1H2PP

Human cd55 domains 3 & 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
KSCPNPGQIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system protein
total genus 15
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h2pP02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h2pP01
1OK2A 1OJVA 3KZJA 2CKUA 4AYIA 4YNXA 2JGWA 3IX0A 3GXEA 4CSYA 3OEDC 2LOJA 4B2SA 1UOTP 1SRZA 2ERJA 3INBC 3KXVA 3ZD2A 4B2RA 4F4OC 3EJHA 2RLPA 1TPNA 2JGXA 2O39C 3TVJA 2A55A 2IZ3A 1H04P 3CALA 5JPMG 1VVCA 4IGDA 2XRDA 4WJG2 5FO8C 3RJ3D 2KRIA 3GOVA 4AYMA 1OK3A 3MQLA 3M7PA 2UWNA 1GKNA 4K12A 2QY0A 5I0QB 1H03P 4JHSA 2EHFA 3ERBA 2B5ID 3R62A 1HFIA 2G7IA 1ZJKA 4ZH1D 1GKGA 2XRBA 4ONTD 2JRAA 5HZPB 1QO6A 1TPGA 2XWJI 2XQWC 1Q3XA 3ZRZA 4DJZA 2YBYA 3L89M 2V8EA 4AYEA 4FXGG 1VVDA 1QUBA 1G4GA 1MD7A 1H2QP 1O9AA 1LY2A 1H2PP 3OXUD 4J38B 3OP8A 1CKLA 3SW0X 2MCYA 1E88A 2EC3A 1TPMA 4MUCA 3O8EB 1HFHA 2CG7A 4A5WB 1NWVA 4AYDA 2MCZA 3ZD1A 1FBRA 1HCCA 1OJWA 2RKYA 3NFPI 5HYTB 2RL0A 2RKZA 1QGBA 2IZ4A 2WIIC 2CG6A 2RLQA 1C1ZA 1GHQB 1OK9A 3T5OA 1ELVA 2XWBF 1E8BA 1MD8A 2YRAA 4LOTA 1Z92B 1G4FA 5HYPA 4LOSA 1SS2A 4PZ5A 1E5GA 5HYUB 4KKDA 1PPQA 2W80A 4C16A 1OK1A 3IU3I 2KMSA 1U5MA 1GPZA 1OJYA 2W81A 2BZMA
chains in the Genus database with same CATH superfamily
1OK2A 1OJVA 3KZJA 2CKUA 4AYIA 4YNXA 2JGWA 3IX0A 3NJAA 3GXEA 4CSYA 3ZLEA 3OEDC 2LOJA 4B2SA 3ZLDA 1UOTP 1SRZA 2ERJA 2I2LA 3INBC 3KXVA 3ZD2A 4B2RA 3EJHA 4N7EA 4F4OC 2RLPA 1TPNA 2JGXA 2O39C 4PO7A 4YIZA 3TVJA 2A55A 2IZ3A 4APLA 1H04P 3VWOA 3CALA 3CI0J 5JPMG 4MSLA 1VVCA 4IGDA 2XRDA 4WJG2 5FO8C 3RJ3D 2KRIA 3GOVA 4AYMA 1OK3A 3MQLA 1RLHA 3M7PA 2UWNA 1GKNA 4K12A 2QY0A 5I0QB 1H03P 4JHSA 2EHFA 3ERBA 5DN5A 3WSXA 2B5ID 3R62A 1HFIA 2G7IA 1ZJKA 4ZH1D 5DN4A 1GKGA 2XRBA 4ONTD 2JRAA 5HZPB 1QO6A 1TPGA 2XWJI 2XQWC 1Q3XA 3FGRA 3ZRZA 4DJZA 2YBYA 3L89M 2V8EA 4AYEA 4FXGG 1VVDA 1QUBA 1G4GA 3FGTA 1MD7A 1H2QP 1O9AA 1LY2A 1H2PP 3OXUD 4J38B 3OP8A 1CKLA 3SW0X 2X2ZA 2MCYA 1E88A 2EC3A 