4AYMA

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 119
sequence length 119
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4aymA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4aymA01
1HFIA 2KRIA 5HYTB 1GKNA 4LOTA 3GOVA 1E88A 5HYPA 1G4FA 1GKGA 1TPMA 3GXEA 2UWNA 3T5OA 3ERBA 2YBYA 2V8EA 1LY2A 3NFPI 2RKZA 1C1ZA 4AYDA 1Q3XA 2A55A 1GPZA 1NWVA 1TPGA 4YNXA 4ZH1D 2ERJA 2O39C 2CG7A 1OK1A 3IX0A 1G4GA 1SRZA 2RLPA 1ELVA 1VVCA 2B5ID 1ZJKA 5I0QB 3RJ3D 1MD7A 3ZD2A 4CSYA 4PZ5A 1UOTP 1MD8A 1H2PP 4K12A 4DJZA 2RLQA 4LOSA 3OXUD 2IZ4A 2MCZA 2QY0A 1O9AA 4KKDA 3ZD1A 1QO6A 4C16A 3TVJA 3MQLA 5FO8C 3ZRZA 1GHQB 4JHSA 2MCYA 4F4OC 1OJYA 1QGBA 2WIIC 2EHFA 1QUBA 3SW0X 2YRAA 2KMSA 2XRDA 4J38B 1VVDA 3O8EB 3OP8A 1H03P 3L89M 1E5GA 1PPQA 1OK3A 3KZJA 3R62A 2XWJI 1HFHA 5HYUB 2XQWC 4B2SA 1OJWA 2JGXA 1U5MA 2RL0A 4MUCA 4AYMA 4ONTD 1TPNA 2XRBA 1OK2A 2JGWA 2CKUA 1OK9A 4B2RA 1H2QP 2W81A 3KXVA 5JPMG 1FBRA 2G7IA 2RKYA 4AYEA 4FXGG 2BZMA 3OEDC 3INBC 2JRAA 3CALA 2XWBF 4A5WB 1E8BA 1SS2A 4AYIA 2EC3A 1HCCA 1CKLA 4IGDA 3IU3I 2IZ3A 2CG6A 5HZPB 3M7PA 1OJVA 2LOJA 4WJG2 1H04P 1Z92B 2W80A 3EJHA
chains in the Genus database with same CATH superfamily
1HFIA 3WSYA 1RLHA 2Y8TA 2KRIA 5HYTB 1GKNA 4LOTA 3GOVA 1E88A 5HYPA 1G4FA 1GKGA 1TPMA 3GXEA 2UWNA 4YIZA 3T5OA 3ERBA 2YBYA 2V8EA 2X2ZA 3WSXA 1LY2A 5DN5A 3NFPI 5DN4A 2RKZA 1C1ZA 4AYDA 1Q3XA 2A55A 1GPZA 1NWVA 1TPGA 4YNXA 4ZH1D 2ERJA 2O39C 3ZLEA 2CG7A 4APLA 1OK1A 3IX0A 1G4GA 1SRZA 2RLPA 3FGRA 1ELVA 1VVCA 2B5ID 3NJAA 1ZJKA 2ZYCA 5I0QB 3RJ3D 1MD7A 4N7EA 3ZD2A 4CSYA 4PZ5A 1UOTP 1MD8A 1H2PP 4K12A 4DJZA 3CI0J 2RLQA 4BWCA 4LOSA 3OXUD 2IZ4A 2MCZA 2QY0A 1O9AA 4KKDA 3ZD1A 3F6KA 1QO6A 4C16A 3TVJA 3MQLA 5FO8C 3ZRZA 1GHQB 4JHSA 2MCYA 4F4OC 3FGTA 1OJYA 2Y8RA 1QGBA 2WIIC 2EHFA 1QUBA 3SW0X 2YRAA 2KMSA 2XRDA 4J38B 1VVDA 3O8EB 3OP8A 1H03P 3L89M 1E5GA 3K3TA 1PPQA 2I2LA 1OK3A 3KZJA 3R62A 2XWJI 1HFHA 5HYUB 2XQWC 4B2SA 1OJWA 2JGXA 1U5MA 2RL0A 