1SRZA

Solution structure of the second complement control protein (ccp) module of the gaba(b)r1a receptor, pro-119 trans conformer
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
EAEFVRICSKSYLTLENGKVFLTGGDLPALDGARVEFRCDPDFHLVGSSRSVCSQGQWSTPKPHCQVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gamma-aminobutyric acid type B receptor, subunit 1
publication title Structural Analysis of the Complement Control Protein (CCP) Modules of GABAB Receptor 1a: ONLY ONE OF THE TWO CCP MODULES IS COMPACTLY FOLDED
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 8
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2004-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1srzA00
1GPZA 1QO6A 1FBRA 3ZRZA 3OEDC 3INBC 1MD8A 2RL0A 1QUBA 2KRIA 4J38B 4AYMA 4LOSA 4FXGG 1H03P 1NWVA 5I0QB 1E88A 1SRZA 2KMSA 1GKNA 1E5GA 1HFIA 3MQLA 5JPMG 4ONTD 1CKLA 2RLPA 2LOJA 1LY2A 3IX0A 4A5WB 3ZD2A 5FO8C 2W80A 2IZ3A 4PZ5A 1OJVA 4IGDA 2BZMA 3GXEA 2UWNA 3L89M 4LOTA 4F4OC 1TPNA 1PPQA 2G7IA 4AYEA 1G4GA 2CG6A 3NFPI 1G4FA 1TPGA 2V8EA 1ELVA 1MD7A 2JGWA 4WJG2 2WIIC 1ZJKA 1OJWA 2XQWC 4B2RA 2IZ4A 2RLQA 3TVJA 5HYTB 5HZPB 1GKGA 2QY0A 1SS2A 3M7PA 4DJZA 4C16A 2B5ID 1VVCA 5HYUB 1Z92B 2CG7A 2RKYA 4B2SA 2JGXA 2YRAA 3R62A 2XWBF 3OP8A 2O39C 4MUCA 3ZD1A 1H2PP 3RJ3D 1OK9A 2XRDA 4YNXA 1GHQB 1OK1A 1OK2A 3EJHA 1U5MA 3GOVA 5HYPA 3SW0X 2EC3A 3OXUD 3ERBA 2ERJA 1HCCA 1C1ZA 4K12A 2XRBA 1Q3XA 3KXVA 2MCZA 2XWJI 3KZJA 4JHSA 4ZH1D 1H2QP 3O8EB 4CSYA 1OK3A 4AYDA 3T5OA 2EHFA 2RKZA 1E8BA 1UOTP 2MCYA 2YBYA 1H04P 1O9AA 2CKUA 3CALA 1VVDA 4AYIA 2JRAA 2A55A 3IU3I 1HFHA 1QGBA 1OJYA 2W81A 4KKDA 1TPMA
chains in the Genus database with same CATH superfamily
1GPZA 1QO6A 1FBRA 3CI0J 3ZRZA 3OEDC 3INBC 1MD8A 3WSYA 2RL0A 1QUBA 2KRIA 4J38B 4AYMA 4LOSA 4FXGG 1H03P 1NWVA 5I0QB 5DN4A 1E88A 1SRZA 2KMSA 1GKNA 1E5GA 1HFIA 3MQLA 2ZYCA 5JPMG 3VWOA 4ONTD 1CKLA 2X2ZA 2RLPA 4N7EA 2LOJA 1LY2A 3IX0A 4A5WB 3ZD2A 5FO8C 2W80A 2IZ3A 4BWCA 4PZ5A 1OJVA 4IGDA 2BZMA 2Y8RA 3GXEA 2UWNA 3L89M 3WSXA 4LOTA 4F4OC 1TPNA 1PPQA 2G7IA 2I2LA 4AYEA 1G4GA 2CG6A 3NFPI 1G4FA 1TPGA 2V8EA 1ELVA 1MD7A 2JGWA 4PO7A 4WJG2 5DN5A 2WIIC 2Y8SA 1ZJKA 1OJWA 2XQWC 4B2RA 2RLQA 2IZ4A 3TVJA 3K3TA 3ZLDA 5HYTB 5HZPB 1GKGA 2QY0A 1SS2A 3M7PA 4DJZA 4C16A 2B5ID 1VVCA 5HYUB 1Z92B 2CG7A 2RKYA 4B2SA 4APLA 3NJAA 2JGXA 2YRAA 3R62A 2XWBF 3FGRA 3FGTA 3OP8A 2O39C 3F6KA 4MUCA 3ZD1A 1H2PP 3RJ3D 1OK9A 2XRDA 4YNXA 1GHQB 4MSLA 1OK1A 1OK2A 3EJHA 1U5MA 3GOVA 5HYPA 3SW0X 2EC3A 3OXUD 3ERBA 2ERJA 1HCCA 1C1ZA 4K12A 2XRBA 1Q3XA 3KXVA 2MCZA 2XWJI 3KZJA 4JHSA 3ZLEA 4ZH1D 1H2QP 3O8EB 4CSYA 1OK3A 4AYDA 3T5OA 1RLHA 2EHFA 2RKZA 1E8BA 1UOTP 2MCYA 2YBYA 1H04P 1O9AA 2CKUA 3CALA 1VVDA 4AYIA 2JRAA 2A55A 3IU3I 1HFHA 1QGBA 1OJYA 4YIZA 2W81A 4KKDA 2Y8TA 1TPMA