1TPMA 4MUCA 3WSYA 2Y8RA 3O8EB 1HFHA 2CG7A 4A5WB 1NWVA 4AYDA 2MCZA 3ZD1A 1FBRA 1HCCA 1OJWA 3F6KA 2RKYA 3NFPI 5HYTB 2RL0A 2RKZA 3K3TA 1QGBA 2IZ4A 2WIIC 2CG6A 2RLQA 1C1ZA 1GHQB 1OK9A 3T5OA 1ELVA 2XWBF 1E8BA 1MD8A 2YRAA 4LOTA 1Z92B 1G4FA 5HYPA 4LOSA 1SS2A 4PZ5A 1E5GA 5HYUB 4KKDA 1PPQA 2W80A 4C16A 2Y8SA 2Y8TA 1OK1A 2ZYCA 3IU3I 2KMSA 1U5MA 1GPZA 1OJYA 4BWCA 2W81A 2BZMA
chains in the Genus database with same CATH topology
1OK2A 1OJVA 3KZJA 2CKUA 4AYIA 4YNXA 2JGWA 3IX0A 3GXEA 4CSYA 3OEDC 2LOJA 4B2SA 1UOTP 1SRZA 2ERJA 3INBC 3KXVA 3ZD2A 4B2RA 4F4OC 3EJHA 2RLPA 1TPNA 2JGXA 2O39C 3TVJA 2A55A 2IZ3A 1H04P 3CALA 5JPMG 1VVCA 4IGDA 2XRDA 4WJG2 5FO8C 3RJ3D 2KRIA 3GOVA 4AYMA 1OK3A 3MQLA 3M7PA 2UWNA 1GKNA 4K12A 2QY0A 5I0QB 1H03P 4JHSA 2EHFA 3ERBA 2B5ID 3R62A 1HFIA 2G7IA 1ZJKA 4ZH1D 1GKGA 2XRBA 4ONTD 2JRAA 5HZPB 1QO6A 1TPGA 2XWJI 2XQWC 1Q3XA 3ZRZA 4DJZA 2YBYA 3L89M 2V8EA 4AYEA 4FXGG 1VVDA 1QUBA 1G4GA 1MD7A 1H2QP 1O9AA 1LY2A 1H2PP 3OXUD 4J38B 3OP8A 1CKLA 3SW0X 2MCYA 1E88A 2EC3A 1TPMA 4MUCA 3O8EB 1HFHA 2CG7A 4A5WB 1NWVA 4AYDA 2MCZA 3ZD1A 1FBRA 1HCCA 1OJWA 2RKYA 3NFPI 5HYTB 2RL0A 2RKZA 1QGBA 2IZ4A 2WIIC 2CG6A 2RLQA 1C1ZA 1GHQB 1OK9A 3T5OA 1ELVA 2XWBF 1E8BA 1MD8A 2YRAA 4LOTA 1Z92B 1G4FA 5HYPA 4LOSA 1SS2A 4PZ5A 1E5GA 5HYUB 4KKDA 1PPQA 2W80A 4C16A 1OK1A 3IU3I 2KMSA 1U5MA 1GPZA 1OJYA 2W81A 2BZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OK2 A;  1OJV A;  3KZJ A;  2CKU A;  4AYI A;  4YNX A;  2JGW A;  3IX0 A;  3GXE A;  4CSY A;  3OED C;  2LOJ A;  4B2S A;  1UOT P;  1SRZ A;  2ERJ A;  3INB C;  3KXV A;  3ZD2 A;  4B2R A;  4F4O C;  3EJH A;  2RLP A;  1TPN A;  2JGX A;  2O39 C;  3TVJ A;  2A55 A;  2IZ3 A;  1H04 P;  3CAL A;  5JPM G;  1VVC A;  4IGD A;  2XRD A;  4WJG 2;  5FO8 C;  3RJ3 D;  2KRI A;  3GOV A;  4AYM A;  1OK3 A;  3MQL A;  3M7P A;  2UWN A;  1GKN A;  4K12 A;  2QY0 A;  5I0Q B;  1H03 P;  4JHS A;  2EHF A;  3ERB A;  2B5I D;  3R62 A;  1HFI A;  2G7I A;  1ZJK A;  4ZH1 D;  1GKG A;  2XRB