4AYMA

Structure of a complex between ccps 6 and 7 of human complement factor h and neisseria meningitidis fhbp variant 3 p106a mutant
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
119
structure length
119
Chain Sequence
CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Design and Evaluation of Meningococcal Vaccines Through Structure-Based Modification of Host and Pathogen Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 21
structure length 119
sequence length 119
chains with identical sequence B, E, F
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4aymA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4aymA01
4CSYA 1GPZA 4JHSA 1E88A 3ERBA 4LOTA 2XWJI 4K12A 3T5OA 4B2SA 5JPMG 1TPGA 2XWBF 3L89M 1C1ZA 2V8EA 4WJG2 4AYDA 1HFHA 2ERJA 4MUCA 3TVJA 1QUBA 1VVDA 4FXGG 1OK3A 4IGDA 4F4OC 3KXVA 1Q3XA 3IU3I 4J38B 5HYTB 2YRAA 1H2PP 3O8EB 1U5MA 1PPQA 1H03P 1GKGA 1VVCA 1TPMA 3RJ3D 2QY0A 3ZRZA 1GHQB 3NFPI 2G7IA 5HZPB 4ZH1D 2IZ3A 2MCYA 1FBRA 4C16A 3M7PA 1CKLA 5FO8C 3ZD2A 3INBC 2KRIA 1O9AA 2JRAA 5HYPA 1OJWA 2CKUA 2YBYA 1LY2A 2LOJA 1OJVA 2EHFA 1G4GA 1G4FA 3GXEA 2RLQA 1OK2A 1OJYA 2RL0A 2CG7A 1Z92B 4LOSA 4PZ5A 2O39C 1E5GA 1H2QP 2MCZA 1NWVA 2CG6A 2BZMA 2KMSA 2RKZA 4AYEA 1GKNA 3KZJA 1OK1A 1QO6A 2UWNA 2B5ID 1QGBA 1ZJKA 5I0QB 1SS2A 1H04P 3R62A 4AYMA 1E8BA 3ZD1A 1SRZA 1HCCA 2XQWC 2WIIC 4AYIA 3GOVA 4KKDA 4A5WB 4YNXA 3OEDC 3OP8A 2RLPA 2A55A 2XRDA 3CALA 5HYUB 1TPNA 2W81A 4ONTD 2JGXA 3EJHA 2JGWA 3OXUD 1MD7A 3MQLA 2XRBA 1ELVA 1HFIA 2W80A 2EC3A 4DJZA 3SW0X 2RKYA 1MD8A 3IX0A 2IZ4A 1UOTP 4B2RA 1OK9A
chains in the Genus database with same CATH superfamily
4CSYA 1GPZA 3WSYA 4JHSA 1E88A 3ERBA 4LOTA 2XWJI 4YIZA 3FGRA 3CI0J 4K12A 3T5OA 4B2SA 5JPMG 2Y8RA 1TPGA 2XWBF 3L89M 1C1ZA 2V8EA 4WJG2 4AYDA 1HFHA 2ERJA 4MUCA 3TVJA 1QUBA 1VVDA 2Y8SA 4FXGG 1OK3A 3ZLEA 4IGDA 4F4OC 3KXVA 4N7EA 1Q3XA 3IU3I 4J38B 3FGTA 2YRAA 5HYTB 1H2PP 3O8EB 3ZLDA 1U5MA 1PPQA 1H03P 1GKGA 1VVCA 1TPMA 3RJ3D 2QY0A 3ZRZA 1GHQB 3NFPI 2G7IA 5HZPB 4ZH1D 2IZ3A 2MCYA 1FBRA 4C16A 3M7PA 1CKLA 5FO8C 