4MUCA 4AYMA 4ONTD 1TPNA 2XRBA 1OK2A 2JGWA 4MSLA 2CKUA 1OK9A 4B2RA 1H2QP 2W81A 3KXVA 5JPMG 1FBRA 2G7IA 4PO7A 2RKYA 4AYEA 4FXGG 2BZMA 2Y8SA 3INBC 3OEDC 3VWOA 2JRAA 3CALA 2XWBF 4A5WB 1E8BA 1SS2A 4AYIA 2EC3A 1HCCA 1CKLA 4IGDA 3ZLDA 3IU3I 2IZ3A 2CG6A 5HZPB 3M7PA 1OJVA 2LOJA 4WJG2 1H04P 1Z92B 2W80A 3EJHA
chains in the Genus database with same CATH topology
1HFIA 2KRIA 5HYTB 1GKNA 4LOTA 3GOVA 1E88A 5HYPA 1G4FA 1GKGA 1TPMA 3GXEA 2UWNA 3T5OA 3ERBA 2YBYA 2V8EA 1LY2A 3NFPI 2RKZA 1C1ZA 4AYDA 1Q3XA 2A55A 1GPZA 1NWVA 1TPGA 4YNXA 4ZH1D 2ERJA 2O39C 2CG7A 1OK1A 3IX0A 1G4GA 1SRZA 2RLPA 1ELVA 1VVCA 2B5ID 1ZJKA 5I0QB 3RJ3D 1MD7A 3ZD2A 4CSYA 4PZ5A 1UOTP 1MD8A 1H2PP 4K12A 4DJZA 2RLQA 4LOSA 3OXUD 2IZ4A 2MCZA 2QY0A 1O9AA 4KKDA 3ZD1A 1QO6A 4C16A 3TVJA 3MQLA 5FO8C 3ZRZA 1GHQB 4JHSA 2MCYA 4F4OC 1OJYA 1QGBA 2WIIC 2EHFA 1QUBA 3SW0X 2YRAA 2KMSA 2XRDA 4J38B 1VVDA 3O8EB 3OP8A 1H03P 3L89M 1E5GA 1PPQA 1OK3A 3KZJA 3R62A 2XWJI 1HFHA 5HYUB 2XQWC 4B2SA 1OJWA 2JGXA 1U5MA 2RL0A 4MUCA 4AYMA 4ONTD 1TPNA 2XRBA 1OK2A 2JGWA 2CKUA 1OK9A 4B2RA 1H2QP 2W81A 3KXVA 5JPMG 1FBRA 2G7IA 2RKYA 4AYEA 4FXGG 2BZMA 3OEDC 3INBC 2JRAA 3CALA 2XWBF 4A5WB 1E8BA 1SS2A 4AYIA 2EC3A 1HCCA 1CKLA 4IGDA 3IU3I 2IZ3A 2CG6A 5HZPB 3M7PA 1OJVA 2LOJA 4WJG2 1H04P 1Z92B 2W80A 3EJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFI A;  2KRI A;  5HYT B;  1GKN A;  4LOT A;  3GOV A;  1E88 A;  5HYP A;  1G4F A;  1GKG A;  1TPM A;  3GXE A;  2UWN A;  3T5O A;  3ERB A;  2YBY A;  2V8E A;  1LY2 A;  3NFP I;  2RKZ A;  1C1Z A;  4AYD A;  1Q3X A;  2A55 A;  1GPZ A;  1NWV A;  1TPG A;  4YNX A;  4ZH1 D;  2ERJ A;  2O39 C;  2CG7 A;  1OK1 A;  3IX0 A;  1G4G A;  1SRZ A;  2RLP A;  1ELV A;  1VVC A;  2B5I D;  1ZJK A;  5I0Q B;  3RJ3 D;  1MD7 A;  3ZD2 A;  4CSY A;  4PZ5 A;  1UOT P;  1MD8 A;  1H2P P;  4K12 A;  4DJZ A;  2RLQ A;  4LOS A;  3OXU D;  2IZ4 A;  2MCZ A;  2QY0 A;  1O9A A;  4KKD A;  3ZD1 A;  1QO6 A;  4C16 A;  3TVJ A;  3MQL A;  5FO8 