1GKGA

Structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
136
structure length
136
Chain Sequence
b'EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT RECEPTOR TYPE 1
publication title Structure of the C3B Binding Site of Cr1 (Cd35), the Immune Adherence Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement
total genus 12
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gkgA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gkgA01
1GKGA 4B2SA 2RKYA 4FXGG 4B2RA 2RL0A 1HFIA 2YBYA 3IU3I 3OP8A 2RLQA 2BZMA 3INBC 1MD8A 3GOVA 5FO8C 1UOTP 3M7PA 5JPMG 4AYIA 3GXEA 1H2QP 1O9AA 1GKNA 1QUBA 2G7IA 2KMSA 3T5OA 2RLPA 4LOTA 3TVJA 2KRIA 2JRAA 4YNXA 2MCZA 1E5GA 5HYUB 1SS2A 1QO6A 3NFPI 3R62A 2LOJA 1U5MA 1TPNA 5I0QB 3ZRZA 1QGBA 1OJYA 2IZ3A 1NWVA 2XWBF 1TPGA 2A55A 3MQLA 1H2PP 1HFHA 4CSYA 1PPQA 2CG7A 4JHSA 3SW0X 1OK2A 3ZD1A 4J38B 2CG6A 4DJZA 1G4FA 4C16A 1VVDA 5HYTB 4ZH1D 3IX0A 3RJ3D 5HYPA 2JGXA 1ZJKA 3O8EB 2EC3A 1H04P 4IGDA 1CKLA 1ELVA 2EHFA 3ZD2A 2QY0A 4AYEA 3L89M 1H03P 1E8BA 3KZJA 1OJVA 1SRZA 2IZ4A 2RKZA 5HZPB 4AYDA 2XRBA 1OK3A 2UWNA 1G4GA 4LOSA 1OK1A 1TPMA 2JGWA 1GHQB 1C1ZA 1MD7A 4PZ5A 4F4OC 3ERBA 2B5ID 3CALA 4ONTD 2WIIC 4MUCA 1Z92B 2W81A 1LY2A 2CKUA 3OEDC 4KKDA 3KXVA 3OXUD 1HCCA 2W80A 2YRAA 4A5WB 2XRDA 2XWJI 2O39C 4K12A 1OK9A 1E88A 2XQWC 4AYMA 2MCYA 1GPZA 1FBRA 1OJWA 4WJG2 1Q3XA 2V8EA 3EJHA 2ERJA 1VVCA
chains in the Genus database with same CATH superfamily
4PO7A 3VWOA 3ZLDA 1GKGA 4B2SA 2RKYA 4FXGG 4B2RA 2RL0A 1HFIA 2YBYA 3IU3I 3OP8A 2RLQA 2BZMA 3INBC 1MD8A 3GOVA 5FO8C 1UOTP 3FGRA 2ZYCA 3M7PA 5JPMG 4AYIA 3GXEA 1H2QP 1O9AA 5DN4A 1GKNA 3WSYA 1QUBA 2G7IA 2KMSA 3T5OA 2RLPA 4LOTA 3TVJA 2KRIA 2JRAA 4YNXA 2MCZA 1E5GA 5HYUB 1SS2A 4YIZA 1QO6A 3NFPI 4N7EA 3R62A 2LOJA 3K3TA 1U5MA 1TPNA 5I0QB 3ZRZA 1QGBA 1OJYA 2IZ3A 1NWVA 2XWBF 1TPGA 2A55A 2Y8RA 3MQLA 1H2PP 1HFHA 4CSYA 1PPQA 2CG7A 4JHSA 3SW0X 1OK2A 3ZD1A 4J38B 2CG6A 5DN5A 4DJZA 4MSLA 4APLA 1G4FA 4C16A 1RLHA 1VVDA 5HYTB 4ZH1D 3IX0A 3RJ3D 5HYPA 2JGXA 