3ZD2A 3INBC 2KRIA 1O9AA 2JRAA 4PO7A 3F6KA 5HYPA 1OJWA 2CKUA 2YBYA 1RLHA 1LY2A 2LOJA 1OJVA 2EHFA 1G4GA 4APLA 1G4FA 3GXEA 2RLQA 2Y8TA 1OK2A 1OJYA 2RL0A 2CG7A 1Z92B 4LOSA 4PZ5A 2O39C 1E5GA 1H2QP 2MCZA 5DN4A 1NWVA 2CG6A 3WSXA 2BZMA 2KMSA 2RKZA 3K3TA 2I2LA 4AYEA 1GKNA 3KZJA 1OK1A 1QO6A 2UWNA 2B5ID 1QGBA 1ZJKA 5I0QB 1SS2A 2ZYCA 1H04P 3R62A 4AYMA 1E8BA 3ZD1A 1SRZA 3NJAA 1HCCA 2X2ZA 2XQWC 2WIIC 4AYIA 3GOVA 4KKDA 4A5WB 4YNXA 3OEDC 3OP8A 5DN5A 2RLPA 2A55A 2XRDA 3CALA 5HYUB 1TPNA 4MSLA 2W81A 4ONTD 2JGXA 3EJHA 2JGWA 3OXUD 1MD7A 3MQLA 2XRBA 1ELVA 1HFIA 2W80A 2EC3A 4DJZA 4BWCA 2RKYA 1MD8A 3VWOA 3SW0X 3IX0A 2IZ4A 1UOTP 4B2RA 1OK9A
chains in the Genus database with same CATH topology
4CSYA 1GPZA 4JHSA 1E88A 3ERBA 4LOTA 2XWJI 4K12A 3T5OA 4B2SA 5JPMG 1TPGA 2XWBF 3L89M 1C1ZA 2V8EA 4WJG2 4AYDA 1HFHA 2ERJA 4MUCA 3TVJA 1QUBA 1VVDA 4FXGG 1OK3A 4IGDA 4F4OC 3KXVA 1Q3XA 3IU3I 4J38B 5HYTB 2YRAA 1H2PP 3O8EB 1U5MA 1PPQA 1H03P 1GKGA 1VVCA 1TPMA 3RJ3D 2QY0A 3ZRZA 1GHQB 3NFPI 2G7IA 5HZPB 4ZH1D 2IZ3A 2MCYA 1FBRA 4C16A 3M7PA 1CKLA 5FO8C 3ZD2A 3INBC 2KRIA 1O9AA 2JRAA 5HYPA 1OJWA 2CKUA 2YBYA 1LY2A 2LOJA 1OJVA 2EHFA 1G4GA 1G4FA 3GXEA 2RLQA 1OK2A 1OJYA 2RL0A 2CG7A 1Z92B 4LOSA 4PZ5A 2O39C 1E5GA 1H2QP 2MCZA 1NWVA 2CG6A 2BZMA 2KMSA 2RKZA 4AYEA 1GKNA 3KZJA 1OK1A 1QO6A 2UWNA 2B5ID 1QGBA 1ZJKA 5I0QB 1SS2A 1H04P 3R62A 4AYMA 1E8BA 3ZD1A 1SRZA 1HCCA 2XQWC 2WIIC 4AYIA 3GOVA 4KKDA 4A5WB 4YNXA 3OEDC 3OP8A 2RLPA 2A55A 2XRDA 3CALA 5HYUB 1TPNA 2W81A 4ONTD 2JGXA 3EJHA 2JGWA 3OXUD 1MD7A 3MQLA 2XRBA 1ELVA 1HFIA 2W80A 2EC3A 4DJZA 3SW0X 2RKYA 1MD8A 3IX0A 2IZ4A 1UOTP 4B2RA 1OK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CSY A;  1GPZ A;  4JHS A;  1E88 A;  3ERB A;  4LOT A;  2XWJ I;  4K12 A;  3T5O A;  4B2S A;  5JPM G;  1TPG A;  2XWB F;  3L89 M;  1C1Z A;  2V8E A;  4WJG 2;  4AYD A;  1HFH A;  2ERJ A;  4MUC A;  3TVJ A;  1QUB A;  1VVD A;  4FXG G;  1OK3 A;  4IGD A;  4F4O C;  3KXV A;  1Q3X A;  3IU3 I;  4J38 B;  5HYT B;  2YRA A;  1H2P P;  3O8E B;  1U5M A;  1PPQ A;  1H03 P;  1GKG A;  1VVC A;  