1OJW A;  4A3L I;  1QVF Z;  3HKZ A;  4KKD A;  3IU3 I;  2V8I A;  1Z02 A;  1VQO 1;  1TWH I;  3NH8 A;  4AYD A;  1Q7Y 1;  2EC3 A;  1RNI A;  4X6A I;  1JJ2 Z;  2V8J A;  4E2Y A;  3CCU Z;  1M90 1;  1YUK A;  4HGZ A;  1YUA A;  1QUB A;  3NH5 A;  3CME Z;  4A3G I;  2JA8 I;  4NBC A;  4A3E I;  3CD6 1;  1VQ7 Z;  2XRD A;  1N2F A;  4BY1 I;  1VVC A;  1M1K 1;  3OW2 Z;  1VQ5 1;  1VQP Z;  3MQL A;  3PO3 I;  1YHQ Z;  2HF1 A;  3GXE A;  1YJW Z;  3GTK I;  4CSY A;  4NBH A;  3U50 C;  4XX2 A;  3HOV I;  3CC4 1;  4A3F I;  1Y1V I;  3HOY I;  1TWC I;  3CME 1;  1YI2 Z;  4NB9 A;  4MRI A;  2B5I D;  1ELV A;  3TVJ A;  3CCQ Z;  1USP B;  1DL6 A;  1JJ2 Y;  3M7P A;  3CC7 Z;  5IP9 I;  3NFP I;  1Q86 2;  1N8R 2;  1I50 I;  4JHS A;  2R6M A;  3S1M I;  3L89 M;  3HOU I;  1MD8 A;  1X3Z A;  3OP8 A;  1VQ7 1;  2RKY A;  2PMZ A;  1I6H I;  3CMA 1;  2EGT A;  3G6E Z;  3OXU D;  3S15 I;  4E33 A;  1UOT P;  2BZM A;  4YNX A;  3CCE 1;  2NVQ I;  3FQM A;  1K8A 2;  4A3I I;  3CC4 Z;  2OTL Z;  1KD1 2;  3J80 b;  3S2D I;  1NJI 2;  4ZH1 D;  2OTJ 1;  2RBL A;  5IT9 b;  2JA5 I;  2R93 I;  1Q86 1;  1VQ5 Z;  3LUS A;  4NBD A;  2WB1 A;  1P9N A;  5IT9 f;  2RHB A;  2QRC B;  3RZD I;  4MUC A;  3GKQ A;  4TNU A;  3G6E 1;  2OOX B;  3CCU 1;  1K9M 1;  3VB9 A;  2CG6 A;  4Y52 I;  2P3Y A;  1VQM 1;  2JUB A;  4A3B I;  1VQ9 Z;  2MCY A;  2JGW A;  5C44 I;  4QTT A;  1H03 P;  2KPI A;  1YI2 1;  3FQQ A;  1S7M A;  3CCJ 1;  1CKL A;  2EHF A;  4IGD A;  2LFU A;  3CXC Z;  1W2B Y;  4E30 A;  3F3F C;  1SS2 A;  4A5W B;  4BXX I;  2ERJ A;  3J81 f;  3OED C;  3I56 Z;  2KI7 B;  3NFZ A;  3S17 I;  3CQZ I;  3JAM b;  1MD7 A;  5LL6 f;  2F4O A;  3CCV 1;  2JS4 A;  1Z01 A;  1NUI A;  3F3P C;  3GTG I;  4A93 I;  3CC7 1;  2OZK A;  1YIT 1;  1OJY A;  2KRI A;  3KIH A;  1KQS Y;  2Q51 A;  2OTJ Z;  1QVG Y;  4BBR I;  2YRA A;  2UWN A;  4DQY B;  2O39 C;  4MD7 A;  4AYM A;  2G7I A;  2QRE B;  3J81 b;  3HOX I;  3CMA Z;  1KC8 2;  3ERB A;  4MXU A;  5FO8 C;  2NVY I;  4DK1 A;  1YIT Z;  1Q81 1;  1H04 P;  3QWU A;  3Q87 A;  2KMS A;  2V8E A;  3T5O A;  3GTL I;  1GPZ A;  2V8K A;  1S72 1;  1ML8 A;  1RLY A;  2O53 A;  2OTL 1;  3BG1 B;  3EJH A;  3JAM f;  2RL0 A;  1N8R 1;  1VQK 1;  1VQN 1;  3ZD1 A;  3G71 1;  1LY2 A;  3CCQ 1;  4NBE A;  2K3R A;  3CCS Z;  3I07 A;  2JMO A;  4CL1 A;  5HYU B;  2P28 A;  3HOZ I;  4S1T A;  3S2H I;  1YHQ 1;  3VMI A;  4A3J I;  1RO2 A;  4NBA A;  3SW0 X;  4FXG G;  1HFH A;  3RZO I;  5D1O B;  2DE5 A;  2XWJ I;  4E2Z A;  4ONT D;  4BY7 I;  1YIJ 1;  1YJ9 1;  5C4X I;  1RO4 A;  5FLM I;  2RLP A;  2E2J I;  1HCC A;  4PZ5 A;  1JWH C;  1VQL 1;  1OK3 A;  1GKG A;  1GHQ B;  1RO0 A;  2RKZ A;  4NBF A;  1YIJ Z;  1YJ9 Z;  3CCR Z;  1HFI A;  4NBB A;  3CPW Y;  3D9X A;  3EER A;  4B2S A;  2G2K A;  3D6W A;  2K5R A;  1K9M 2;  2XWB F;  3IF8 A;  2RLQ A;  3TDH B;  2J6A A;  5FLX b;  2AKL A;  1TWF I;  5C3E I;  4F4O C;  3CCV Z;  2JA7 I;  3CAL A;  2GU2 A;  1SRZ A;  2QY0 A;  3CC2 Z;  1M90 2;  1FBR A;  2A55 A;  3MZK B;  2W04 A;  1QGB A;  5HZP B;  4K12 A;  3G71 Z;  1KD1 1;  3GTO I;  4MD9 A;  1USP A;  1Q3X A;  1NWV A;  1WW9 A;  3J7A 4;  1VVD A;  3EED A;  3ZD2 A;  1Y1W I;  1VQ9 1;  2CG7 A;  1ZH1 A;  2LOJ A;  5AN9 F;  4A3C I;  1QO6 A;  1Z92 B;  3GTJ I;  4E31 A;  3I55 Z;  1VQ8 1;  3NDJ A;  2JGX A;  2MCZ A;  1Q82 1;  5D1O A;  3GCF A;  3NDI A;  1ZJK A;  1K73 2;  1KQS Z;  3PO3 S;  1TFI A;  2OOY B;  3IX0 A;  2R92 I;  3TE5 B;  3PO2 I;  3R62 A;  2GTI A;  2IZ3 A;  2QLV B;  4HGY A;  1KRL A;  3CCM Z;  3VMG A;  4E2W A;  4RVG A;  1TPG A;  3FKI I;  3H0G I;  3IFU A;  2QEX 1;  4RS4 A;  3I56 1;  1K8A 1;  3CC2 1;  2H85 A;  2E2H I;  1E8B A;  1QF8 A;  1VQL Z;  4RVD A;  1YJN Z;  4LOS A;  1VQM Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...