1H2PP

Human cd55 domains 3 & 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
b'KSCPNPGQIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system protein
total genus 15
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2002-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h2pP02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h2pP01
1C1ZA 4K12A 4A5WB 1O9AA 3INBC 2RL0A 3ZD1A 1SS2A 1ZJKA 2RKZA 3OP8A 1OJVA 1HFHA 1HCCA 3MQLA 4LOSA 1ELVA 2CG6A 5HZPB 1OK2A 1OK1A 3ZD2A 1Q3XA 2XWBF 1QGBA 2IZ4A 1SRZA 4PZ5A 3GXEA 4LOTA 2QY0A 2RKYA 3O8EB 1GHQB 3ZRZA 5I0QB 3RJ3D 1U5MA 2YBYA 1G4GA 3KZJA 3OEDC 5HYTB 3R62A 2EC3A 4AYMA 2XQWC 2KRIA 2WIIC 2RLQA 4CSYA 1UOTP 1OK3A 1Z92B 3L89M 5JPMG 3GOVA 2MCYA 5HYUB 4AYEA 2XWJI 4IGDA 1E8BA 1H2QP 3M7PA 1GKNA 3NFPI 3IU3I 2BZMA 1PPQA 1H2PP 1OJYA 1H03P 1G4FA 1TPGA 2RLPA 3T5OA 3TVJA 4AYIA 2CG7A 2CKUA 1QO6A 4B2SA 1QUBA 1E88A 2LOJA 2IZ3A 1OK9A 4F4OC 4C16A 2JGWA 3SW0X 2O39C 1LY2A 1GKGA 2JGXA 4MUCA 1MD7A 3IX0A 4FXGG 2A55A 4ZH1D 4WJG2 1GPZA 3OXUD 2W81A 5HYPA 4JHSA 2EHFA 2ERJA 4AYDA 2UWNA 2G7IA 3EJHA 1CKLA 2B5ID 4B2RA 1MD8A 1HFIA 2XRBA 2MCZA 3ERBA 1NWVA 1TPMA 1VVCA 1TPNA 4J38B 4KKDA 2W80A 2V8EA 2XRDA 5FO8C 4ONTD 1VVDA 3CALA 4YNXA 1E5GA 3KXVA 2JRAA 2KMSA 4DJZA 1FBRA 1H04P 2YRAA 1OJWA
chains in the Genus database with same CATH superfamily
1C1ZA 4K12A 4A5WB 4APLA 1O9AA 4MSLA 3INBC 2RL0A 3ZD1A 1SS2A 1ZJKA 2RKZA 3OP8A 1OJVA 1HFHA 4N7EA 1HCCA 3MQLA 4LOSA 1ELVA 2CG6A 5HZPB 1OK2A 1OK1A 3ZD2A 1Q3XA 3F6KA 2XWBF 1QGBA 2IZ4A 1SRZA 4PZ5A 3GXEA 2X2ZA 4LOTA 2QY0A 2RKYA 3FGTA 3O8EB 1GHQB 3ZRZA 5I0QB 3RJ3D 1U5MA 5DN4A 2YBYA 1G4GA 3KZJA 3OEDC 5HYTB 3R62A 2EC3A 4AYMA 2XQWC 2KRIA 2WIIC 2RLQA 4CSYA 1UOTP 1OK3A 1Z92B 3L89M 5JPMG 3GOVA 2MCYA 5HYUB 4AYEA 3ZLDA 3WSYA 2XWJI 4IGDA 1E8BA 1H2QP 3M7PA 1GKNA 3NFPI 3IU3I 2BZMA 2I2LA 1PPQA 1H2PP 1OJYA 1H03P 2ZYCA 1G4FA 1TPGA 2RLPA 3T5OA 3WSXA 3TVJA 4AYIA 3NJAA 2CG7A 2CKUA 1QO6A 4B2SA 1QUBA 1E88A 2LOJA 2IZ3A 4BWCA 3VWOA 1OK9A 