2IZ3A

Solution structure of human beta-microseminoprotein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
94
structure length
94
Chain Sequence
SCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Inhibitor
total genus 10
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz3A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz3A02
2CG7A 1MD8A 3SW0X 4MUCA 2O39C 4CSYA 2LOJA 4KKDA 3CALA 4JHSA 2UWNA 1C1ZA 1HFHA 2YBYA 2XRBA 3L89M 1H2PP 1OK1A 4A5WB 1ELVA 2V8EA 1QGBA 4LOTA 1GKGA 1OJVA 3ZD2A 1UOTP 5HYTB 1CKLA 3INBC 3T5OA 4LOSA 4IGDA 4ONTD 1ZJKA 1PPQA 4K12A 4PZ5A 3MQLA 3OEDC 2WIIC 4F4OC 1O9AA 3KXVA 1OK2A 3OXUD 1H2QP 2EC3A 1FBRA 1GHQB 2XWBF 3M7PA 2ERJA 1HFIA 4WJG2 1E5GA 2JGXA 2RLPA 3OP8A 2MCYA 5I0QB 2XQWC 1OK3A 1SRZA 4AYEA 3GXEA 1OJWA 2EHFA 1Q3XA 1HCCA 2W81A 2A55A 1H04P 1VVDA 1TPNA 3NFPI 2JGWA 2KRIA 1Z92B 4J38B 1OJYA 1U5MA 3GOVA 5HYUB 5HYPA 2RKYA 4FXGG 4ZH1D 3ZRZA 1QUBA 1G4GA 2B5ID 2IZ4A 1TPMA 2MCZA 1SS2A 2CKUA 3O8EB 2JRAA 1TPGA 2YRAA 4YNXA 1LY2A 3ZD1A 2XRDA 2RL0A 2KMSA 5JPMG 1GPZA 2G7IA 4B2RA 4AYMA 2RLQA 2W80A 4B2SA 3IU3I 1H03P 3EJHA 3TVJA 2BZMA 1OK9A 2QY0A 2IZ3A 5FO8C 1VVCA 4C16A 2XWJI 3KZJA 3RJ3D 4AYIA 2RKZA 1NWVA 3ERBA 4AYDA 4DJZA 5HZPB 1QO6A 1MD7A 1E88A 3IX0A 3R62A 1G4FA 1GKNA 1E8BA 2CG6A
chains in the Genus database with same CATH superfamily
1VQ7Z 1YUKA 4MONA 1WZNA 3F3PC 4NBHA 4KKDA 4JHSA 2GTHA 1Q822 2UWNA 4E31A 4DK1A 2V8KA 2Q51A 1DL6A 4MXUA 1GKGA 2R7ZI 2W03A 2QKDA 1S721 3CMAZ 1I50I 3I55Z 4APLA 1M902 2OTLZ 1NP6A 2NVQI 1CKLA 1FDOA 2OTJ1 5T64A 1ZJKA 2E2II 4RVGA 4A3EI 3MZKB 2WIIC 1YITZ 2QR1B 2F4MA 1OK2A 3CC21 2P28A 3CC2Z 2OZKA 3D2LA 3EERA 2JIRA 2Y8SA 1N8R1 2JIMA 1YI2Z 3S1RI 1I3QI 2O53A 4NFRA 3GXEA 3HOVI 2JA5I 2WAQA 1JJ2Z 3CCL1 1TPNA 3CCLZ 3S14I 4A93I 1WIIA 2JR6A 1Y1WI 2JMOA 4QTUA 1OJYA 2JIPA 3S15I 2V8JA 1YHQ1 3FKII 4MD7A 1WCMI 2QREB 2RKYA 1Z01A 1G4GA 1YJW1 1K8A1 3CCMZ 3LUSA 2CKUA 5A2Qb 2YRAA 3G711 5IT9f 2RT9A 3GTPI 3G71Z 2KMSA 5DN4A 2V45A 3CME1 5FLXb 3WSXA 3CMEZ 3IU3I 1VQ8Z 4MSLA 1VQ91 3EJHA 2JS4A 3MZLB 1OK9A 4X6AI 2DE7A 2M48A 1VQ9Z 1VQ51 3PO3I 4TNUA 4QTTA 2XWJI 3M3YI 2M6NA 3RJ3D 2O4HA 3FGRA 2LEXA 1NWVA 1G4FA 3GKQA 3IX0A 3R62A 4NB9A 2R93I 2CG6A 3IR7A 2CG7A 1MD8A 3OW2Y 3GTKI 4MD9A 4MUCA 4CSYA 2LOJA 3K7AI 1YJ9Z 2QA4Z 3CXCY 3IF8A 4EWCA 1C1ZA 3D6WA 1VQOZ 4A5WB 2V8EA 4A3DI 4A3GI 4LOTA 1Q812 2QRDB 2G2KA 1VQ4Z 1KQSY 1UOTP 3JAMf 2W04A 5T67A 5C4XI 3D9XA 4ONTD 1ZB8A 2VPZA 3GTGI 1PPQA 4K12A 1I6HI 2JA6I 1Y1VI 2VPWA 4PZ5A 3OEDC 1O9AA 5CM2M 3KXVA 2E2JI 2P3YA 3M7PA 1FBRA 3ZLEA 1JWHC 3NJAA 4DGLA 1E5GA 1LQLA 2B63I 2JGXA 3PO3S 3KIFA 4NBCA 3OP8A 3F6KA 1TWFI 1SRZA 4AYEA 4RVFA 3I4NI 1YJN1 1S72Z 2EHFA 1HCCA 2W81A 1ZH1A 2ZYCA 5D1OA 2A55A 1YJNZ 1H04P 2VUGA 4RS4A 2VF1A 1K9M1 2OTJZ 2EGTA 2KRIA 2DE5A 1Z92B 4J38B 4RVDA 3GOVA 3T4NB 