1SRZA

Solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 trans conformer
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
EAEFVRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gamma-aminobutyric acid type B receptor, subunit 1
publication title Structural Analysis of the Complement Control Protein (CCP) Modules of GABAB Receptor 1a: ONLY ONE OF THE TWO CCP MODULES IS COMPACTLY FOLDED
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1srzA00
2A55A 3ZD1A 1H03P 3R62A 1OK3A 1PPQA 1O9AA 1Q3XA 1HFIA 2WIIC 5HYUB 1OK2A 4AYMA 3NFPI 2CG6A 2RLPA 1MD7A 3RJ3D 1GKGA 1HCCA 4A5WB 3EJHA 4CSYA 2JRAA 1VVDA 2BZMA 1GPZA 1H04P 1ZJKA 1MD8A 4ZH1D 1UOTP 2W81A 2YBYA 2LOJA 2RLQA 3CALA 3ZRZA 4LOTA 4B2RA 3GOVA 1OJVA 1ELVA 1G4FA 1C1ZA 2JGXA 1HFHA 2IZ3A 2XRBA 2IZ4A 4MUCA 2KMSA 3ZD2A 2B5ID 1OJWA 3O8EB 2XQWC 3OEDC 1Z92B 4FXGG 4AYDA 1G4GA 3GXEA 2EC3A 1E88A 2EHFA 5I0QB 4AYIA 5HYPA 1TPGA 4DJZA 1SRZA 2UWNA 3INBC 4J38B 4K12A 1QGBA 2CG7A 4AYEA 2QY0A 1FBRA 1VVCA 4F4OC 2RKYA 2JGWA 4C16A 3SW0X 3TVJA 1GKNA 4KKDA 1H2QP 3KXVA 1OK9A 3OXUD 4PZ5A 1E5GA 2KRIA 1OJYA 3M7PA 2MCZA 3IU3I 2XWBF 2CKUA 2V8EA 1QUBA 2G7IA 4IGDA 2O39C 3IX0A 4LOSA 5FO8C 2RL0A 2YRAA 3KZJA 1SS2A 1QO6A 3ERBA 4ONTD 2ERJA 2RKZA 5HYTB 1TPNA 1NWVA 3MQLA 1LY2A 1GHQB 3L89M 4WJG2 1CKLA 2XRDA 5HZPB 3T5OA 4B2SA 1TPMA 2XWJI 5JPMG 1H2PP 1OK1A 2W80A 4JHSA 1E8BA 1U5MA 2MCYA 4YNXA 3OP8A
chains in the Genus database with same CATH superfamily
2A55A 3ZD1A 1H03P 3R62A 1OK3A 1PPQA 2X2ZA 1O9AA 1Q3XA 1HFIA 2WIIC 5HYUB 1OK2A 4AYMA 3NFPI 2CG6A 2RLPA 1MD7A 3RJ3D 1GKGA 3NJAA 1HCCA 4A5WB 3EJHA 5DN4A 4CSYA 2JRAA 1VVDA 2BZMA 3FGTA 1GPZA 1H04P 1ZJKA 2Y8RA 4N7EA 1MD8A 4ZH1D 1UOTP 2W81A 2YBYA 2LOJA 2I2LA 2RLQA 3CALA 3ZLDA 3ZRZA 4LOTA 4B2RA 3GOVA 1OJVA 1ELVA 1G4FA 1C1ZA 2JGXA 1HFHA 2IZ3A 2XRBA 2IZ4A 4MUCA 2KMSA 3CI0J 2Y8SA 3ZD2A 2ZYCA 2B5ID 1OJWA 3O8EB 2XQWC 3OEDC 4YIZA 1Z92B 4FXGG 3ZLEA 4AYDA 1G4GA 3GXEA 3WSYA 2EC3A 4BWCA 1E88A 2EHFA 5I0QB 4AYIA 5HYPA 1TPGA 4DJZA 1SRZA 2UWNA 3INBC 