4F4OC 4C16A 2JGWA 3SW0X 2O39C 1LY2A 1GKGA 2JGXA 4MUCA 3CI0J 3ZLEA 1MD7A 3IX0A 4FXGG 2A55A 4ZH1D 5DN5A 4WJG2 2Y8TA 1GPZA 1RLHA 3OXUD 2W81A 5HYPA 4JHSA 2EHFA 2ERJA 4AYDA 2UWNA 2G7IA 3FGRA 3EJHA 1CKLA 2B5ID 4B2RA 1MD8A 1HFIA 2Y8SA 2XRBA 2MCZA 3ERBA 1NWVA 1TPMA 1VVCA 1TPNA 4J38B 4KKDA 2W80A 4PO7A 2V8EA 2XRDA 4YIZA 3K3TA 5FO8C 4ONTD 1VVDA 3CALA 4YNXA 1E5GA 3KXVA 2JRAA 2KMSA 4DJZA 1FBRA 1H04P 2Y8RA 2YRAA 1OJWA
chains in the Genus database with same CATH topology
1C1ZA 4K12A 4A5WB 1O9AA 3INBC 2RL0A 3ZD1A 1SS2A 1ZJKA 2RKZA 3OP8A 1OJVA 1HFHA 1HCCA 3MQLA 4LOSA 1ELVA 2CG6A 5HZPB 1OK2A 1OK1A 3ZD2A 1Q3XA 2XWBF 1QGBA 2IZ4A 1SRZA 4PZ5A 3GXEA 4LOTA 2QY0A 2RKYA 3O8EB 1GHQB 3ZRZA 5I0QB 3RJ3D 1U5MA 2YBYA 1G4GA 3KZJA 3OEDC 5HYTB 3R62A 2EC3A 4AYMA 2XQWC 2KRIA 2WIIC 2RLQA 4CSYA 1UOTP 1OK3A 1Z92B 3L89M 5JPMG 3GOVA 2MCYA 5HYUB 4AYEA 2XWJI 4IGDA 1E8BA 1H2QP 3M7PA 1GKNA 3NFPI 3IU3I 2BZMA 1PPQA 1H2PP 1OJYA 1H03P 1G4FA 1TPGA 2RLPA 3T5OA 3TVJA 4AYIA 2CG7A 2CKUA 1QO6A 4B2SA 1QUBA 1E88A 2LOJA 2IZ3A 1OK9A 4F4OC 4C16A 2JGWA 3SW0X 2O39C 1LY2A 1GKGA 2JGXA 4MUCA 1MD7A 3IX0A 4FXGG 2A55A 4ZH1D 4WJG2 1GPZA 3OXUD 2W81A 5HYPA 4JHSA 2EHFA 2ERJA 4AYDA 2UWNA 2G7IA 3EJHA 1CKLA 2B5ID 4B2RA 1MD8A 1HFIA 2XRBA 2MCZA 3ERBA 1NWVA 1TPMA 1VVCA 1TPNA 4J38B 4KKDA 2W80A 2V8EA 2XRDA 5FO8C 4ONTD 1VVDA 3CALA 4YNXA 1E5GA 3KXVA 2JRAA 2KMSA 4DJZA 1FBRA 1H04P 2YRAA 1OJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C1Z A;  4K12 A;  4A5W B;  1O9A A;  3INB C;  2RL0 A;  3ZD1 A;  1SS2 A;  1ZJK A;  2RKZ A;  3OP8 A;  1OJV A;  1HFH A;  1HCC A;  3MQL A;  4LOS A;  1ELV A;  2CG6 A;  5HZP B;  1OK2 A;  1OK1 A;  3ZD2 A;  1Q3X A;  2XWB F;  1QGB A;  2IZ4 A;  1SRZ A;  4PZ5 A;  3GXE A;  4LOT A;  2QY0 A;  2RKY A;  3O8E B;  1GHQ B;  3ZRZ A;  5I0Q B;  3RJ3 D;  1U5M A;  2YBY A;  1G4G A;  3KZJ A;  3OED C;  5HYT B;  3R62 A;  2EC3 A;  4AYM A;  2XQW C;  2KRI A;  2WII C;  2RLQ A;  4CSY A;  1UOT P;  1OK3 A;  1Z92 B;  3L89 M;  5JPM G;  3GOV A;  