1GKGA

Structure determination and rational mutagenesis reveal binding surface of immune adherence receptor, cr1 (cd35)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
136
structure length
136
Chain Sequence
EAEAKSCKTPPDPVNGMVHVITDIQVGSRITYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT RECEPTOR TYPE 1
publication title Structure of the C3B Binding Site of Cr1 (Cd35), the Immune Adherence Receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complement
total genus 12
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gkgA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gkgA01
4AYDA 4AYIA 2CG6A 3ZRZA 4AYMA 2XWJI 1QUBA 1QGBA 5HYTB 3R62A 4A5WB 5FO8C 1OK3A 1H04P 1ZJKA 3KZJA 4LOTA 4KKDA 3KXVA 2JRAA 2QY0A 3INBC 1G4GA 1GKGA 2BZMA 4JHSA 2W81A 1UOTP 3ZD2A 3T5OA 4YNXA 2V8EA 3MQLA 4K12A 3IU3I 1HCCA 2YRAA 1H03P 1O9AA 2MCYA 1QO6A 2KMSA 1LY2A 1HFIA 4C16A 2JGWA 1OK9A 4FXGG 1OK1A 2RLPA 3IX0A 1OJYA 1NWVA 1PPQA 2XRDA 5JPMG 5I0QB 1CKLA 1Z92B 2RKZA 1H2QP 2XWBF 4CSYA 2YBYA 2UWNA 2XRBA 1U5MA 3O8EB 1E8BA 4B2SA 3GOVA 3GXEA 2O39C 3L89M 3M7PA 4B2RA 1TPGA 2CG7A 1TPMA 3CALA 4J38B 2JGXA 1GPZA 2IZ3A 2B5ID 4ONTD 2EHFA 1OK2A 5HYPA 3ZD1A 4AYEA 2RLQA 2G7IA 1HFHA 3ERBA 1VVCA 4ZH1D 1OJWA 2MCZA 2KRIA 1FBRA 3OP8A 4WJG2 1G4FA 2LOJA 3SW0X 2W80A 2XQWC 2RL0A 3EJHA 1H2PP 2RKYA 4DJZA 2IZ4A 1ELVA 1MD8A 2A55A 3RJ3D 5HYUB 3OEDC 5HZPB 1GKNA 1OJVA 1Q3XA 1MD7A 1SS2A 3TVJA 3OXUD 1E88A 4LOSA 1VVDA 1TPNA 3NFPI 4PZ5A 1E5GA 1C1ZA 4MUCA 2ERJA 1SRZA 4F4OC 2EC3A 1GHQB 4IGDA 2CKUA 2WIIC
chains in the Genus database with same CATH superfamily
3F6KA 4AYDA 4AYIA 3VWOA 2CG6A 3ZRZA 4AYMA 2XWJI 1QUBA 1QGBA 5HYTB 3R62A 4A5WB 5FO8C 2Y8SA 1OK3A 1H04P 1ZJKA 3KZJA 4LOTA 4KKDA 3KXVA 2JRAA 2QY0A 3INBC 1G4GA 1GKGA 3ZLEA 2BZMA 4JHSA 2W81A 2Y8RA 1UOTP 3ZD2A 3T5OA 4YNXA 2V8EA 3MQLA 4K12A 3IU3I 1HCCA 2YRAA 1H03P 1O9AA 2MCYA 1QO6A 2I2LA 2KMSA 1LY2A 1HFIA 4C16A 2JGWA 1OK9A 4FXGG 1OK1A 2RLPA 3IX0A 1OJYA 4BWCA 1NWVA 3CI0J 1PPQA 2XRDA 5JPMG 5I0QB 2ZYCA 1CKLA 1Z92B 2RKZA 1H2QP 2XWBF 4MSLA 