C;  3ZRZ A;  1GHQ B;  4JHS A;  2MCY A;  4F4O C;  1OJY A;  1QGB A;  2WII C;  2EHF A;  1QUB A;  3SW0 X;  2YRA A;  2KMS A;  2XRD A;  4J38 B;  1VVD A;  3O8E B;  3OP8 A;  1H03 P;  3L89 M;  1E5G A;  1PPQ A;  1OK3 A;  3KZJ A;  3R62 A;  2XWJ I;  1HFH A;  5HYU B;  2XQW C;  4B2S A;  1OJW A;  2JGX A;  1U5M A;  2RL0 A;  4MUC A;  4AYM A;  4ONT D;  1TPN A;  2XRB A;  1OK2 A;  2JGW A;  2CKU A;  1OK9 A;  4B2R A;  1H2Q P;  2W81 A;  3KXV A;  5JPM G;  1FBR A;  2G7I A;  2RKY A;  4AYE A;  4FXG G;  2BZM A;  3OED C;  3INB C;  2JRA A;  3CAL A;  2XWB F;  4A5W B;  1E8B A;  1SS2 A;  4AYI A;  2EC3 A;  1HCC A;  1CKL A;  4IGD A;  3IU3 I;  2IZ3 A;  2CG6 A;  5HZP B;  3M7P A;  1OJV A;  2LOJ A;  4WJG 2;  1H04 P;  1Z92 B;  2W80 A;  3EJH A; 
#chains in the Genus database with same CATH topology
 1HFI A;  3WSY A;  1RLH A;  2Y8T A;  2KRI A;  5HYT B;  1GKN A;  4LOT A;  3GOV A;  1E88 A;  5HYP A;  1G4F A;  1GKG A;  1TPM A;  3GXE A;  2UWN A;  4YIZ A;  3T5O A;  3ERB A;  2YBY A;  2V8E A;  2X2Z A;  3WSX A;  1LY2 A;  5DN5 A;  3NFP I;  5DN4 A;  2RKZ A;  1C1Z A;  4AYD A;  1Q3X A;  2A55 A;  1GPZ A;  1NWV A;  1TPG A;  4YNX A;  4ZH1 D;  2ERJ A;  2O39 C;  3ZLE A;  2CG7 A;  4APL A;  1OK1 A;  3IX0 A;  1G4G A;  1SRZ A;  2RLP A;  3FGR A;  1ELV A;  1VVC A;  2B5I D;  3NJA A;  1ZJK A;  2ZYC A;  5I0Q B;  3RJ3 D;  1MD7 A;  4N7E A;  3ZD2 A;  4CSY A;  4PZ5 A;  1UOT P;  1MD8 A;  1H2P P;  4K12 A;  4DJZ A;  3CI0 J;  2RLQ A;  4BWC A;  4LOS A;  3OXU D;  2IZ4 A;  2MCZ A;  2QY0 A;  1O9A A;  4KKD A;  3ZD1 A;  3F6K A;  1QO6 A;  4C16 A;  3TVJ A;  3MQL A;  5FO8 C;  3ZRZ A;  1GHQ B;  4JHS A;  2MCY A;  4F4O C;  3FGT A;  1OJY A;  2Y8R A;  1QGB A;  2WII C;  2EHF A;  1QUB A;  3SW0 X;  2YRA A;  2KMS A;  2XRD A;  4J38 B;  1VVD A;  3O8E B;  3OP8 A;  1H03 P;  3L89 M;  1E5G A;  3K3T A;  1PPQ A;  2I2L A;  1OK3 A;  3KZJ A;  3R62 A;  2XWJ I;  1HFH A;  5HYU B;  2XQW C;  4B2S A;  1OJW A;  2JGX A;  1U5M A;  2RL0 A;  