2MCY A;  5HYU B;  4AYE A;  2XWJ I;  4IGD A;  1E8B A;  1H2Q P;  3M7P A;  1GKN A;  3NFP I;  3IU3 I;  2BZM A;  1PPQ A;  1H2P P;  1OJY A;  1H03 P;  1G4F A;  1TPG A;  2RLP A;  3T5O A;  3TVJ A;  4AYI A;  2CG7 A;  2CKU A;  1QO6 A;  4B2S A;  1QUB A;  1E88 A;  2LOJ A;  2IZ3 A;  1OK9 A;  4F4O C;  4C16 A;  2JGW A;  3SW0 X;  2O39 C;  1LY2 A;  1GKG A;  2JGX A;  4MUC A;  1MD7 A;  3IX0 A;  4FXG G;  2A55 A;  4ZH1 D;  4WJG 2;  1GPZ A;  3OXU D;  2W81 A;  5HYP A;  4JHS A;  2EHF A;  2ERJ A;  4AYD A;  2UWN A;  2G7I A;  3EJH A;  1CKL A;  2B5I D;  4B2R A;  1MD8 A;  1HFI A;  2XRB A;  2MCZ A;  3ERB A;  1NWV A;  1TPM A;  1VVC A;  1TPN A;  4J38 B;  4KKD A;  2W80 A;  2V8E A;  2XRD A;  5FO8 C;  4ONT D;  1VVD A;  3CAL A;  4YNX A;  1E5G A;  3KXV A;  2JRA A;  2KMS A;  4DJZ A;  1FBR A;  1H04 P;  2YRA A;  1OJW A; 
#chains in the Genus database with same CATH topology
 1C1Z A;  4K12 A;  4A5W B;  4APL A;  1O9A A;  4MSL A;  3INB C;  2RL0 A;  3ZD1 A;  1SS2 A;  1ZJK A;  2RKZ A;  3OP8 A;  1OJV A;  1HFH A;  4N7E A;  1HCC A;  3MQL A;  4LOS A;  1ELV A;  2CG6 A;  5HZP B;  1OK2 A;  1OK1 A;  3ZD2 A;  1Q3X A;  3F6K A;  2XWB F;  1QGB A;  2IZ4 A;  1SRZ A;  4PZ5 A;  3GXE A;  2X2Z A;  4LOT A;  2QY0 A;  2RKY A;  3FGT A;  3O8E B;  1GHQ B;  3ZRZ A;  5I0Q B;  3RJ3 D;  1U5M A;  5DN4 A;  2YBY A;  1G4G A;  3KZJ A;  3OED C;  5HYT B;  3R62 A;  2EC3 A;  4AYM A;  2XQW C;  2KRI A;  2WII C;  2RLQ A;  4CSY A;  1UOT P;  1OK3 A;  1Z92 B;  3L89 M;  5JPM G;  3GOV A;  2MCY A;  5HYU B;  4AYE A;  3ZLD A;  3WSY A;  2XWJ I;  4IGD A;  1E8B A;  1H2Q P;  3M7P A;  1GKN A;  3NFP I;  3IU3 I;  2BZM A;  2I2L A;  1PPQ A;  1H2P P;  1OJY A;  1H03 P;  2ZYC A;  1G4F A;  1TPG A;  2RLP A;  3T5O A;  3WSX A;  3TVJ A;  4AYI A;  3NJA A;  2CG7 A;  2CKU A;  1QO6 A;  4B2S A;  1QUB A;  1E88 A;  2LOJ A;  2IZ3 A;  4BWC A;  3VWO A;  1OK9 A;  4F4O C;  4C16 A;  2JGW A;  3SW0 X;  2O39 C;  1LY2 A;  1GKG A;  2JGX A;  4MUC A;  3CI0 J;  3ZLE A;  1MD7 A;  3IX0 A;  4FXG G;  