A;  4ONT D;  2JRA A;  5HZP B;  1QO6 A;  1TPG A;  2XWJ I;  2XQW C;  1Q3X A;  3ZRZ A;  4DJZ A;  2YBY A;  3L89 M;  2V8E A;  4AYE A;  4FXG G;  1VVD A;  1QUB A;  1G4G A;  1MD7 A;  1H2Q P;  1O9A A;  1LY2 A;  1H2P P;  3OXU D;  4J38 B;  3OP8 A;  1CKL A;  3SW0 X;  2MCY A;  1E88 A;  2EC3 A;  1TPM A;  4MUC A;  3O8E B;  1HFH A;  2CG7 A;  4A5W B;  1NWV A;  4AYD A;  2MCZ A;  3ZD1 A;  1FBR A;  1HCC A;  1OJW A;  2RKY A;  3NFP I;  5HYT B;  2RL0 A;  2RKZ A;  1QGB A;  2IZ4 A;  2WII C;  2CG6 A;  2RLQ A;  1C1Z A;  1GHQ B;  1OK9 A;  3T5O A;  1ELV A;  2XWB F;  1E8B A;  1MD8 A;  2YRA A;  4LOT A;  1Z92 B;  1G4F A;  5HYP A;  4LOS A;  1SS2 A;  4PZ5 A;  1E5G A;  5HYU B;  4KKD A;  1PPQ A;  2W80 A;  4C16 A;  1OK1 A;  3IU3 I;  2KMS A;  1U5M A;  1GPZ A;  1OJY A;  2W81 A;  2BZM A; 
#chains in the Genus database with same CATH topology
 1OK2 A;  1OJV A;  3KZJ A;  2CKU A;  4AYI A;  4YNX A;  2JGW A;  3IX0 A;  3NJA A;  3GXE A;  4CSY A;  3ZLE A;  3OED C;  2LOJ A;  4B2S A;  3ZLD A;  1UOT P;  1SRZ A;  2ERJ A;  2I2L A;  3INB C;  3KXV A;  3ZD2 A;  4B2R A;  3EJH A;  4N7E A;  4F4O C;  2RLP A;  1TPN A;  2JGX A;  2O39 C;  4PO7 A;  4YIZ A;  3TVJ A;  2A55 A;  2IZ3 A;  4APL A;  1H04 P;  3VWO A;  3CAL A;  3CI0 J;  5JPM G;  4MSL A;  1VVC A;  4IGD A;  2XRD A;  4WJG 2;  5FO8 C;  3RJ3 D;  2KRI A;  3GOV A;  4AYM A;  1OK3 A;  3MQL A;  1RLH A;  3M7P A;  2UWN A;  1GKN A;  4K12 A;  2QY0 A;  5I0Q B;  1H03 P;  4JHS A;  2EHF A;  3ERB A;  5DN5 A;  3WSX A;  2B5I D;  3R62 A;  1HFI A;  2G7I A;  1ZJK A;  4ZH1 D;  5DN4 A;  1GKG A;  2XRB A;  4ONT D;  2JRA A;  5HZP B;  1QO6 A;  1TPG A;  2XWJ I;  2XQW C;  1Q3X A;  3FGR A;  3ZRZ A;  4DJZ A;  2YBY A;  3L89 M;  2V8E A;  4AYE A;  4FXG G;  1VVD A;  1QUB A;  1G4G A;  3FGT A;  1MD7 A;  1H2Q P;  1O9A A;  1LY2 A;  1H2P P;  3OXU D;  4J38 B;  3OP8 A;  1CKL A;  3SW0 X;  2X2Z A;  2MCY A;  1E88 A;  2EC3 A;  1TPM A;  4MUC A;  3WSY A;  2Y8R A;  3O8E B;  1HFH A;  2CG7 A;  4A5W B;  1NWV