1ZJKA 3O8EB 2EC3A 1H04P 4IGDA 1CKLA 1ELVA 3WSXA 2EHFA 3ZD2A 2QY0A 4AYEA 3L89M 1H03P 1E8BA 3CI0J 3KZJA 1OJVA 1SRZA 2IZ4A 2RKZA 5HZPB 4AYDA 2XRBA 1OK3A 2UWNA 1G4GA 4LOSA 1OK1A 1TPMA 2JGWA 1GHQB 4BWCA 1C1ZA 1MD7A 2Y8SA 3ZLEA 4PZ5A 4F4OC 3ERBA 2B5ID 3CALA 4ONTD 2WIIC 4MUCA 1Z92B 3F6KA 2W81A 1LY2A 2CKUA 3OEDC 4KKDA 3KXVA 3OXUD 1HCCA 2X2ZA 2W80A 2YRAA 4A5WB 2XRDA 2XWJI 3FGTA 2O39C 2I2LA 4K12A 1OK9A 2Y8TA 1E88A 2XQWC 4AYMA 3NJAA 2MCYA 1GPZA 1FBRA 1OJWA 4WJG2 1Q3XA 2V8EA 3EJHA 2ERJA 1VVCA
chains in the Genus database with same CATH topology
1GKGA 4B2SA 2RKYA 4FXGG 4B2RA 2RL0A 1HFIA 2YBYA 3IU3I 3OP8A 2RLQA 2BZMA 3INBC 1MD8A 3GOVA 5FO8C 1UOTP 3M7PA 5JPMG 4AYIA 3GXEA 1H2QP 1O9AA 1GKNA 1QUBA 2G7IA 2KMSA 3T5OA 2RLPA 4LOTA 3TVJA 2KRIA 2JRAA 4YNXA 2MCZA 1E5GA 5HYUB 1SS2A 1QO6A 3NFPI 3R62A 2LOJA 1U5MA 1TPNA 5I0QB 3ZRZA 1QGBA 1OJYA 2IZ3A 1NWVA 2XWBF 1TPGA 2A55A 3MQLA 1H2PP 1HFHA 4CSYA 1PPQA 2CG7A 4JHSA 3SW0X 1OK2A 3ZD1A 4J38B 2CG6A 4DJZA 1G4FA 4C16A 1VVDA 5HYTB 4ZH1D 3IX0A 3RJ3D 5HYPA 2JGXA 1ZJKA 3O8EB 2EC3A 1H04P 4IGDA 1CKLA 1ELVA 2EHFA 3ZD2A 2QY0A 4AYEA 3L89M 1H03P 1E8BA 3KZJA 1OJVA 1SRZA 2IZ4A 2RKZA 5HZPB 4AYDA 2XRBA 1OK3A 2UWNA 1G4GA 4LOSA 1OK1A 1TPMA 2JGWA 1GHQB 1C1ZA 1MD7A 4PZ5A 4F4OC 3ERBA 2B5ID 3CALA 4ONTD 2WIIC 4MUCA 1Z92B 2W81A 1LY2A 2CKUA 3OEDC 4KKDA 3KXVA 3OXUD 1HCCA 2W80A 2YRAA 4A5WB 2XRDA 2XWJI 2O39C 4K12A 1OK9A 1E88A 2XQWC 4AYMA 2MCYA 1GPZA 1FBRA 1OJWA 4WJG2 1Q3XA 2V8EA 3EJHA 2ERJA 1VVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GKG A;  4B2S A;  2RKY A;  4FXG G;  4B2R A;  2RL0 A;  1HFI A;  2YBY A;  3IU3 I;  3OP8 A;  2RLQ A;  2BZM A;  3INB C;  1MD8 A;  3GOV A;  5FO8 C;  1UOT P;  3M7P A;  5JPM G;  4AYI A;  3GXE A;  1H2Q P;  1O9A A;  1GKN A;  1QUB A;  2G7I A;  2KMS A;  3T5O A;  2RLP A;  4LOT A;  3TVJ A;  2KRI A;  2JRA A;  4YNX A;  2MCZ A;  1E5G A;  5HYU B;  1SS2 A;  1QO6 A;  3NFP I;  3R62 A;  2LOJ A;  1U5M A;  1TPN A;  5I0Q B;  3ZRZ A;  1QGB A;  1OJY A;  2IZ3 A;  1NWV A;  2XWB F;  1TPG