4CSYA 2YBYA 2UWNA 2XRBA 1U5MA 3O8EB 1E8BA 4B2SA 3GOVA 3GXEA 3ZLDA 2O39C 3L89M 3M7PA 4B2RA 1RLHA 1TPGA 3FGRA 2CG7A 1TPMA 3CALA 4J38B 2JGXA 1GPZA 2IZ3A 2B5ID 4ONTD 2EHFA 1OK2A 5HYPA 3ZD1A 4AYEA 2RLQA 2G7IA 1HFHA 3ERBA 1VVCA 4ZH1D 2X2ZA 1OJWA 2Y8TA 2MCZA 2KRIA 1FBRA 3OP8A 4WJG2 1G4FA 4APLA 3WSYA 2LOJA 3SW0X 2W80A 2XQWC 2RL0A 3EJHA 1H2PP 2RKYA 4N7EA 4DJZA 4PO7A 2IZ4A 3FGTA 1ELVA 1MD8A 2A55A 3RJ3D 5HYUB 3K3TA 3OEDC 5HZPB 4YIZA 1GKNA 1OJVA 1Q3XA 1MD7A 1SS2A 3TVJA 3OXUD 5DN5A 4LOSA 1E88A 1VVDA 1TPNA 3NFPI 4PZ5A 5DN4A 1E5GA 1C1ZA 4MUCA 2ERJA 1SRZA 4F4OC 3NJAA 3WSXA 2EC3A 1GHQB 4IGDA 2CKUA 2WIIC
chains in the Genus database with same CATH topology
4AYDA 4AYIA 2CG6A 3ZRZA 4AYMA 2XWJI 1QUBA 1QGBA 5HYTB 3R62A 4A5WB 5FO8C 1OK3A 1H04P 1ZJKA 3KZJA 4LOTA 4KKDA 3KXVA 2JRAA 2QY0A 3INBC 1G4GA 1GKGA 2BZMA 4JHSA 2W81A 1UOTP 3ZD2A 3T5OA 4YNXA 2V8EA 3MQLA 4K12A 3IU3I 1HCCA 2YRAA 1H03P 1O9AA 2MCYA 1QO6A 2KMSA 1LY2A 1HFIA 4C16A 2JGWA 1OK9A 4FXGG 1OK1A 2RLPA 3IX0A 1OJYA 1NWVA 1PPQA 2XRDA 5JPMG 5I0QB 1CKLA 1Z92B 2RKZA 1H2QP 2XWBF 4CSYA 2YBYA 2UWNA 2XRBA 1U5MA 3O8EB 1E8BA 4B2SA 3GOVA 3GXEA 2O39C 3L89M 3M7PA 4B2RA 1TPGA 2CG7A 1TPMA 3CALA 4J38B 2JGXA 1GPZA 2IZ3A 2B5ID 4ONTD 2EHFA 1OK2A 5HYPA 3ZD1A 4AYEA 2RLQA 2G7IA 1HFHA 3ERBA 1VVCA 4ZH1D 1OJWA 2MCZA 2KRIA 1FBRA 3OP8A 4WJG2 1G4FA 2LOJA 3SW0X 2W80A 2XQWC 2RL0A 3EJHA 1H2PP 2RKYA 4DJZA 2IZ4A 1ELVA 1MD8A 2A55A 3RJ3D 5HYUB 3OEDC 5HZPB 1GKNA 1OJVA 1Q3XA 1MD7A 1SS2A 3TVJA 3OXUD 1E88A 4LOSA 1VVDA 1TPNA 3NFPI 4PZ5A 1E5GA 1C1ZA 4MUCA 2ERJA 1SRZA 4F4OC 2EC3A 1GHQB 4IGDA 2CKUA 2WIIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYD A;  4AYI A;  2CG6 A;  3ZRZ A;  4AYM A;  2XWJ I;  1QUB A;  1QGB A;  5HYT B;  3R62 A;  4A5W B;  5FO8 C;  1OK3 A;  1H04 P;  1ZJK A;  3KZJ A;  4LOT A;  4KKD A;  3KXV A;  2JRA A;  2QY0 A;  3INB C;  1G4G A;  1GKG A;  2BZM A;  4JHS A;  2W81 A;  1UOT P;  3ZD2 A;  3T5O A;  4YNX A;  2V8E A;  3MQL A;  4K12 A;  3IU3 I;  1HCC A;  2YRA A;  1H03 P;  1O9A A;  2MCY A;  1QO6 A;  2KMS A;  1LY2 A;  1HFI