5HYPA 5IP9I 4BY1I 2AYDA 3P5JB 2ZAEB 2B5ID 2IZ4A 3J80f 1Q16A 2BJOA 3J7A4 3GTOI 3G6E1 2RIQA 2Q4ZA 3OW2Z 3G6EZ 1VQ61 2PMZA 1Y8CA 2JRAA 1YIJ1 1VQM1 2VPYA 3CXCZ 1LY2A 3ZD1A 3CCE1 1VQMZ 2RL0A 2XRDA 2G7IA 5FLMI 3CCEZ 1SIWA 1M901 4B2RA 2YADA 2QEX1 1FDIA 4AYMA 1NJI2 5D1OB 3Q87A 1KC82 1K8A2 1Y1VS 1H03P 4E2XA 2JA8I 4S1TA 2KI7B 1KQSZ 2JUBA 1VQL1 1ZB9A 1YHQZ 2NVYI 2Y8RA 1K732 3KZJA 3CCR1 1YJWZ 2I2LA 5A2Qf 2OOYB 3CCRZ 1AA6A 3CD61 4A3LI 3I07A 5HZPB 4HH4A 3J81f 1MD7A 1E88A 3CD6Z 1E8BA 4A3KI 3NH4A 3GTJI 3SW0X 2O39C 2RPRA 3VB9A 1Q7Y1 4A3FI 1RLHA 3S17I 3CCQ1 3L89M 1H2PP 3K3TA 3MONA 4E2WA 1ELVA 1KD12 3FQQA 4A3BI 3H0GI 1N2FA 1VQ5Z 1OJVA 4BBRI 1PFTA 4A3MI 1Q861 1RLYA 4LOSA 1QVFY 1M1K1 2KPIA 5IT9b 4IGDA 3FQMA 3PO2I 1W2BY 2JIQA 1QVGY 4MRIA 2E9HA 3OXUD 4NBEA 3VMIA 3BG1B 4CL1A 1H2QP 2HU9A 3HOUI 1GHQB 2VUMI 3S1MI 1HFIA 1RNIA 3S16I 2QLVB 2F4OA 3F3FC 3NDIA 2RLPA 4HGZA 2JA7I 3HOYI 2E7ZA 3S2HI 5I0QB 4BBSI 2XQWC 1OK3A 4YIZA 3CC41 1VVDA 2Y8TA 4RV9A 3S1NI 3NH5A 2HF1A 4E32A 1RO4A 2JGWA 1USPA 4A3CI 5AN9F 3GTMI 3NH8A 1X0TA 4NBDA 4NB8A 3CCS1 4XX2A 1TWHI 4PO7A 3CCSZ 1KRLA 3ZRZA 4BXXI 2IV2X 1SS2A 2H85A 3GTLI 2RBLA 1TPGA 3JAMb 4YNXA 3H3VJ 5T6BA 3RZDI 3RZOI 3VMHA 4AYBA 2W80A 1RO2A 2NVXI 3S1QI 1QF8A 2BZMA 1WJ2A 2JIOA 1N8R2 3HOWI 1USPB 1K83I 4E30A 1VQP1 3CPWY 1VQPZ 3CCJ1 4E2YA 3I561 2RHBA 5FO8C 1VVCA 3CMA1 4C16A 3I551 3CCJZ 3I56Z 1Q821 1QVFZ 5D1PA 2Y0SA 2OTL1 4AYIA 3FGTA 4MD8A 4E33A 4NBBA 3ERBA 2QRCB 4DJZA 1W2BZ 2NVTI 3VMGA 1VQ6Z 1QVGZ 2R92I 1S7MA 1YIJZ 1YUAA 3CALA 3CCV1 3I4MI 1YIT1 3CCVZ 2QEXZ 3GTMS 1WW9A 2V3VA 1HFHA 2YBYA 2XRBA 4RVHA 3CC71 3HOXI 1VQK1 1OK1A 1ML8A 1VQLZ 1QGBA 3CC7Z 1R9TI 1Z03A 3IFUA 1YI21 1VQKZ 3S2DI 1X3ZA 2GU2A 3ZD2A 4Y52I 2V8IA 2NAPA 3J80b 3CI0J 2K3RA 2YU9I 4Y7NI 1Q7Y2 1L1OC 5HYTB 2E2HI 3INBC 2PK7A 3G4S1 1TWCI 3T5OA 3ZLDA 4NOZA 4A3JI 3VWOA 3G4SZ 1SFOI 5C44I 5FLXf 1VQN1 4E2ZA 1VQNZ 3QWUA 5DN5A 3MQLA 4MH4A 4F4OC 2GTIA 5LL6f 2I3CA 4NBFA 1Q862 1NJI1 3CCQZ 2EC3A 2XWBF 4WJG2 2ERJA 3CCM1 4DQYB 1KC81 3HOZI 1M1K2 3U50C 3HKZA 2MCYA 3TDHB 1NUIA 2J6AA 1Z02A 1OJWA 2AKLA 1Q3XA 2OOXB 1K731 3BG0B 1X3WA 5IP7I 3J81b 3ESWA 3NFPI 1TFIA 1P9NA 3CPWZ 1VQ81 4NBAA 1U5MA 4A3II 1VLAA 5HYUB 3CCU1 1RQFA 3CCUZ 4FXGG 1RO0A 4ZH1D 1QUBA 3TE5B 1TPMA 5C4JI 2MCZA 3CQZI 2K5RA 1TWAI 3O8EB 1KD11 3CC4Z 1YJ91 2X2ZA 5JPMG 3NFZA 1GPZA 2QA41 3GCFA 1QXFA 4BY7I 2VPXA 2RLQA 1JJ2Y 4B2SA 5C3EI 3WSYA 3TVJA 1VQO1 1QYPA 2QY0A 3M4OI 4NBGA 2IZ3A 4BWCA 2JNYA 1VQ41 4N7EA 3GTQI 2PM9A 2WB1A 3VTNA 2R6MA 1TWGI 3NDJA 4NH1C 2RKZA 1K9M2 3KIHA 4HGYA 4AYDA 1QO6A 1GKNA 3EEDA 2DE6A 1VQ71 1Q811 2LFUA 2LIYA
chains in the Genus database with same CATH topology