A;  2A55 A;  3MQL A;  1H2P P;  1HFH A;  4CSY A;  1PPQ A;  2CG7 A;  4JHS A;  3SW0 X;  1OK2 A;  3ZD1 A;  4J38 B;  2CG6 A;  4DJZ A;  1G4F A;  4C16 A;  1VVD A;  5HYT B;  4ZH1 D;  3IX0 A;  3RJ3 D;  5HYP A;  2JGX A;  1ZJK A;  3O8E B;  2EC3 A;  1H04 P;  4IGD A;  1CKL A;  1ELV A;  2EHF A;  3ZD2 A;  2QY0 A;  4AYE A;  3L89 M;  1H03 P;  1E8B A;  3KZJ A;  1OJV A;  1SRZ A;  2IZ4 A;  2RKZ A;  5HZP B;  4AYD A;  2XRB A;  1OK3 A;  2UWN A;  1G4G A;  4LOS A;  1OK1 A;  1TPM A;  2JGW A;  1GHQ B;  1C1Z A;  1MD7 A;  4PZ5 A;  4F4O C;  3ERB A;  2B5I D;  3CAL A;  4ONT D;  2WII C;  4MUC A;  1Z92 B;  2W81 A;  1LY2 A;  2CKU A;  3OED C;  4KKD A;  3KXV A;  3OXU D;  1HCC A;  2W80 A;  2YRA A;  4A5W B;  2XRD A;  2XWJ I;  2O39 C;  4K12 A;  1OK9 A;  1E88 A;  2XQW C;  4AYM A;  2MCY A;  1GPZ A;  1FBR A;  1OJW A;  4WJG 2;  1Q3X A;  2V8E A;  3EJH A;  2ERJ A;  1VVC A; 
#chains in the Genus database with same CATH topology
 4PO7 A;  3VWO A;  3ZLD A;  1GKG A;  4B2S A;  2RKY A;  4FXG G;  4B2R A;  2RL0 A;  1HFI A;  2YBY A;  3IU3 I;  3OP8 A;  2RLQ A;  2BZM A;  3INB C;  1MD8 A;  3GOV A;  5FO8 C;  1UOT P;  3FGR A;  2ZYC A;  3M7P A;  5JPM G;  4AYI A;  3GXE A;  1H2Q P;  1O9A A;  5DN4 A;  1GKN A;  3WSY A;  1QUB A;  2G7I A;  2KMS A;  3T5O A;  2RLP A;  4LOT A;  3TVJ A;  2KRI A;  2JRA A;  4YNX A;  2MCZ A;  1E5G A;  5HYU B;  1SS2 A;  4YIZ A;  1QO6 A;  3NFP I;  4N7E A;  3R62 A;  2LOJ A;  3K3T A;  1U5M A;  1TPN A;  5I0Q B;  3ZRZ A;  1QGB A;  1OJY A;  2IZ3 A;  1NWV A;  2XWB F;  1TPG A;  2A55 A;  2Y8R A;  3MQL A;  1H2P P;  1HFH A;  4CSY A;  1PPQ A;  2CG7 A;  4JHS A;  3SW0 X;  1OK2 A;  3ZD1 A;  4J38 B;  2CG6 A;  5DN5 A;  4DJZ A;  4MSL A;  4APL A;  1G4F A;  4C16 A;  1RLH A;  1VVD A;  5HYT B;  4ZH1 D;  3IX0 A;  3RJ3 D;  5HYP A;  2JGX A;  1ZJK A;  3O8E B;  2EC3 A;  1H04 P;  4IGD A;  1CKL A;  1ELV A;  3WSX A;  2EHF A;  3ZD2 A;  2QY0 A;  4AYE A;  3L89 M;  1H03 P;  1E8B A;  3CI0 J;  3KZJ A;  1OJV A;  1SRZ A;  2IZ4 A;  2RKZ A;  5HZP B;  4AYD A;  2XRB A;  