4J38B 4K12A 1QGBA 2CG7A 4AYEA 4PO7A 2QY0A 1FBRA 1VVCA 4MSLA 4F4OC 2RKYA 2JGWA 3FGRA 4C16A 3SW0X 3TVJA 2Y8TA 1GKNA 4KKDA 1H2QP 3KXVA 1OK9A 3OXUD 4PZ5A 4APLA 1E5GA 2KRIA 1OJYA 3M7PA 2MCZA 3IU3I 2XWBF 1RLHA 2CKUA 1QUBA 2V8EA 2G7IA 3WSXA 4IGDA 2O39C 3IX0A 3F6KA 4LOSA 5FO8C 2RL0A 3K3TA 2YRAA 3KZJA 1SS2A 1QO6A 3ERBA 4ONTD 2ERJA 2RKZA 5HYTB 1TPNA 1NWVA 3MQLA 1LY2A 1GHQB 3L89M 4WJG2 1CKLA 2XRDA 5HZPB 3T5OA 4B2SA 1TPMA 2XWJI 3VWOA 5JPMG 1H2PP 1OK1A 2W80A 4JHSA 1E8BA 1U5MA 2MCYA 5DN5A 4YNXA 3OP8A
chains in the Genus database with same CATH topology
2A55A 3ZD1A 1H03P 3R62A 1OK3A 1PPQA 1O9AA 1Q3XA 1HFIA 2WIIC 5HYUB 1OK2A 4AYMA 3NFPI 2CG6A 2RLPA 1MD7A 3RJ3D 1GKGA 1HCCA 4A5WB 3EJHA 4CSYA 2JRAA 1VVDA 2BZMA 1GPZA 1H04P 1ZJKA 1MD8A 4ZH1D 1UOTP 2W81A 2YBYA 2LOJA 2RLQA 3CALA 3ZRZA 4LOTA 4B2RA 3GOVA 1OJVA 1ELVA 1G4FA 1C1ZA 2JGXA 1HFHA 2IZ3A 2XRBA 2IZ4A 4MUCA 2KMSA 3ZD2A 2B5ID 1OJWA 3O8EB 2XQWC 3OEDC 1Z92B 4FXGG 4AYDA 1G4GA 3GXEA 2EC3A 1E88A 2EHFA 5I0QB 4AYIA 5HYPA 1TPGA 4DJZA 1SRZA 2UWNA 3INBC 4J38B 4K12A 1QGBA 2CG7A 4AYEA 2QY0A 1FBRA 1VVCA 4F4OC 2RKYA 2JGWA 4C16A 3SW0X 3TVJA 1GKNA 4KKDA 1H2QP 3KXVA 1OK9A 3OXUD 4PZ5A 1E5GA 2KRIA 1OJYA 3M7PA 2MCZA 3IU3I 2XWBF 2CKUA 2V8EA 1QUBA 2G7IA 4IGDA 2O39C 3IX0A 4LOSA 5FO8C 2RL0A 2YRAA 3KZJA 1SS2A 1QO6A 3ERBA 4ONTD 2ERJA 2RKZA 5HYTB 1TPNA 1NWVA 3MQLA 1LY2A 1GHQB 3L89M 4WJG2 1CKLA 2XRDA 5HZPB 3T5OA 4B2SA 1TPMA 2XWJI 5JPMG 1H2PP 1OK1A 2W80A 4JHSA 1E8BA 1U5MA 2MCYA 4YNXA 3OP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A55 A;  3ZD1 A;  1H03 P;  3R62 A;  1OK3 A;  1PPQ A;  1O9A A;  1Q3X A;  1HFI A;  2WII C;  5HYU B;  1OK2 A;  4AYM A;  3NFP I;  2CG6 A;  2RLP A;  1MD7 A;  3RJ3 D;  1GKG A;  1HCC A;  4A5W B;  3EJH A;  4CSY A;  2JRA A;  1VVD A;  2BZM A;  1GPZ A;  1H04 P;  1ZJK A;  1MD8 A;  4ZH1 D;  1UOT P;  2W81 A;  2YBY A;  2LOJ A;  2RLQ A;  3CAL A;  3ZRZ A;  4LOT A;  4B2R A;  3GOV A;  1OJV A;  1ELV A;  1G4F A;  1C1Z A;  2JGX A;  1HFH A;  2IZ3 A;  2XRB A;  2IZ4 A;  4MUC A;  