1VQ7Z 1YUKA 4MONA 3F3PC 4NBHA 4KKDA 4JHSA 2GTHA 1Q822 2UWNA 4E31A 4DK1A 2V8KA 2Q51A 1DL6A 4MXUA 1GKGA 2R7ZI 2W03A 2QKDA 1S721 3CMAZ 1I50I 3I55Z 1M902 2OTLZ 1NP6A 2NVQI 1CKLA 2OTJ1 5T64A 1ZJKA 2E2II 4RVGA 4A3EI 3MZKB 2WIIC 1YITZ 2QR1B 2F4MA 1OK2A 3CC21 2P28A 3CC2Z 2OZKA 3EERA 1N8R1 1YI2Z 3S1RI 1I3QI 2O53A 4NFRA 3GXEA 3HOVI 2JA5I 2WAQA 1JJ2Z 3CCL1 1TPNA 3CCLZ 3S14I 4A93I 1WIIA 2JR6A 1Y1WI 2JMOA 4QTUA 1OJYA 3S15I 2V8JA 1YHQ1 3FKII 4MD7A 1WCMI 2QREB 2RKYA 1Z01A 1G4GA 1YJW1 1K8A1 3CCMZ 3LUSA 2CKUA 5A2Qb 2YRAA 3G711 5IT9f 2RT9A 3GTPI 3G71Z 2KMSA 3CME1 5FLXb 3CMEZ 3IU3I 1VQ8Z 1VQ91 3EJHA 3MZLB 2JS4A 1OK9A 4X6AI 2DE7A 2M48A 1VQ9Z 1VQ51 3PO3I 4TNUA 4QTTA 2XWJI 3M3YI 2M6NA 3RJ3D 2O4HA 1NWVA 1G4FA 3GKQA 3IX0A 3R62A 4NB9A 2R93I 2CG6A 2CG7A 1MD8A 3OW2Y 3GTKI 4MD9A 4MUCA 4CSYA 2LOJA 3K7AI 1YJ9Z 2QA4Z 3CXCY 3IF8A 4EWCA 1C1ZA 3D6WA 1VQOZ 4A5WB 2V8EA 4A3DI 4A3GI 4LOTA 1Q812 2QRDB 2G2KA 1VQ4Z 1KQSY 1UOTP 3JAMf 2W04A 5T67A 5C4XI 3D9XA 4ONTD 1ZB8A 3GTGI 1PPQA 4K12A 1I6HI 2JA6I 1Y1VI 4PZ5A 3OEDC 1O9AA 5CM2M 3KXVA 2E2JI 2P3YA 3M7PA 1FBRA 1JWHC 4DGLA 1E5GA 1LQLA 2B63I 2JGXA 3PO3S 3KIFA 4NBCA 3OP8A 1TWFI 1SRZA 4AYEA 4RVFA 3I4NI 1YJN1 1S72Z 2EHFA 1HCCA 2W81A 1ZH1A 5D1OA 2A55A 1YJNZ 1H04P 2VUGA 4RS4A 2VF1A 1K9M1 2OTJZ 2EGTA 2KRIA 2DE5A 1Z92B 4J38B 4RVDA 3GOVA 3T4NB 5HYPA 5IP9I 4BY1I 3P5JB 2ZAEB 2B5ID 2IZ4A 3J80f 3J7A4 2BJOA 3GTOI 3G6E1 2RIQA 2Q4ZA 3OW2Z 3G6EZ 1VQ61 2PMZA 2JRAA 1YIJ1 1VQM1 3CXCZ 1LY2A 3ZD1A 3CCE1 1VQMZ 2XRDA 2RL0A 2G7IA 5FLMI 3CCEZ 1M901 4B2RA 2YADA 2QEX1 4AYMA 1NJI2 5D1OB 3Q87A 1KC82 1K8A2 1Y1VS 1H03P 4E2XA 2JA8I 4S1TA 2KI7B 1KQSZ 2JUBA 1VQL1 1ZB9A 1YHQZ 2NVYI 1K732 3KZJA 3CCR1 1YJWZ 5A2Qf 2OOYB 3CCRZ 3CD61 4A3LI 3I07A 5HZPB 4HH4A 3J81f 1MD7A 1E88A 3CD6Z 1E8BA 4A3KI 3NH4A 3GTJI 3SW0X 2O39C 2RPRA 3VB9A 1Q7Y1 4A3FI 3S17I 3CCQ1 3L89M 1H2PP 3MONA 4E2WA 1ELVA 1KD12 3FQQA 4A3BI 3H0GI 1N2FA 1VQ5Z 1OJVA 4BBRI 1PFTA 4A3MI 1Q861 1RLYA 4LOSA 1QVFY 1M1K1 2KPIA 5IT9b 4IGDA 3FQMA 3PO2I 1W2BY 1QVGY 4MRIA 2E9HA 3OXUD 4NBEA 3VMIA 3BG1B 4CL1A 1H2QP 2HU9A 3HOUI 1GHQB 2VUMI 3S1MI 1HFIA 1RNIA 3S16I 2QLVB 2F4OA 3F3FC 3NDIA 2RLPA 4HGZA 2JA7I 3HOYI 3S2HI 5I0QB 4BBSI 2XQWC 1OK3A 3CC41 1VVDA 3S1NI 4RV9A 3NH5A 2HF1A 4E32A 1RO4A 2JGWA 1USPA 4A3CI 5AN9F 3GTMI 3NH8A 1X0TA 4NBDA 4NB8A 3CCS1 4XX2A 1TWHI 3CCSZ 1KRLA 3ZRZA 4BXXI 1SS2A 2H85A 3GTLI 2RBLA 1TPGA 3JAMb 4YNXA 3H3VJ 5T6BA 3RZDI 3RZOI 3VMHA 4AYBA 2W80A 1RO2A 2NVXI 3S1QI 1QF8A 2BZMA 1N8R2 3HOWI 1USPB 1K83I 4E30A 1VQP1 3CPWY 1VQPZ 3CCJ1 4E2YA 3I561 2RHBA 5FO8C 1VVCA 3CMA1 4C16A 3I551 3CCJZ 3I56Z 1Q821 1QVFZ 5D1PA 2Y0SA 2OTL1 4AYIA 4MD8A 4E33A 4NBBA 3ERBA 2QRCB 4DJZA 1W2BZ 2NVTI 3VMGA 1VQ6Z 1QVGZ 2R92I 1S7MA 1YIJZ 1YUAA 3CALA 3CCV1 3I4MI 1YIT1 3CCVZ 2QEXZ 3GTMS 1WW9A 1HFHA 2YBYA 2XRBA 4RVHA 3CC71 3HOXI 1VQK1 1OK1A 1ML8A 1VQLZ 1QGBA 3CC7Z 1R9TI 1Z03A 3IFUA 1YI21 1VQKZ 3S2DI 1X3ZA 2GU2A 3ZD2A 4Y52I 2V8IA 3J80b 2K3RA 2YU9I 4Y7NI 1Q7Y2 1L1OC 5HYTB 