2Y8SA

Co-structure of an ama1 mutant (y230a) with a surface exposed region of ron2 from toxoplasma gondii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
411
structure length
386
Chain Sequence
GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILAVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN, PUTATIVE
publication title Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of Ama1 with a Ron2 Peptide
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 97
structure length 386
sequence length 411
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2y8sA03
4YIZA 2Y8RA 4APLA 2Y8TA 2Y8SA 3ZLDA 2X2ZA 3ZLEA
chains in the Genus database with same CATH superfamily
2CG7A 1VVDA 1ZJKA 3OEDC 1MD8A 2JRAA 2ERJA 2XWJI 1QUBA 1H2PP 2BZMA 1G4FA 2A55A 1OK3A 3M7PA 4YIZA 1TPGA 1U5MA 3OXUD 4LOSA 2RLPA 2V8EA 4YNXA 2LOJA 1OJWA 1G4GA 5DN4A 2WIIC 1NWVA 3OP8A 1ELVA 4C16A 4N7EA 2QY0A 4AYMA 2W81A 3R62A 1GPZA 3ZD1A 2XRBA 4JHSA 4IGDA 4B2RA 2RKYA 1SS2A 3NJAA 4F4OC 4WJG2 1QGBA 4B2SA 4DJZA 1OK2A 1LY2A 3WSYA 2RL0A 2RLQA 2UWNA 1H04P 5DN5A 1C1ZA 3T5OA 1GKGA 1HCCA 1E5GA 2YRAA 2XQWC 3IU3I 2RKZA 4BWCA 3K3TA 4ONTD 1FBRA 3L89M 1Q3XA 2MCYA 4AYEA 4PZ5A 5FO8C 1PPQA 2X2ZA 4APLA 1HFHA 2KRIA 1RLHA 1OK9A 2Y8RA 1OK1A 2Y8TA 5HYUB 4AYDA 2CKUA 2IZ4A 4LOTA 3O8EB 4FXGG 2G7IA 5HYPA 1E88A 2JGXA 2KMSA 1SRZA 2CG6A 2MCZA 3ERBA 1TPMA 4K12A 3VWOA 2ZYCA 3ZLEA 3GOVA 5JPMG 4CSYA 2B5ID 2Y8SA 1OJYA 3INBC 2XRDA 3TVJA 3ZLDA 2XWBF 1QO6A 3KZJA 3CALA 2IZ3A 3NFPI 1GKNA 1MD7A 2EC3A 2I2LA 1TPNA 3ZD2A 1H03P 2EHFA 4ZH1D 5I0QB 3FGRA 3WSXA 3GXEA 1H2QP 4PO7A 5HYTB 1UOTP 1Z92B 1OJVA 3FGTA 2YBYA 4J38B 1E8BA 3CI0J 3ZRZA 1HFIA 3IX0A 2JGWA 5HZPB 4AYIA 1VVCA 1CKLA 1O9AA 3EJHA 3RJ3D 3KXVA 2O39C 3F6KA 3MQLA 4MUCA 1GHQB 4MSLA 2W80A 4A5WB 4KKDA 3SW0X
chains in the Genus database with same CATH topology
2I2LA 2Y8RA 3FGRA 2X2ZA 2Y8TA 3WSXA 4PO7A 3NJAA 3FGTA 3ZLEA 3WSYA 4YIZA 2Y8SA 3ZLDA 4BWCA 3F6KA 4MSLA 4APLA 4N7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YIZ A;  2Y8R A;  4APL A;  2Y8T A;  2Y8S A;  3ZLD A;  2X2Z A;  3ZLE A; 
#chains in the Genus database with same CATH topology
 2CG7 A;  1VVD A;  1ZJK A;  3OED C;  1MD8 A;  2JRA A;  2ERJ A;  2XWJ I;  1QUB A;  1H2P P;  2BZM A;  1G4F A;  2A55 A;  1OK3 A;  3M7P A;  4YIZ A;  1TPG A;  1U5M A;  3OXU D;  4LOS A;  2RLP A;  2V8E A;  4YNX A;  2LOJ A;  1OJW A;  1G4G A;  5DN4 A;  2WII C;  1NWV A;  3OP8 A;  1ELV A;  4C16 A;  4N7E A;  2QY0 A;  4AYM A;  2W81 A;  3R62 A;  1GPZ A;  3ZD1 A;  2XRB A;  4JHS A;  4IGD A;  4B2R A;  2RKY A;  1SS2 A;  3NJA A;  4F4O C;  4WJG 2;  1QGB A;  4B2S A;  4DJZ A;  1OK2 A;  1LY2 A;  3WSY A;  2RL0 A;  2RLQ A;  2UWN A;  1H04 P;  5DN5 A;  1C1Z A;  3T5O A;  1GKG A;  1HCC A;  1E5G A;  2YRA A;  2XQW C;  3IU3 I;  2RKZ A;  4BWC A;  3K3T A;  4ONT D;  1FBR A;  3L89 M;  1Q3X A;  2MCY A;  4AYE A;  4PZ5 A;  5FO8 C;  1PPQ A;  2X2Z A;  4APL A;  1HFH A;  2KRI A;  1RLH A;  1OK9 A;  2Y8R A;  1OK1 A;  2Y8T A;  5HYU B;  4AYD A;  2CKU A;  2IZ4 A;  4LOT A;  3O8E B;  4FXG G;  2G7I A;  5HYP A;  1E88 A;  2JGX A;  2KMS A;  1SRZ A;  2CG6 A;  2MCZ A;  3ERB A;  1TPM A;  4K12 A;  3VWO A;  2ZYC A;  3ZLE A;  3GOV A;  5JPM G;  4CSY A;  2B5I D;  2Y8S A;  1OJY A;  3INB C;  2XRD A;  3TVJ A;  3ZLD A;  2XWB F;  1QO6 A;  3KZJ A;  3CAL A;  2IZ3 A;  3NFP I;  1GKN A;  1MD7 A;  2EC3 A;  2I2L A;  1TPN A;  3ZD2 A;  1H03 P;  2EHF A;  4ZH1 D;  5I0Q B;  3FGR A;  3WSX A;  3GXE A;  1H2Q P;  4PO7 A;  5HYT B;  1UOT P;  1Z92 B;  1OJV A;  3FGT A;  2YBY A;  4J38 B;  1E8B A;  3CI0 J;  3ZRZ A;  1HFI A;  3IX0 A;  2JGW A;  5HZP B;  4AYI A;  1VVC A;  1CKL A;  1O9A A;  3EJH A;  3RJ3 D;  3KXV A;  2O39 C;  3F6K A;  3MQL A;  4MUC A;  1GHQ B;  4MSL A;  2W80 A;  4A5W B;  4KKD A;  3SW0 X; 
#chains in the Genus database with same CATH homology
 2I2L A;  2Y8R A;  3FGR A;  2X2Z A;  2Y8T A;  3WSX A;  4PO7 A;  3NJA A;  3FGT A;  3ZLE A;  3WSY A;  4YIZ A;  2Y8S A;  3ZLD A;  4BWC A;  3F6K A;  4MSL A;  4APL A;  4N7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...