A;  4AYD A;  2MCZ A;  3ZD1 A;  1FBR A;  1HCC A;  1OJW A;  3F6K A;  2RKY A;  3NFP I;  5HYT B;  2RL0 A;  2RKZ A;  3K3T A;  1QGB A;  2IZ4 A;  2WII C;  2CG6 A;  2RLQ A;  1C1Z A;  1GHQ B;  1OK9 A;  3T5O A;  1ELV A;  2XWB F;  1E8B A;  1MD8 A;  2YRA A;  4LOT A;  1Z92 B;  1G4F A;  5HYP A;  4LOS A;  1SS2 A;  4PZ5 A;  1E5G A;  5HYU B;  4KKD A;  1PPQ A;  2W80 A;  4C16 A;  2Y8S A;  2Y8T A;  1OK1 A;  2ZYC A;  3IU3 I;  2KMS A;  1U5M A;  1GPZ A;  1OJY A;  4BWC A;  2W81 A;  2BZM A; 
#chains in the Genus database with same CATH homology
 1OK2 A;  1OJV A;  3KZJ A;  2CKU A;  4AYI A;  4YNX A;  2JGW A;  3IX0 A;  3GXE A;  4CSY A;  3OED C;  2LOJ A;  4B2S A;  1UOT P;  1SRZ A;  2ERJ A;  3INB C;  3KXV A;  3ZD2 A;  4B2R A;  4F4O C;  3EJH A;  2RLP A;  1TPN A;  2JGX A;  2O39 C;  3TVJ A;  2A55 A;  2IZ3 A;  1H04 P;  3CAL A;  5JPM G;  1VVC A;  4IGD A;  2XRD A;  4WJG 2;  5FO8 C;  3RJ3 D;  2KRI A;  3GOV A;  4AYM A;  1OK3 A;  3MQL A;  3M7P A;  2UWN A;  1GKN A;  4K12 A;  2QY0 A;  5I0Q B;  1H03 P;  4JHS A;  2EHF A;  3ERB A;  2B5I D;  3R62 A;  1HFI A;  2G7I A;  1ZJK A;  4ZH1 D;  1GKG A;  2XRB A;  4ONT D;  2JRA A;  5HZP B;  1QO6 A;  1TPG A;  2XWJ I;  2XQW C;  1Q3X A;  3ZRZ A;  4DJZ A;  2YBY A;  3L89 M;  2V8E A;  4AYE A;  4FXG G;  1VVD A;  1QUB A;  1G4G A;  1MD7 A;  1H2Q P;  1O9A A;  1LY2 A;  1H2P P;  3OXU D;  4J38 B;  3OP8 A;  1CKL A;  3SW0 X;  2MCY A;  1E88 A;  2EC3 A;  1TPM A;  4MUC A;  3O8E B;  1HFH A;  2CG7 A;  4A5W B;  1NWV A;  4AYD A;  2MCZ A;  3ZD1 A;  1FBR A;  1HCC A;  1OJW A;  2RKY A;  3NFP I;  5HYT B;  2RL0 A;  2RKZ A;  1QGB A;  2IZ4 A;  2WII C;  2CG6 A;  2RLQ A;  1C1Z A;  1GHQ B;  1OK9 A;  3T5O A;  1ELV A;  2XWB F;  1E8B A;  1MD8 A;  2YRA A;  4LOT A;  1Z92 B;  1G4F A;  5HYP A;  4LOS A;  1SS2 A;  4PZ5 A;  1E5G A;  5HYU B;  4KKD A;  1PPQ A;  2W80 A;  4C16 A;  1OK1 A;  3IU3 I;  2KMS A;  1U5M A;  1GPZ A;  1OJY A;  2W81 A;  2BZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...