1OK3 A;  2UWN A;  1G4G A;  4LOS A;  1OK1 A;  1TPM A;  2JGW A;  1GHQ B;  4BWC A;  1C1Z A;  1MD7 A;  2Y8S A;  3ZLE A;  4PZ5 A;  4F4O C;  3ERB A;  2B5I D;  3CAL A;  4ONT D;  2WII C;  4MUC A;  1Z92 B;  3F6K A;  2W81 A;  1LY2 A;  2CKU A;  3OED C;  4KKD A;  3KXV A;  3OXU D;  1HCC A;  2X2Z A;  2W80 A;  2YRA A;  4A5W B;  2XRD A;  2XWJ I;  3FGT A;  2O39 C;  2I2L A;  4K12 A;  1OK9 A;  2Y8T A;  1E88 A;  2XQW C;  4AYM A;  3NJA A;  2MCY A;  1GPZ A;  1FBR A;  1OJW A;  4WJG 2;  1Q3X A;  2V8E A;  3EJH A;  2ERJ A;  1VVC A; 
#chains in the Genus database with same CATH homology
 1GKG A;  4B2S A;  2RKY A;  4FXG G;  4B2R A;  2RL0 A;  1HFI A;  2YBY A;  3IU3 I;  3OP8 A;  2RLQ A;  2BZM A;  3INB C;  1MD8 A;  3GOV A;  5FO8 C;  1UOT P;  3M7P A;  5JPM G;  4AYI A;  3GXE A;  1H2Q P;  1O9A A;  1GKN A;  1QUB A;  2G7I A;  2KMS A;  3T5O A;  2RLP A;  4LOT A;  3TVJ A;  2KRI A;  2JRA A;  4YNX A;  2MCZ A;  1E5G A;  5HYU B;  1SS2 A;  1QO6 A;  3NFP I;  3R62 A;  2LOJ A;  1U5M A;  1TPN A;  5I0Q B;  3ZRZ A;  1QGB A;  1OJY A;  2IZ3 A;  1NWV A;  2XWB F;  1TPG A;  2A55 A;  3MQL A;  1H2P P;  1HFH A;  4CSY A;  1PPQ A;  2CG7 A;  4JHS A;  3SW0 X;  1OK2 A;  3ZD1 A;  4J38 B;  2CG6 A;  4DJZ A;  1G4F A;  4C16 A;  1VVD A;  5HYT B;  4ZH1 D;  3IX0 A;  3RJ3 D;  5HYP A;  2JGX A;  1ZJK A;  3O8E B;  2EC3 A;  1H04 P;  4IGD A;  1CKL A;  1ELV A;  2EHF A;  3ZD2 A;  2QY0 A;  4AYE A;  3L89 M;  1H03 P;  1E8B A;  3KZJ A;  1OJV A;  1SRZ A;  2IZ4 A;  2RKZ A;  5HZP B;  4AYD A;  2XRB A;  1OK3 A;  2UWN A;  1G4G A;  4LOS A;  1OK1 A;  1TPM A;  2JGW A;  1GHQ B;  1C1Z A;  1MD7 A;  4PZ5 A;  4F4O C;  3ERB A;  2B5I D;  3CAL A;  4ONT D;  2WII C;  4MUC A;  1Z92 B;  2W81 A;  1LY2 A;  2CKU A;  3OED C;  4KKD A;  3KXV A;  3OXU D;  1HCC A;  2W80 A;  2YRA A;  4A5W B;  2XRD A;  2XWJ I;  2O39 C;  4K12 A;  1OK9 A;  1E88 A;  2XQW C;  4AYM A;  2MCY A;  1GPZ A;  1FBR A;  1OJW A;  4WJG 2;  1Q3X A;  2V8E A;  3EJH A;  2ERJ A;  1VVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...