2A55 A;  4ZH1 D;  5DN5 A;  4WJG 2;  2Y8T A;  1GPZ A;  1RLH A;  3OXU D;  2W81 A;  5HYP A;  4JHS A;  2EHF A;  2ERJ A;  4AYD A;  2UWN A;  2G7I A;  3FGR A;  3EJH A;  1CKL A;  2B5I D;  4B2R A;  1MD8 A;  1HFI A;  2Y8S A;  2XRB A;  2MCZ A;  3ERB A;  1NWV A;  1TPM A;  1VVC A;  1TPN A;  4J38 B;  4KKD A;  2W80 A;  4PO7 A;  2V8E A;  2XRD A;  4YIZ A;  3K3T A;  5FO8 C;  4ONT D;  1VVD A;  3CAL A;  4YNX A;  1E5G A;  3KXV A;  2JRA A;  2KMS A;  4DJZ A;  1FBR A;  1H04 P;  2Y8R A;  2YRA A;  1OJW A; 
#chains in the Genus database with same CATH homology
 1C1Z A;  4K12 A;  4A5W B;  1O9A A;  3INB C;  2RL0 A;  3ZD1 A;  1SS2 A;  1ZJK A;  2RKZ A;  3OP8 A;  1OJV A;  1HFH A;  1HCC A;  3MQL A;  4LOS A;  1ELV A;  2CG6 A;  5HZP B;  1OK2 A;  1OK1 A;  3ZD2 A;  1Q3X A;  2XWB F;  1QGB A;  2IZ4 A;  1SRZ A;  4PZ5 A;  3GXE A;  4LOT A;  2QY0 A;  2RKY A;  3O8E B;  1GHQ B;  3ZRZ A;  5I0Q B;  3RJ3 D;  1U5M A;  2YBY A;  1G4G A;  3KZJ A;  3OED C;  5HYT B;  3R62 A;  2EC3 A;  4AYM A;  2XQW C;  2KRI A;  2WII C;  2RLQ A;  4CSY A;  1UOT P;  1OK3 A;  1Z92 B;  3L89 M;  5JPM G;  3GOV A;  2MCY A;  5HYU B;  4AYE A;  2XWJ I;  4IGD A;  1E8B A;  1H2Q P;  3M7P A;  1GKN A;  3NFP I;  3IU3 I;  2BZM A;  1PPQ A;  1H2P P;  1OJY A;  1H03 P;  1G4F A;  1TPG A;  2RLP A;  3T5O A;  3TVJ A;  4AYI A;  2CG7 A;  2CKU A;  1QO6 A;  4B2S A;  1QUB A;  1E88 A;  2LOJ A;  2IZ3 A;  1OK9 A;  4F4O C;  4C16 A;  2JGW A;  3SW0 X;  2O39 C;  1LY2 A;  1GKG A;  2JGX A;  4MUC A;  1MD7 A;  3IX0 A;  4FXG G;  2A55 A;  4ZH1 D;  4WJG 2;  1GPZ A;  3OXU D;  2W81 A;  5HYP A;  4JHS A;  2EHF A;  2ERJ A;  4AYD A;  2UWN A;  2G7I A;  3EJH A;  1CKL A;  2B5I D;  4B2R A;  1MD8 A;  1HFI A;  2XRB A;  2MCZ A;  3ERB A;  1NWV A;  1TPM A;  1VVC A;  1TPN A;  4J38 B;  4KKD A;  2W80 A;  2V8E A;  2XRD A;  5FO8 C;  4ONT D;  1VVD A;  3CAL A;  4YNX A;  1E5G A;  3KXV A;  2JRA A;  2KMS A;  4DJZ A;  1FBR A;  1H04 P;  2YRA A;  1OJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...