2E2HI 3INBC 2PK7A 3G4S1 1TWCI 3T5OA 4NOZA 4A3JI 3G4SZ 1SFOI 5C44I 5FLXf 1VQN1 4E2ZA 1VQNZ 3QWUA 3MQLA 4MH4A 4F4OC 2GTIA 5LL6f 2I3CA 4NBFA 1Q862 1NJI1 3CCQZ 2EC3A 2XWBF 4WJG2 2ERJA 3CCM1 4DQYB 1KC81 3HOZI 1M1K2 3U50C 3HKZA 2MCYA 3TDHB 1NUIA 2J6AA 1Z02A 1OJWA 2AKLA 1Q3XA 2OOXB 1K731 3BG0B 1X3WA 5IP7I 3J81b 3ESWA 3NFPI 1TFIA 1P9NA 3CPWZ 1VQ81 4NBAA 1U5MA 4A3II 1VLAA 5HYUB 3CCU1 1RQFA 3CCUZ 4FXGG 1RO0A 4ZH1D 1QUBA 3TE5B 1TPMA 5C4JI 2MCZA 3CQZI 2K5RA 1TWAI 3O8EB 1KD11 3CC4Z 1YJ91 5JPMG 3NFZA 1GPZA 2QA41 3GCFA 4BY7I 2RLQA 1JJ2Y 4B2SA 5C3EI 3TVJA 1VQO1 1QYPA 2QY0A 3M4OI 4NBGA 2IZ3A 2JNYA 1VQ41 3GTQI 2PM9A 2WB1A 3VTNA 2R6MA 1TWGI 3NDJA 4NH1C 2RKZA 1K9M2 3KIHA 4HGYA 4AYDA 1QO6A 1GKNA 3EEDA 2DE6A 1VQ71 1Q811 2LFUA 2LIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG7 A;  1MD8 A;  3SW0 X;  4MUC A;  2O39 C;  4CSY A;  2LOJ A;  4KKD A;  3CAL A;  4JHS A;  2UWN A;  1C1Z A;  1HFH A;  2YBY A;  2XRB A;  3L89 M;  1H2P P;  1OK1 A;  4A5W B;  1ELV A;  2V8E A;  1QGB A;  4LOT A;  1GKG A;  1OJV A;  3ZD2 A;  1UOT P;  5HYT B;  1CKL A;  3INB C;  3T5O A;  4LOS A;  4IGD A;  4ONT D;  1ZJK A;  1PPQ A;  4K12 A;  4PZ5 A;  3MQL A;  3OED C;  2WII C;  4F4O C;  1O9A A;  3KXV A;  1OK2 A;  3OXU D;  1H2Q P;  2EC3 A;  1FBR A;  1GHQ B;  2XWB F;  3M7P A;  2ERJ A;  1HFI A;  4WJG 2;  1E5G A;  2JGX A;  2RLP A;  3OP8 A;  2MCY A;  5I0Q B;  2XQW C;  1OK3 A;  1SRZ A;  4AYE A;  3GXE A;  1OJW A;  2EHF A;  1Q3X A;  1HCC A;  2W81 A;  2A55 A;  1H04 P;  1VVD A;  1TPN A;  3NFP I;  2JGW A;  2KRI A;  1Z92 B;  4J38 B;  1OJY A;  1U5M A;  3GOV A;  5HYU B;  5HYP A;  2RKY A;  4FXG G;  4ZH1 D;  3ZRZ A;  1QUB A;  1G4G A;  2B5I D;  2IZ4 A;  1TPM A;  2MCZ A;  1SS2 A;  2CKU A;  3O8E B;  2JRA A;  1TPG A;  2YRA A;  4YNX A;  1LY2 A;  3ZD1 A;  2XRD A;  2RL0 A;  2KMS A;  5JPM G;  1GPZ A;  2G7I A;  4B2R A;  4AYM A;  2RLQ A;  2W80 A;  4B2S A;  3IU3 I;  1H03 P;  3EJH A;  3TVJ A;  2BZM A;  1OK9 A;  2QY0 A;  2IZ3 A;  5FO8 C;  1VVC A;  4C16 A;  2XWJ I;  3KZJ A;  3RJ3 D;  4AYI A;  2RKZ A;  1NWV A;  3ERB A;  4AYD A;  4DJZ A;  5HZP B;  1QO6 A;  1MD7 A;  1E88 A;  3IX0 A;  3R62 A;  1G4F A;  1GKN A;  1E8B A;  2CG6 A; 
#chains in the Genus database with same CATH topology
 1VQ7 Z;  1YUK A;  4MON A;  1WZN A;  3F3P C;  4NBH A;  4KKD A;  4JHS A;  2GTH A;  1Q82 2;  2UWN A;  4E31 A;  4DK1 A;  2V8K A;  2Q51 A;  1DL6 A;  4MXU A;  1GKG A;  2R7Z I;  2W03 A;  2QKD A;  1S72 1;  3CMA Z;  1I50 I;  3I55 Z;  4APL A;  1M90 2;  2OTL Z;  1NP6 A;  2NVQ I;  1CKL A;  1FDO A;  2OTJ 1;  5T64 A;  1ZJK A;  2E2I I;  4RVG A;  4A3E I;  3MZK B;  2WII C;  1YIT Z;  2QR1 B;  2F4M A;  1OK2 A;  3CC2 1;  2P28 A;  3CC2 Z;  2OZK A;  3D2L A;  3EER A;  2JIR A;  2Y8S A;  1N8R 1;  2JIM A;  1YI2 Z;  3S1R I;  1I3Q I;  2O53 A;  4NFR A;  