2KMS A;  3ZD2 A;  2B5I D;  1OJW A;  3O8E B;  2XQW C;  3OED C;  1Z92 B;  4FXG G;  4AYD A;  1G4G A;  3GXE A;  2EC3 A;  1E88 A;  2EHF A;  5I0Q B;  4AYI A;  5HYP A;  1TPG A;  4DJZ A;  1SRZ A;  2UWN A;  3INB C;  4J38 B;  4K12 A;  1QGB A;  2CG7 A;  4AYE A;  2QY0 A;  1FBR A;  1VVC A;  4F4O C;  2RKY A;  2JGW A;  4C16 A;  3SW0 X;  3TVJ A;  1GKN A;  4KKD A;  1H2Q P;  3KXV A;  1OK9 A;  3OXU D;  4PZ5 A;  1E5G A;  2KRI A;  1OJY A;  3M7P A;  2MCZ A;  3IU3 I;  2XWB F;  2CKU A;  2V8E A;  1QUB A;  2G7I A;  4IGD A;  2O39 C;  3IX0 A;  4LOS A;  5FO8 C;  2RL0 A;  2YRA A;  3KZJ A;  1SS2 A;  1QO6 A;  3ERB A;  4ONT D;  2ERJ A;  2RKZ A;  5HYT B;  1TPN A;  1NWV A;  3MQL A;  1LY2 A;  1GHQ B;  3L89 M;  4WJG 2;  1CKL A;  2XRD A;  5HZP B;  3T5O A;  4B2S A;  1TPM A;  2XWJ I;  5JPM G;  1H2P P;  1OK1 A;  2W80 A;  4JHS A;  1E8B A;  1U5M A;  2MCY A;  4YNX A;  3OP8 A; 
#chains in the Genus database with same CATH topology
 2A55 A;  3ZD1 A;  1H03 P;  3R62 A;  1OK3 A;  1PPQ A;  2X2Z A;  1O9A A;  1Q3X A;  1HFI A;  2WII C;  5HYU B;  1OK2 A;  4AYM A;  3NFP I;  2CG6 A;  2RLP A;  1MD7 A;  3RJ3 D;  1GKG A;  3NJA A;  1HCC A;  4A5W B;  3EJH A;  5DN4 A;  4CSY A;  2JRA A;  1VVD A;  2BZM A;  3FGT A;  1GPZ A;  1H04 P;  1ZJK A;  2Y8R A;  4N7E A;  1MD8 A;  4ZH1 D;  1UOT P;  2W81 A;  2YBY A;  2LOJ A;  2I2L A;  2RLQ A;  3CAL A;  3ZLD A;  3ZRZ A;  4LOT A;  4B2R A;  3GOV A;  1OJV A;  1ELV A;  1G4F A;  1C1Z A;  2JGX A;  1HFH A;  2IZ3 A;  2XRB A;  2IZ4 A;  4MUC A;  2KMS A;  3CI0 J;  2Y8S A;  3ZD2 A;  2ZYC A;  2B5I D;  1OJW A;  3O8E B;  2XQW C;  3OED C;  4YIZ A;  1Z92 B;  4FXG G;  3ZLE A;  4AYD A;  1G4G A;  3GXE A;  3WSY A;  2EC3 A;  4BWC A;  1E88 A;  2EHF A;  5I0Q B;  4AYI A;  5HYP A;  1TPG A;  4DJZ A;  1SRZ A;  2UWN A;  3INB C;  4J38 B;  4K12 A;  1QGB A;  2CG7 A;  4AYE A;  4PO7 A;  2QY0 A;  1FBR A;  1VVC A;  4MSL A;  4F4O C;  2RKY A;  2JGW A;  3FGR A;  4C16 A;  3SW0 X;  3TVJ A;  2Y8T A;  1GKN A;  4KKD A;  1H2Q P;  3KXV A;  1OK9 A;  3OXU D;  4PZ5 A;  