1TPM A;  3RJ3 D;  2QY0 A;  3ZRZ A;  1GHQ B;  3NFP I;  2G7I A;  5HZP B;  4ZH1 D;  2IZ3 A;  2MCY A;  1FBR A;  4C16 A;  3M7P A;  1CKL A;  5FO8 C;  3ZD2 A;  3INB C;  2KRI A;  1O9A A;  2JRA A;  5HYP A;  1OJW A;  2CKU A;  2YBY A;  1LY2 A;  2LOJ A;  1OJV A;  2EHF A;  1G4G A;  1G4F A;  3GXE A;  2RLQ A;  1OK2 A;  1OJY A;  2RL0 A;  2CG7 A;  1Z92 B;  4LOS A;  4PZ5 A;  2O39 C;  1E5G A;  1H2Q P;  2MCZ A;  1NWV A;  2CG6 A;  2BZM A;  2KMS A;  2RKZ A;  4AYE A;  1GKN A;  3KZJ A;  1OK1 A;  1QO6 A;  2UWN A;  2B5I D;  1QGB A;  1ZJK A;  5I0Q B;  1SS2 A;  1H04 P;  3R62 A;  4AYM A;  1E8B A;  3ZD1 A;  1SRZ A;  1HCC A;  2XQW C;  2WII C;  4AYI A;  3GOV A;  4KKD A;  4A5W B;  4YNX A;  3OED C;  3OP8 A;  2RLP A;  2A55 A;  2XRD A;  3CAL A;  5HYU B;  1TPN A;  2W81 A;  4ONT D;  2JGX A;  3EJH A;  2JGW A;  3OXU D;  1MD7 A;  3MQL A;  2XRB A;  1ELV A;  1HFI A;  2W80 A;  2EC3 A;  4DJZ A;  3SW0 X;  2RKY A;  1MD8 A;  3IX0 A;  2IZ4 A;  1UOT P;  4B2R A;  1OK9 A; 
#chains in the Genus database with same CATH topology
 4CSY A;  1GPZ A;  3WSY A;  4JHS A;  1E88 A;  3ERB A;  4LOT A;  2XWJ I;  4YIZ A;  3FGR A;  3CI0 J;  4K12 A;  3T5O A;  4B2S A;  5JPM G;  2Y8R A;  1TPG A;  2XWB F;  3L89 M;  1C1Z A;  2V8E A;  4WJG 2;  4AYD A;  1HFH A;  2ERJ A;  4MUC A;  3TVJ A;  1QUB A;  1VVD A;  2Y8S A;  4FXG G;  1OK3 A;  3ZLE A;  4IGD A;  4F4O C;  3KXV A;  4N7E A;  1Q3X A;  3IU3 I;  4J38 B;  3FGT A;  2YRA A;  5HYT B;  1H2P P;  3O8E B;  3ZLD A;  1U5M A;  1PPQ A;  1H03 P;  1GKG A;  1VVC A;  1TPM A;  3RJ3 D;  2QY0 A;  3ZRZ A;  1GHQ B;  3NFP I;  2G7I A;  5HZP B;  4ZH1 D;  2IZ3 A;  2MCY A;  1FBR A;  4C16 A;  3M7P A;  1CKL A;  5FO8 C;  3ZD2 A;  3INB C;  2KRI A;  1O9A A;  2JRA A;  4PO7 A;  3F6K A;  5HYP A;  1OJW A;  2CKU A;  2YBY A;  1RLH A;  1LY2 A;  2LOJ A;  1OJV A;  2EHF A;  1G4G A;  4APL A;  1G4F A;  3GXE A;  2RLQ A;  2Y8T A;  1OK2 A;  1OJY A;  2RL0 A;  2CG7 A;  1Z92 B;  4LOS A;  4PZ5 A;  2O39 C;  1E5G A;  1H2Q P;  2MCZ A;  5DN4 A;  1NWV A;  2CG6 A;  3WSX A;  2BZM A;  2KMS A;  2RKZ A;  3K3T A;  2I2L A;  