2Y8SA

Co-structure of an ama1 mutant (y230a) with a surface exposed region of ron2 from toxoplasma gondii
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
411
structure length
386
Chain Sequence
b'GNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILAVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN, PUTATIVE
publication title Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of Ama1 with a Ron2 Peptide
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 97
structure length 386
sequence length 411
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 2y8sA03
3ZLDA 3ZLEA 4YIZA 2Y8TA 4APLA 2Y8RA 2Y8SA 2X2ZA
chains in the Genus database with same CATH superfamily
2EC3A 2Y8TA 2Y8RA 2V8EA 4AYMA 1SS2A 4ONTD 3IU3I 4ZH1D 3ZD2A 4YIZA 2CG6A 5HYUB 3IX0A 3M7PA 3CI0J 2XQWC 4JHSA 3L89M 4AYIA 2JRAA 3K3TA 2XWBF 4MSLA 5DN4A 4APLA 1OK1A 1GPZA 4LOTA 1OK3A 1HFHA 4LOSA 1U5MA 2JGXA 2BZMA 2KRIA 1TPMA 2Y8SA 2XRBA 2ZYCA 3SW0X 1OJWA 3EJHA 2LOJA 4C16A 3CALA 4KKDA 1PPQA 2X2ZA 1GKNA 3ZLDA 1H2PP 1O9AA 2ERJA 3GOVA 3KXVA 1MD7A 2CG7A 5HZPB 3FGTA 1G4FA 1GKGA 2KMSA 4F4OC 2G7IA 1C1ZA 5FO8C 1TPGA 3INBC 4WJG2 4B2SA 2CKUA 2W81A 2RKZA 1CKLA 2UWNA 1VVCA 4IGDA 2IZ4A 2W80A 5JPMG 2WIIC 4PZ5A 1VVDA 4YNXA 1E8BA 4B2RA 1G4GA 2JGWA 1OK2A 2I2LA 3WSYA 4MUCA 4CSYA 1QGBA 1ELVA 4AYDA 2YBYA 4AYEA 3ZLEA 1ZJKA 4K12A 3OP8A 3O8EB 1RLHA 3ERBA 1Z92B 2MCYA 1MD8A 1GHQB 2QY0A 2A55A 3RJ3D 2XRDA 1QO6A 3KZJA 5HYPA 1H2QP 3OEDC 2YRAA 4J38B 3VWOA 3R62A 5HYTB 2RL0A 1HCCA 2RKYA 3NFPI 4PO7A 2O39C 1E88A 4DJZA 1UOTP 1H03P 4FXGG 3TVJA 3ZD1A 2XWJI 1SRZA 1TPNA 5I0QB 1H04P 2MCZA 3ZRZA 4N7EA 1OJVA 2IZ3A 1NWVA 3FGRA 2RLQA 3OXUD 2RLPA 1OJYA 2B5ID 1FBRA 4BWCA 3WSXA 1Q3XA 3MQLA 1HFIA 3NJAA 1LY2A 4A5WB 3GXEA 3F6KA 3T5OA 1QUBA 5DN5A 1OK9A 1E5GA 2EHFA
chains in the Genus database with same CATH topology
2Y8TA 2I2LA 3WSYA 2Y8RA 2X2ZA 3ZLDA 3ZLEA 4YIZA 4N7EA 3FGTA 3FGRA 4MSLA 4APLA 4BWCA 3WSXA 3NJAA 3F6KA 2Y8SA 4PO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLD A;  3ZLE A;  4YIZ A;  2Y8T A;  4APL A;  2Y8R A;  2Y8S A;  2X2Z A; 
#chains in the Genus database with same CATH topology
 2EC3 A;  2Y8T A;  2Y8R A;  2V8E A;  4AYM A;  1SS2 A;  4ONT D;  3IU3 I;  4ZH1 D;  3ZD2 A;  4YIZ A;  2CG6 A;  5HYU B;  3IX0 A;  3M7P A;  3CI0 J;  2XQW C;  4JHS A;  3L89 M;  4AYI A;  2JRA A;  3K3T A;  2XWB F;  4MSL A;  5DN4 A;  4APL A;  1OK1 A;  1GPZ A;  4LOT A;  1OK3 A;  1HFH A;  4LOS A;  1U5M A;  2JGX A;  2BZM A;  2KRI A;  1TPM A;  2Y8S A;  2XRB A;  2ZYC A;  3SW0 X;  1OJW A;  3EJH A;  2LOJ A;  4C16 A;  3CAL A;  4KKD A;  1PPQ A;  2X2Z A;  1GKN A;  3ZLD A;  1H2P P;  1O9A A;  2ERJ A;  3GOV A;  3KXV A;  1MD7 A;  2CG7 A;  5HZP B;  3FGT A;  1G4F A;  1GKG A;  2KMS A;  4F4O C;  2G7I A;  1C1Z A;  5FO8 C;  1TPG A;  3INB C;  4WJG 2;  4B2S A;  2CKU A;  2W81 A;  2RKZ A;  1CKL A;  2UWN A;  1VVC A;  4IGD A;  2IZ4 A;  2W80 A;  5JPM G;  2WII C;  4PZ5 A;  1VVD A;  4YNX A;  1E8B A;  4B2R A;  1G4G A;  2JGW A;  1OK2 A;  2I2L A;  3WSY A;  4MUC A;  4CSY A;  1QGB A;  1ELV A;  4AYD A;  2YBY A;  4AYE A;  3ZLE A;  1ZJK A;  4K12 A;  3OP8 A;  3O8E B;  1RLH A;  3ERB A;  1Z92 B;  2MCY A;  1MD8 A;  1GHQ B;  2QY0 A;  2A55 A;  3RJ3 D;  2XRD A;  1QO6 A;  3KZJ A;  5HYP A;  1H2Q P;  3OED C;  2YRA A;  4J38 B;  3VWO A;  3R62 A;  5HYT B;  2RL0 A;  1HCC A;  2RKY A;  3NFP I;  4PO7 A;  2O39 C;  1E88 A;  4DJZ A;  1UOT P;  1H03 P;  4FXG G;  3TVJ A;  3ZD1 A;  2XWJ I;  1SRZ A;  1TPN A;  5I0Q B;  1H04 P;  2MCZ A;  3ZRZ A;  4N7E A;  1OJV A;  2IZ3 A;  1NWV A;  3FGR A;  2RLQ A;  3OXU D;  2RLP A;  1OJY A;  2B5I D;  1FBR A;  4BWC A;  3WSX A;  1Q3X A;  3MQL A;  1HFI A;  3NJA A;  1LY2 A;  4A5W B;  3GXE A;  3F6K A;  3T5O A;  1QUB A;  5DN5 A;  1OK9 A;  1E5G A;  2EHF A; 
#chains in the Genus database with same CATH homology
 2Y8T A;  2I2L A;  3WSY A;  2Y8R A;  2X2Z A;  3ZLD A;  3ZLE A;  4YIZ A;  4N7E A;  3FGT A;  3FGR A;  4MSL A;  4APL A;  4BWC A;  3WSX A;  3NJA A;  3F6K A;  2Y8S A;  4PO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...