A;  4C16 A;  2JGW A;  1OK9 A;  4FXG G;  1OK1 A;  2RLP A;  3IX0 A;  1OJY A;  1NWV A;  1PPQ A;  2XRD A;  5JPM G;  5I0Q B;  1CKL A;  1Z92 B;  2RKZ A;  1H2Q P;  2XWB F;  4CSY A;  2YBY A;  2UWN A;  2XRB A;  1U5M A;  3O8E B;  1E8B A;  4B2S A;  3GOV A;  3GXE A;  2O39 C;  3L89 M;  3M7P A;  4B2R A;  1TPG A;  2CG7 A;  1TPM A;  3CAL A;  4J38 B;  2JGX A;  1GPZ A;  2IZ3 A;  2B5I D;  4ONT D;  2EHF A;  1OK2 A;  5HYP A;  3ZD1 A;  4AYE A;  2RLQ A;  2G7I A;  1HFH A;  3ERB A;  1VVC A;  4ZH1 D;  1OJW A;  2MCZ A;  2KRI A;  1FBR A;  3OP8 A;  4WJG 2;  1G4F A;  2LOJ A;  3SW0 X;  2W80 A;  2XQW C;  2RL0 A;  3EJH A;  1H2P P;  2RKY A;  4DJZ A;  2IZ4 A;  1ELV A;  1MD8 A;  2A55 A;  3RJ3 D;  5HYU B;  3OED C;  5HZP B;  1GKN A;  1OJV A;  1Q3X A;  1MD7 A;  1SS2 A;  3TVJ A;  3OXU D;  1E88 A;  4LOS A;  1VVD A;  1TPN A;  3NFP I;  4PZ5 A;  1E5G A;  1C1Z A;  4MUC A;  2ERJ A;  1SRZ A;  4F4O C;  2EC3 A;  1GHQ B;  4IGD A;  2CKU A;  2WII C; 
#chains in the Genus database with same CATH topology
 3F6K A;  4AYD A;  4AYI A;  3VWO A;  2CG6 A;  3ZRZ A;  4AYM A;  2XWJ I;  1QUB A;  1QGB A;  5HYT B;  3R62 A;  4A5W B;  5FO8 C;  2Y8S A;  1OK3 A;  1H04 P;  1ZJK A;  3KZJ A;  4LOT A;  4KKD A;  3KXV A;  2JRA A;  2QY0 A;  3INB C;  1G4G A;  1GKG A;  3ZLE A;  2BZM A;  4JHS A;  2W81 A;  2Y8R A;  1UOT P;  3ZD2 A;  3T5O A;  4YNX A;  2V8E A;  3MQL A;  4K12 A;  3IU3 I;  1HCC A;  2YRA A;  1H03 P;  1O9A A;  2MCY A;  1QO6 A;  2I2L A;  2KMS A;  1LY2 A;  1HFI A;  4C16 A;  2JGW A;  1OK9 A;  4FXG G;  1OK1 A;  2RLP A;  3IX0 A;  1OJY A;  4BWC A;  1NWV A;  3CI0 J;  1PPQ A;  2XRD A;  5JPM G;  5I0Q B;  2ZYC A;  1CKL A;  1Z92 B;  2RKZ A;  1H2Q P;  2XWB F;  4MSL A;  4CSY A;  2YBY A;  2UWN A;  2XRB A;  1U5M A;  3O8E B;  1E8B A;  4B2S A;  3GOV A;  3GXE A;  3ZLD A;  2O39 C;  3L89 M;  3M7P A;  4B2R A;  1RLH A;  1TPG A;  3FGR A;  2CG7 A;  1TPM A;  3CAL A;  4J38 B;  2JGX A;  1GPZ A;  2IZ3 A;  2B5I D;  4ONT D;  2EHF A;  1OK2 A;  5HYP A;  3ZD1 A;  4AYE A;  2RLQ A;  2G7I A;  1HFH A;  3ERB A;  1VVC A;  4ZH1 D;  