3GXE A;  3HOV I;  2JA5 I;  2WAQ A;  1JJ2 Z;  3CCL 1;  1TPN A;  3CCL Z;  3S14 I;  4A93 I;  1WII A;  2JR6 A;  1Y1W I;  2JMO A;  4QTU A;  1OJY A;  2JIP A;  3S15 I;  2V8J A;  1YHQ 1;  3FKI I;  4MD7 A;  1WCM I;  2QRE B;  2RKY A;  1Z01 A;  1G4G A;  1YJW 1;  1K8A 1;  3CCM Z;  3LUS A;  2CKU A;  5A2Q b;  2YRA A;  3G71 1;  5IT9 f;  2RT9 A;  3GTP I;  3G71 Z;  2KMS A;  5DN4 A;  2V45 A;  3CME 1;  5FLX b;  3WSX A;  3CME Z;  3IU3 I;  1VQ8 Z;  4MSL A;  1VQ9 1;  3EJH A;  2JS4 A;  3MZL B;  1OK9 A;  4X6A I;  2DE7 A;  2M48 A;  1VQ9 Z;  1VQ5 1;  3PO3 I;  4TNU A;  4QTT A;  2XWJ I;  3M3Y I;  2M6N A;  3RJ3 D;  2O4H A;  3FGR A;  2LEX A;  1NWV A;  1G4F A;  3GKQ A;  3IX0 A;  3R62 A;  4NB9 A;  2R93 I;  2CG6 A;  3IR7 A;  2CG7 A;  1MD8 A;  3OW2 Y;  3GTK I;  4MD9 A;  4MUC A;  4CSY A;  2LOJ A;  3K7A I;  1YJ9 Z;  2QA4 Z;  3CXC Y;  3IF8 A;  4EWC A;  1C1Z A;  3D6W A;  1VQO Z;  4A5W B;  2V8E A;  4A3D I;  4A3G I;  4LOT A;  1Q81 2;  2QRD B;  2G2K A;  1VQ4 Z;  1KQS Y;  1UOT P;  3JAM f;  2W04 A;  5T67 A;  5C4X I;  3D9X A;  4ONT D;  1ZB8 A;  2VPZ A;  3GTG I;  1PPQ A;  4K12 A;  1I6H I;  2JA6 I;  1Y1V I;  2VPW A;  4PZ5 A;  3OED C;  1O9A A;  5CM2 M;  3KXV A;  2E2J I;  2P3Y A;  3M7P A;  1FBR A;  3ZLE A;  1JWH C;  3NJA A;  4DGL A;  1E5G A;  1LQL A;  2B63 I;  2JGX A;  3PO3 S;  3KIF A;  4NBC A;  3OP8 A;  3F6K A;  1TWF I;  1SRZ A;  4AYE A;  4RVF A;  3I4N I;  1YJN 1;  1S72 Z;  2EHF A;  1HCC A;  2W81 A;  1ZH1 A;  2ZYC A;  5D1O A;  2A55 A;  1YJN Z;  1H04 P;  2VUG A;  4RS4 A;  2VF1 A;  1K9M 1;  2OTJ Z;  2EGT A;  2KRI A;  2DE5 A;  1Z92 B;  4J38 B;  4RVD A;  3GOV A;  3T4N B;  5HYP A;  5IP9 I;  4BY1 I;  2AYD A;  3P5J B;  2ZAE B;  2B5I D;  2IZ4 A;  3J80 f;  1Q16 A;  2BJO A;  3J7A 4;  3GTO I;  3G6E 1;  2RIQ A;  2Q4Z A;  3OW2 Z;  3G6E Z;  1VQ6 1;  2PMZ A;  1Y8C A;  2JRA A;  1YIJ 1;  1VQM 1;  2VPY A;  3CXC Z;  1LY2 A;  3ZD1 A;  3CCE 1;  1VQM Z;  2RL0 A;  2XRD A;  2G7I A;  5FLM I;  3CCE Z;  1SIW A;  1M90 1;  4B2R A;  2YAD A;  2QEX 1;  1FDI A;  4AYM A;  1NJI 2;  5D1O B;  3Q87 A;  1KC8 2;  1K8A 2;  1Y1V S;  1H03 P;  4E2X A;  2JA8 I;  4S1T A;  2KI7 B;  1KQS Z;  2JUB A;  1VQL 1;  1ZB9 A;  1YHQ Z;  2NVY I;  2Y8R A;  1K73 2;  3KZJ A;  3CCR 1;  1YJW Z;  2I2L A;  5A2Q f;  2OOY B;  3CCR Z;  1AA6 A;  3CD6 1;  4A3L I;  3I07 A;  5HZP B;  4HH4 A;  3J81 f;  1MD7 A;  1E88 A;  3CD6 Z;  1E8B A;  4A3K I;  3NH4 A;  3GTJ I;  3SW0 X;  2O39 C;  2RPR A;  3VB9 A;  1Q7Y 1;  4A3F I;  1RLH A;  3S17 I;  3CCQ 1;  3L89 M;  1H2P P;  3K3T A;  3MON A;  4E2W A;  1ELV A;  1KD1 2;  3FQQ A;  4A3B I;  3H0G I;  1N2F A;  1VQ5 Z;  1OJV A;  4BBR I;  1PFT A;  4A3M I;  1Q86 1;  1RLY A;  4LOS A;  1QVF Y;  1M1K 1;  2KPI A;  5IT9 b;  4IGD A;  3FQM A;  3PO2 I;  1W2B Y;  2JIQ A;  1QVG Y;  4MRI A;  2E9H A;  3OXU D;  4NBE