4AYE A;  1GKN A;  3KZJ A;  1OK1 A;  1QO6 A;  2UWN A;  2B5I D;  1QGB A;  1ZJK A;  5I0Q B;  1SS2 A;  2ZYC A;  1H04 P;  3R62 A;  4AYM A;  1E8B A;  3ZD1 A;  1SRZ A;  3NJA A;  1HCC A;  2X2Z A;  2XQW C;  2WII C;  4AYI A;  3GOV A;  4KKD A;  4A5W B;  4YNX A;  3OED C;  3OP8 A;  5DN5 A;  2RLP A;  2A55 A;  2XRD A;  3CAL A;  5HYU B;  1TPN A;  4MSL A;  2W81 A;  4ONT D;  2JGX A;  3EJH A;  2JGW A;  3OXU D;  1MD7 A;  3MQL A;  2XRB A;  1ELV A;  1HFI A;  2W80 A;  2EC3 A;  4DJZ A;  4BWC A;  2RKY A;  1MD8 A;  3VWO A;  3SW0 X;  3IX0 A;  2IZ4 A;  1UOT P;  4B2R A;  1OK9 A; 
#chains in the Genus database with same CATH homology
 4CSY A;  1GPZ A;  4JHS A;  1E88 A;  3ERB A;  4LOT A;  2XWJ I;  4K12 A;  3T5O A;  4B2S A;  5JPM G;  1TPG A;  2XWB F;  3L89 M;  1C1Z A;  2V8E A;  4WJG 2;  4AYD A;  1HFH A;  2ERJ A;  4MUC A;  3TVJ A;  1QUB A;  1VVD A;  4FXG G;  1OK3 A;  4IGD A;  4F4O C;  3KXV A;  1Q3X A;  3IU3 I;  4J38 B;  5HYT B;  2YRA A;  1H2P P;  3O8E B;  1U5M A;  1PPQ A;  1H03 P;  1GKG A;  1VVC A;  1TPM A;  3RJ3 D;  2QY0 A;  3ZRZ A;  1GHQ B;  3NFP I;  2G7I A;  5HZP B;  4ZH1 D;  2IZ3 A;  2MCY A;  1FBR A;  4C16 A;  3M7P A;  1CKL A;  5FO8 C;  3ZD2 A;  3INB C;  2KRI A;  1O9A A;  2JRA A;  5HYP A;  1OJW A;  2CKU A;  2YBY A;  1LY2 A;  2LOJ A;  1OJV A;  2EHF A;  1G4G A;  1G4F A;  3GXE A;  2RLQ A;  1OK2 A;  1OJY A;  2RL0 A;  2CG7 A;  1Z92 B;  4LOS A;  4PZ5 A;  2O39 C;  1E5G A;  1H2Q P;  2MCZ A;  1NWV A;  2CG6 A;  2BZM A;  2KMS A;  2RKZ A;  4AYE A;  1GKN A;  3KZJ A;  1OK1 A;  1QO6 A;  2UWN A;  2B5I D;  1QGB A;  1ZJK A;  5I0Q B;  1SS2 A;  1H04 P;  3R62 A;  4AYM A;  1E8B A;  3ZD1 A;  1SRZ A;  1HCC A;  2XQW C;  2WII C;  4AYI A;  3GOV A;  4KKD A;  4A5W B;  4YNX A;  3OED C;  3OP8 A;  2RLP A;  2A55 A;  2XRD A;  3CAL A;  5HYU B;  1TPN A;  2W81 A;  4ONT D;  2JGX A;  3EJH A;  2JGW A;  3OXU D;  1MD7 A;  3MQL A;  2XRB A;  1ELV A;  1HFI A;  2W80 A;  2EC3 A;  4DJZ A;  3SW0 X;  2RKY A;  1MD8 A;  3IX0 A;  2IZ4 A;  1UOT P;  4B2R A;  1OK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...