4MUC A;  4AYM A;  4ONT D;  1TPN A;  2XRB A;  1OK2 A;  2JGW A;  4MSL A;  2CKU A;  1OK9 A;  4B2R A;  1H2Q P;  2W81 A;  3KXV A;  5JPM G;  1FBR A;  2G7I A;  4PO7 A;  2RKY A;  4AYE A;  4FXG G;  2BZM A;  2Y8S A;  3INB C;  3OED C;  3VWO A;  2JRA A;  3CAL A;  2XWB F;  4A5W B;  1E8B A;  1SS2 A;  4AYI A;  2EC3 A;  1HCC A;  1CKL A;  4IGD A;  3ZLD A;  3IU3 I;  2IZ3 A;  2CG6 A;  5HZP B;  3M7P A;  1OJV A;  2LOJ A;  4WJG 2;  1H04 P;  1Z92 B;  2W80 A;  3EJH A; 
#chains in the Genus database with same CATH homology
 1HFI A;  2KRI A;  5HYT B;  1GKN A;  4LOT A;  3GOV A;  1E88 A;  5HYP A;  1G4F A;  1GKG A;  1TPM A;  3GXE A;  2UWN A;  3T5O A;  3ERB A;  2YBY A;  2V8E A;  1LY2 A;  3NFP I;  2RKZ A;  1C1Z A;  4AYD A;  1Q3X A;  2A55 A;  1GPZ A;  1NWV A;  1TPG A;  4YNX A;  4ZH1 D;  2ERJ A;  2O39 C;  2CG7 A;  1OK1 A;  3IX0 A;  1G4G A;  1SRZ A;  2RLP A;  1ELV A;  1VVC A;  2B5I D;  1ZJK A;  5I0Q B;  3RJ3 D;  1MD7 A;  3ZD2 A;  4CSY A;  4PZ5 A;  1UOT P;  1MD8 A;  1H2P P;  4K12 A;  4DJZ A;  2RLQ A;  4LOS A;  3OXU D;  2IZ4 A;  2MCZ A;  2QY0 A;  1O9A A;  4KKD A;  3ZD1 A;  1QO6 A;  4C16 A;  3TVJ A;  3MQL A;  5FO8 C;  3ZRZ A;  1GHQ B;  4JHS A;  2MCY A;  4F4O C;  1OJY A;  1QGB A;  2WII C;  2EHF A;  1QUB A;  3SW0 X;  2YRA A;  2KMS A;  2XRD A;  4J38 B;  1VVD A;  3O8E B;  3OP8 A;  1H03 P;  3L89 M;  1E5G A;  1PPQ A;  1OK3 A;  3KZJ A;  3R62 A;  2XWJ I;  1HFH A;  5HYU B;  2XQW C;  4B2S A;  1OJW A;  2JGX A;  1U5M A;  2RL0 A;  4MUC A;  4AYM A;  4ONT D;  1TPN A;  2XRB A;  1OK2 A;  2JGW A;  2CKU A;  1OK9 A;  4B2R A;  1H2Q P;  2W81 A;  3KXV A;  5JPM G;  1FBR A;  2G7I A;  2RKY A;  4AYE A;  4FXG G;  2BZM A;  3OED C;  3INB C;  2JRA A;  3CAL A;  2XWB F;  4A5W B;  1E8B A;  1SS2 A;  4AYI A;  2EC3 A;  1HCC A;  1CKL A;  4IGD A;  3IU3 I;  2IZ3 A;  2CG6 A;  5HZP B;  3M7P A;  1OJV A;  2LOJ A;  4WJG 2;  1H04 P;  1Z92 B;  2W80 A;  3EJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...