A;  3VMI A;  3BG1 B;  4CL1 A;  1H2Q P;  2HU9 A;  3HOU I;  1GHQ B;  2VUM I;  3S1M I;  1HFI A;  1RNI A;  3S16 I;  2QLV B;  2F4O A;  3F3F C;  3NDI A;  2RLP A;  4HGZ A;  2JA7 I;  3HOY I;  2E7Z A;  3S2H I;  5I0Q B;  4BBS I;  2XQW C;  1OK3 A;  4YIZ A;  3CC4 1;  1VVD A;  2Y8T A;  4RV9 A;  3S1N I;  3NH5 A;  2HF1 A;  4E32 A;  1RO4 A;  2JGW A;  1USP A;  4A3C I;  5AN9 F;  3GTM I;  3NH8 A;  1X0T A;  4NBD A;  4NB8 A;  3CCS 1;  4XX2 A;  1TWH I;  4PO7 A;  3CCS Z;  1KRL A;  3ZRZ A;  4BXX I;  2IV2 X;  1SS2 A;  2H85 A;  3GTL I;  2RBL A;  1TPG A;  3JAM b;  4YNX A;  3H3V J;  5T6B A;  3RZD I;  3RZO I;  3VMH A;  4AYB A;  2W80 A;  1RO2 A;  2NVX I;  3S1Q I;  1QF8 A;  2BZM A;  1WJ2 A;  2JIO A;  1N8R 2;  3HOW I;  1USP B;  1K83 I;  4E30 A;  1VQP 1;  3CPW Y;  1VQP Z;  3CCJ 1;  4E2Y A;  3I56 1;  2RHB A;  5FO8 C;  1VVC A;  3CMA 1;  4C16 A;  3I55 1;  3CCJ Z;  3I56 Z;  1Q82 1;  1QVF Z;  5D1P A;  2Y0S A;  2OTL 1;  4AYI A;  3FGT A;  4MD8 A;  4E33 A;  4NBB A;  3ERB A;  2QRC B;  4DJZ A;  1W2B Z;  2NVT I;  3VMG A;  1VQ6 Z;  1QVG Z;  2R92 I;  1S7M A;  1YIJ Z;  1YUA A;  3CAL A;  3CCV 1;  3I4M I;  1YIT 1;  3CCV Z;  2QEX Z;  3GTM S;  1WW9 A;  2V3V A;  1HFH A;  2YBY A;  2XRB A;  4RVH A;  3CC7 1;  3HOX I;  1VQK 1;  1OK1 A;  1ML8 A;  1VQL Z;  1QGB A;  3CC7 Z;  1R9T I;  1Z03 A;  3IFU A;  1YI2 1;  1VQK Z;  3S2D I;  1X3Z A;  2GU2 A;  3ZD2 A;  4Y52 I;  2V8I A;  2NAP A;  3J80 b;  3CI0 J;  2K3R A;  2YU9 I;  4Y7N I;  1Q7Y 2;  1L1O C;  5HYT B;  2E2H I;  3INB C;  2PK7 A;  3G4S 1;  1TWC I;  3T5O A;  3ZLD A;  4NOZ A;  4A3J I;  3VWO A;  3G4S Z;  1SFO I;  5C44 I;  5FLX f;  1VQN 1;  4E2Z A;  1VQN Z;  3QWU A;  5DN5 A;  3MQL A;  4MH4 A;  4F4O C;  2GTI A;  5LL6 f;  2I3C A;  4NBF A;  1Q86 2;  1NJI 1;  3CCQ Z;  2EC3 A;  2XWB F;  4WJG 2;  2ERJ A;  3CCM 1;  4DQY B;  1KC8 1;  3HOZ I;  1M1K 2;  3U50 C;  3HKZ A;  2MCY A;  3TDH B;  1NUI A;  2J6A A;  1Z02 A;  1OJW A;  2AKL A;  1Q3X A;  2OOX B;  1K73 1;  3BG0 B;  1X3W A;  5IP7 I;  3J81 b;  3ESW A;  3NFP I;  1TFI A;  1P9N A;  3CPW Z;  1VQ8 1;  4NBA A;  1U5M A;  4A3I I;  1VLA A;  5HYU B;  3CCU 1;  1RQF A;  3CCU Z;  4FXG G;  1RO0 A;  4ZH1 D;  1QUB A;  3TE5 B;  1TPM A;  5C4J I;  2MCZ A;  3CQZ I;  2K5R A;  1TWA I;  3O8E B;  1KD1 1;  3CC4 Z;  1YJ9 1;  2X2Z A;  5JPM G;  3NFZ A;  1GPZ A;  2QA4 1;  3GCF A;  1QXF A;  4BY7 I;  2VPX A;  2RLQ A;  1JJ2 Y;  4B2S A;  5C3E I;  3WSY A;  3TVJ A;  1VQO 1;  1QYP A;  2QY0 A;  3M4O I;  4NBG A;  2IZ3 A;  4BWC A;  2JNY A;  1VQ4 1;  4N7E A;  3GTQ I;  2PM9 A;  2WB1 A;  3VTN A;  2R6M A;  1TWG I;  3NDJ A;  4NH1 C;  2RKZ A;  1K9M 2;  3KIH A;  4HGY A;  4AYD A;  1QO6 A;  1GKN A;  3EED A;  2DE6 A;  1VQ7 1;  1Q81 1;  2LFU A;  2LIY A; 
#chains in the Genus database with same CATH homology