4APL A;  1E5G A;  2KRI A;  1OJY A;  3M7P A;  2MCZ A;  3IU3 I;  2XWB F;  1RLH A;  2CKU A;  1QUB A;  2V8E A;  2G7I A;  3WSX A;  4IGD A;  2O39 C;  3IX0 A;  3F6K A;  4LOS A;  5FO8 C;  2RL0 A;  3K3T A;  2YRA A;  3KZJ A;  1SS2 A;  1QO6 A;  3ERB A;  4ONT D;  2ERJ A;  2RKZ A;  5HYT B;  1TPN A;  1NWV A;  3MQL A;  1LY2 A;  1GHQ B;  3L89 M;  4WJG 2;  1CKL A;  2XRD A;  5HZP B;  3T5O A;  4B2S A;  1TPM A;  2XWJ I;  3VWO A;  5JPM G;  1H2P P;  1OK1 A;  2W80 A;  4JHS A;  1E8B A;  1U5M A;  2MCY A;  5DN5 A;  4YNX A;  3OP8 A; 
#chains in the Genus database with same CATH homology
 2A55 A;  3ZD1 A;  1H03 P;  3R62 A;  1OK3 A;  1PPQ A;  1O9A A;  1Q3X A;  1HFI A;  2WII C;  5HYU B;  1OK2 A;  4AYM A;  3NFP I;  2CG6 A;  2RLP A;  1MD7 A;  3RJ3 D;  1GKG A;  1HCC A;  4A5W B;  3EJH A;  4CSY A;  2JRA A;  1VVD A;  2BZM A;  1GPZ A;  1H04 P;  1ZJK A;  1MD8 A;  4ZH1 D;  1UOT P;  2W81 A;  2YBY A;  2LOJ A;  2RLQ A;  3CAL A;  3ZRZ A;  4LOT A;  4B2R A;  3GOV A;  1OJV A;  1ELV A;  1G4F A;  1C1Z A;  2JGX A;  1HFH A;  2IZ3 A;  2XRB A;  2IZ4 A;  4MUC A;  2KMS A;  3ZD2 A;  2B5I D;  1OJW A;  3O8E B;  2XQW C;  3OED C;  1Z92 B;  4FXG G;  4AYD A;  1G4G A;  3GXE A;  2EC3 A;  1E88 A;  2EHF A;  5I0Q B;  4AYI A;  5HYP A;  1TPG A;  4DJZ A;  1SRZ A;  2UWN A;  3INB C;  4J38 B;  4K12 A;  1QGB A;  2CG7 A;  4AYE A;  2QY0 A;  1FBR A;  1VVC A;  4F4O C;  2RKY A;  2JGW A;  4C16 A;  3SW0 X;  3TVJ A;  1GKN A;  4KKD A;  1H2Q P;  3KXV A;  1OK9 A;  3OXU D;  4PZ5 A;  1E5G A;  2KRI A;  1OJY A;  3M7P A;  2MCZ A;  3IU3 I;  2XWB F;  2CKU A;  2V8E A;  1QUB A;  2G7I A;  4IGD A;  2O39 C;  3IX0 A;  4LOS A;  5FO8 C;  2RL0 A;  2YRA A;  3KZJ A;  1SS2 A;  1QO6 A;  3ERB A;  4ONT D;  2ERJ A;  2RKZ A;  5HYT B;  1TPN A;  1NWV A;  3MQL A;  1LY2 A;  1GHQ B;  3L89 M;  4WJG 2;  1CKL A;  2XRD A;  5HZP B;  3T5O A;  4B2S A;  1TPM A;  2XWJ I;  5JPM G;  1H2P P;  1OK1 A;  2W80 A;  4JHS A;  1E8B A;  1U5M A;  2MCY A;  4YNX A;  3OP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...