2X2Z A;  1OJW A;  2Y8T A;  2MCZ A;  2KRI A;  1FBR A;  3OP8 A;  4WJG 2;  1G4F A;  4APL A;  3WSY A;  2LOJ A;  3SW0 X;  2W80 A;  2XQW C;  2RL0 A;  3EJH A;  1H2P P;  2RKY A;  4N7E A;  4DJZ A;  4PO7 A;  2IZ4 A;  3FGT A;  1ELV A;  1MD8 A;  2A55 A;  3RJ3 D;  5HYU B;  3K3T A;  3OED C;  5HZP B;  4YIZ A;  1GKN A;  1OJV A;  1Q3X A;  1MD7 A;  1SS2 A;  3TVJ A;  3OXU D;  5DN5 A;  4LOS A;  1E88 A;  1VVD A;  1TPN A;  3NFP I;  4PZ5 A;  5DN4 A;  1E5G A;  1C1Z A;  4MUC A;  2ERJ A;  1SRZ A;  4F4O C;  3NJA A;  3WSX A;  2EC3 A;  1GHQ B;  4IGD A;  2CKU A;  2WII C; 
#chains in the Genus database with same CATH homology
 4AYD A;  4AYI A;  2CG6 A;  3ZRZ A;  4AYM A;  2XWJ I;  1QUB A;  1QGB A;  5HYT B;  3R62 A;  4A5W B;  5FO8 C;  1OK3 A;  1H04 P;  1ZJK A;  3KZJ A;  4LOT A;  4KKD A;  3KXV A;  2JRA A;  2QY0 A;  3INB C;  1G4G A;  1GKG A;  2BZM A;  4JHS A;  2W81 A;  1UOT P;  3ZD2 A;  3T5O A;  4YNX A;  2V8E A;  3MQL A;  4K12 A;  3IU3 I;  1HCC A;  2YRA A;  1H03 P;  1O9A A;  2MCY A;  1QO6 A;  2KMS A;  1LY2 A;  1HFI A;  4C16 A;  2JGW A;  1OK9 A;  4FXG G;  1OK1 A;  2RLP A;  3IX0 A;  1OJY A;  1NWV A;  1PPQ A;  2XRD A;  5JPM G;  5I0Q B;  1CKL A;  1Z92 B;  2RKZ A;  1H2Q P;  2XWB F;  4CSY A;  2YBY A;  2UWN A;  2XRB A;  1U5M A;  3O8E B;  1E8B A;  4B2S A;  3GOV A;  3GXE A;  2O39 C;  3L89 M;  3M7P A;  4B2R A;  1TPG A;  2CG7 A;  1TPM A;  3CAL A;  4J38 B;  2JGX A;  1GPZ A;  2IZ3 A;  2B5I D;  4ONT D;  2EHF A;  1OK2 A;  5HYP A;  3ZD1 A;  4AYE A;  2RLQ A;  2G7I A;  1HFH A;  3ERB A;  1VVC A;  4ZH1 D;  1OJW A;  2MCZ A;  2KRI A;  1FBR A;  3OP8 A;  4WJG 2;  1G4F A;  2LOJ A;  3SW0 X;  2W80 A;  2XQW C;  2RL0 A;  3EJH A;  1H2P P;  2RKY A;  4DJZ A;  2IZ4 A;  1ELV A;  1MD8 A;  2A55 A;  3RJ3 D;  5HYU B;  3OED C;  5HZP B;  1GKN A;  1OJV A;  1Q3X A;  1MD7 A;  1SS2 A;  3TVJ A;  3OXU D;  1E88 A;  4LOS A;  1VVD A;  1TPN A;  3NFP I;  4PZ5 A;  1E5G A;  1C1Z A;  4MUC A;  2ERJ A;  1SRZ A;  4F4O C;  2EC3 A;  1GHQ B;  4IGD A;  2CKU A;  2WII C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...