 1VQ7 Z;  1YUK A;  4MON A;  3F3P C;  4NBH A;  4KKD A;  4JHS A;  2GTH A;  1Q82 2;  2UWN A;  4E31 A;  4DK1 A;  2V8K A;  2Q51 A;  1DL6 A;  4MXU A;  1GKG A;  2R7Z I;  2W03 A;  2QKD A;  1S72 1;  3CMA Z;  1I50 I;  3I55 Z;  1M90 2;  2OTL Z;  1NP6 A;  2NVQ I;  1CKL A;  2OTJ 1;  5T64 A;  1ZJK A;  2E2I I;  4RVG A;  4A3E I;  3MZK B;  2WII C;  1YIT Z;  2QR1 B;  2F4M A;  1OK2 A;  3CC2 1;  2P28 A;  3CC2 Z;  2OZK A;  3EER A;  1N8R 1;  1YI2 Z;  3S1R I;  1I3Q I;  2O53 A;  4NFR A;  3GXE A;  3HOV I;  2JA5 I;  2WAQ A;  1JJ2 Z;  3CCL 1;  1TPN A;  3CCL Z;  3S14 I;  4A93 I;  1WII A;  2JR6 A;  1Y1W I;  2JMO A;  4QTU A;  1OJY A;  3S15 I;  2V8J A;  1YHQ 1;  3FKI I;  4MD7 A;  1WCM I;  2QRE B;  2RKY A;  1Z01 A;  1G4G A;  1YJW 1;  1K8A 1;  3CCM Z;  3LUS A;  2CKU A;  5A2Q b;  2YRA A;  3G71 1;  5IT9 f;  2RT9 A;  3GTP I;  3G71 Z;  2KMS A;  3CME 1;  5FLX b;  3CME Z;  3IU3 I;  1VQ8 Z;  1VQ9 1;  3EJH A;  3MZL B;  2JS4 A;  1OK9 A;  4X6A I;  2DE7 A;  2M48 A;  1VQ9 Z;  1VQ5 1;  3PO3 I;  4TNU A;  4QTT A;  2XWJ I;  3M3Y I;  2M6N A;  3RJ3 D;  2O4H A;  1NWV A;  1G4F A;  3GKQ A;  3IX0 A;  3R62 A;  4NB9 A;  2R93 I;  2CG6 A;  2CG7 A;  1MD8 A;  3OW2 Y;  3GTK I;  4MD9 A;  4MUC A;  4CSY A;  2LOJ A;  3K7A I;  1YJ9 Z;  2QA4 Z;  3CXC Y;  3IF8 A;  4EWC A;  1C1Z A;  3D6W A;  1VQO Z;  4A5W B;  2V8E A;  4A3D I;  4A3G I;  4LOT A;  1Q81 2;  2QRD B;  2G2K A;  1VQ4 Z;  1KQS Y;  1UOT P;  3JAM f;  2W04 A;  5T67 A;  5C4X I;  3D9X A;  4ONT D;  1ZB8 A;  3GTG I;  1PPQ A;  4K12 A;  1I6H I;  2JA6 I;  1Y1V I;  4PZ5 A;  3OED C;  1O9A A;  5CM2 M;  3KXV A;  2E2J I;  2P3Y A;  3M7P A;  1FBR A;  1JWH C;  4DGL A;  1E5G A;  1LQL A;  2B63 I;  2JGX A;  3PO3 S;  3KIF A;  4NBC A;  3OP8 A;  1TWF I;  1SRZ A;  4AYE A;  4RVF A;  3I4N I;  1YJN 1;  1S72 Z;  2EHF A;  1HCC A;  2W81 A;  1ZH1 A;  5D1O A;  2A55 A;  1YJN Z;  1H04 P;  2VUG A;  4RS4 A;  2VF1 A;  1K9M 1;  2OTJ Z;  2EGT A;  2KRI A;  2DE5 A;  1Z92 B;  4J38 B;  4RVD A;  3GOV A;  3T4N B;  5HYP A;  5IP9 I;  4BY1 I;  3P5J B;  2ZAE B;  2B5I D;  2IZ4 A;  3J80 f;  3J7A 4;  2BJO A;  3GTO I;  3G6E 1;  2RIQ A;  2Q4Z A;  3OW2 Z;  3G6E Z;  1VQ6 1;  2PMZ A;  2JRA A;  1YIJ 1;  1VQM 1;  3CXC Z;  1LY2 A;  3ZD1 A;  3CCE 1;  1VQM Z;  2XRD A;  2RL0 A;  2G7I A;  5FLM I;  3CCE Z;  1M90 1;  4B2R A;  2YAD A;  2QEX 1;  4AYM A;  1NJI 2;  5D1O B;  3Q87 A;  1KC8 2;  1K8A 2;  1Y1V S;  1H03 P;  4E2X A;  2JA8 I;  4S1T A;  2KI7 B;  1KQS Z;  2JUB A;  1VQL 1;  1ZB9 A;  1YHQ Z;  2NVY I;  1K73 2;  3KZJ A;  3CCR 1;  1YJW Z;  5A2Q f;  2OOY B;  3CCR Z;  3CD6 1;  4A3L I;  3I07 A;  5HZP B;  4HH4 A;  3J81 f;  1MD7 A;  1E88 A;  3CD6 Z;  1E8B A;  4A3K I;  3NH4 A;  3GTJ I;  3SW0 X;  2O39 C;  2RPR A;  3VB9 A;  1Q7Y 1;  4A3F I;  3S17 I;  3CCQ 1;  3L89 M;  1H2P P;  3MON A;  4E2W A;  1ELV A;  1KD1 2;  3FQQ A;  4A3B I;  3H0G I;  1N2F A;  1VQ5 Z;  1OJV A;  4BBR I;  1PFT A;  4A3M I;  1Q86 1;  1RLY A;  4LOS A;  1QVF Y;  1M1K 1;  2KPI A;  5IT9 b;  4IGD A;  3FQM A;  3PO2 I;  1W2B Y;  1QVG Y;  4MRI A;  2E9H A;  3OXU D;  4NBE A;  3VMI A;  3BG1 B;  4CL1 A;  1H2Q P;  2HU9 A;  3HOU I;  1GHQ B;  2VUM I;  3S1M I;  1HFI A;  1RNI A;  3S16 I;  2QLV B;  2F4O A;  3F3F C;  3NDI A;  2RLP A;  4HGZ A;  2JA7 I;  3HOY I;  3S2H I;  5I0Q B;  4BBS I;  2XQW C;  1OK3 A;  3CC4 1;  1VVD A;  3S1N I;  4RV9 A;  3NH5 A;  2HF1 A;  4E32 A;  1RO4 A;  2JGW A;  1USP A;  4A3C I;  5AN9 F;  3GTM I;  3NH8 A;  1X0T A;  4NBD A;  4NB8 A;  3CCS 1;  4XX2 A;  1TWH I;  3CCS Z;  1KRL A;  3ZRZ A;  4BXX I;  1SS2 A;  2H85 A;  3GTL I;  2RBL A;  1TPG A;  3JAM b;  4YNX A;  3H3V J;  5T6B A;  3RZD I;  3RZO I;  3VMH A;  4AYB A;  2W80 A;  1RO2 A;  2NVX I;  3S1Q I;  1QF8 A;  2BZM A;  1N8R 2;  3HOW I;  1USP B;  1K83 I;  4E30 A;  1VQP 1;  3CPW Y;  1VQP Z;  3CCJ 1;  4E2Y A;  3I56 1;  2RHB A;  5FO8 C;  1VVC A;  3CMA 1;  4C16 A;  3I55 1;  3CCJ Z;  3I56 Z;  1Q82 1;  1QVF Z;  5D1P A;  2Y0S A;  2OTL 1;  4AYI A;  4MD8 A;  4E33 A;  4NBB A;  3ERB A;  2QRC B;  4DJZ A;  1W2B Z;  2NVT I;  3VMG A;  1VQ6 Z;  1QVG Z;  2R92 I;  1S7M A;  1YIJ Z;  1YUA A;  3CAL A;  3CCV 1;  3I4M I;  1YIT 1;  3CCV Z;  2QEX Z;  3GTM S;  1WW9 A;  1HFH A;  2YBY A;  2XRB A;  4RVH A;  3CC7 1;  3HOX I;  1VQK 1;  1OK1 A;  1ML8 A;  1VQL Z;  1QGB A;  3CC7 Z;  1R9T I;  1Z03 A;  3IFU A;  1YI2 1;  1VQK Z;  3S2D I;  1X3Z A;  2GU2 A;  3ZD2 A;  4Y52 I;  2V8I A;  3J80 b;  2K3R A;  2YU9 I;  4Y7N I;  1Q7Y 2;  1L1O C;  5HYT B;  2E2H I;  3INB C;  2PK7 A;  3G4S 1;  1TWC I;  3T5O A;  4NOZ A;  4A3J I;  3G4S Z;  1SFO I;  5C44 I;  5FLX f;  1VQN 1;  4E2Z A;  1VQN Z;  3QWU A;  3MQL A;  4MH4 A;  4F4O C;  2GTI A;  5LL6 f;  2I3C A;  4NBF A;  1Q86 2;  1NJI 1;  3CCQ Z;  2EC3 A;  2XWB F;  4WJG 2;  2ERJ A;  3CCM 1;  4DQY B;  1KC8 1;  3HOZ I;  1M1K 2;  3U50 C;  3HKZ A;  2MCY A;  3TDH B;  1NUI A;  2J6A A;  1Z02 A;  1OJW A;  2AKL A;  1Q3X A;  2OOX B;  1K73 1;  3BG0 B;  1X3W A;  5IP7 I;  3J81 b;  3ESW A;  3NFP I;  1TFI A;  1P9N A;  3CPW Z;  1VQ8 1;  4NBA A;  1U5M A;  4A3I I;  1VLA A;  5HYU B;  3CCU 1;  1RQF A;  3CCU Z;  4FXG G;  1RO0 A;  4ZH1 D;  1QUB A;  3TE5 B;  1TPM A;  5C4J I;  2MCZ A;  3CQZ I;  2K5R A;  1TWA I;  3O8E B;  1KD1 1;  3CC4 Z;  1YJ9 1;  5JPM G;  3NFZ A;  1GPZ A;  2QA4 1;  3GCF A;  4BY7 I;  2RLQ A;  1JJ2 Y;  4B2S A;  5C3E I;  3TVJ A;  1VQO 1;  1QYP A;  2QY0 A;  3M4O I;  4NBG A;  2IZ3 A;  2JNY A;  1VQ4 1;  3GTQ I;  2PM9 A;  2WB1 A;  3VTN A;  2R6M A;  1TWG I;  3NDJ A;  4NH1 C;  2RKZ A;  1K9M 2;  3KIH A;  4HGY A;  4AYD A;  1QO6 A;  1GKN A;  3EED A;  2DE6 A;  1VQ7 1;  1Q81 1;  2LFU A;  2LIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...