chains in the Genus database with same CATH topology
1GPZA 1QO6A 1FBRA 3ZRZA 3OEDC 3INBC 1MD8A 2RL0A 1QUBA 2KRIA 4J38B 4AYMA 4LOSA 4FXGG 1H03P 1NWVA 5I0QB 1E88A 1SRZA 2KMSA 1GKNA 1E5GA 1HFIA 3MQLA 5JPMG 4ONTD 1CKLA 2RLPA 2LOJA 1LY2A 3IX0A 4A5WB 3ZD2A 5FO8C 2W80A 2IZ3A 4PZ5A 1OJVA 4IGDA 2BZMA 3GXEA 2UWNA 3L89M 4LOTA 4F4OC 1TPNA 1PPQA 2G7IA 4AYEA 1G4GA 2CG6A 3NFPI 1G4FA 1TPGA 2V8EA 1ELVA 1MD7A 2JGWA 4WJG2 2WIIC 1ZJKA 1OJWA 2XQWC 4B2RA 2IZ4A 2RLQA 3TVJA 5HYTB 5HZPB 1GKGA 2QY0A 1SS2A 3M7PA 4DJZA 4C16A 2B5ID 1VVCA 5HYUB 1Z92B 2CG7A 2RKYA 4B2SA 2JGXA 2YRAA 3R62A 2XWBF 3OP8A 2O39C 4MUCA 3ZD1A 1H2PP 3RJ3D 1OK9A 2XRDA 4YNXA 1GHQB 1OK1A 1OK2A 3EJHA 1U5MA 3GOVA 5HYPA 3SW0X 2EC3A 3OXUD 3ERBA 2ERJA 1HCCA 1C1ZA 4K12A 2XRBA 1Q3XA 3KXVA 2MCZA 2XWJI 3KZJA 4JHSA 4ZH1D 1H2QP 3O8EB 4CSYA 1OK3A 4AYDA 3T5OA 2EHFA 2RKZA 1E8BA 1UOTP 2MCYA 2YBYA 1H04P 1O9AA 2CKUA 3CALA 1VVDA 4AYIA 2JRAA 2A55A 3IU3I 1HFHA 1QGBA 1OJYA 2W81A 4KKDA 1TPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPZ A;  1QO6 A;  1FBR A;  3ZRZ A;  3OED C;  3INB C;  1MD8 A;  2RL0 A;  1QUB A;  2KRI A;  4J38 B;  4AYM A;  4LOS A;  4FXG G;  1H03 P;  1NWV A;  5I0Q B;  1E88 A;  1SRZ A;  2KMS A;  1GKN A;  1E5G A;  1HFI A;  3MQL A;  5JPM G;  4ONT D;  1CKL A;  2RLP A;  2LOJ A;  1LY2 A;  3IX0 A;  4A5W B;  3ZD2 A;  5FO8 C;  2W80 A;  2IZ3 A;  4PZ5 A;  1OJV A;  4IGD A;  2BZM A;  3GXE A;  2UWN A;  3L89 M;  4LOT A;  4F4O C;  1TPN A;  1PPQ A;  2G7I A;  4AYE A;  1G4G A;  2CG6 A;  3NFP I;  1G4F A;  1TPG A;  2V8E A;  1ELV A;  1MD7 A;  2JGW A;  4WJG 2;  2WII C;  1ZJK A;  1OJW A;  2XQW C;  4B2R A;  2IZ4 A;  2RLQ A;  3TVJ A;  5HYT B;  5HZP B;  1GKG A;  2QY0 A;  1SS2 A;  3M7P A;  4DJZ A;  4C16 A;  2B5I D;  1VVC A;  5HYU B;  1Z92 B;  2CG7 A;  2RKY A;  4B2S A;  2JGX A;  2YRA A;  3R62 A;  2XWB F;  3OP8 A;  2O39 C;  4MUC A;  3ZD1 A;  1H2P P;  3RJ3 D;  1OK9 A;  2XRD A;  4YNX A;  1GHQ B;  1OK1 A;  1OK2 A;  3EJH A;  1U5M A;  3GOV A;  5HYP A;  3SW0 X;  2EC3 A;  3OXU D;  3ERB A;  2ERJ A;  1HCC A;  1C1Z A;  4K12 A;  2XRB A;  1Q3X A;  3KXV A;  2MCZ A;  2XWJ I;  3KZJ A;  4JHS A;  4ZH1 D;  1H2Q P;  3O8E B;  4CSY A;  1OK3 A;  4AYD A;  3T5O A;  2EHF A;  2RKZ A;  1E8B A;  1UOT P;  2MCY A;  2YBY A;  1H04 P;  1O9A A;  2CKU A;  3CAL A;  1VVD A;  4AYI A;  2JRA A;  2A55 A;  3IU3 I;  1HFH A;  1QGB A;  1OJY A;  2W81 A;  4KKD A;  1TPM A; 
#chains in the Genus database with same CATH topology
 1GPZ A;  1QO6 A;  1FBR A;  3CI0 J;  3ZRZ A;  3OED C;  3INB C;  1MD8 A;  3WSY A;  2RL0 A;  1QUB A;  2KRI A;  4J38 B;  4AYM A;  4LOS A;  4FXG G;  1H03 P;  1NWV A;  5I0Q B;  5DN4 A;  1E88 A;  1SRZ A;  2KMS A;  1GKN A;  1E5G A;  1HFI A;  3MQL A;  2ZYC A;  5JPM G;  3VWO A;  4ONT D;  1CKL A;  2X2Z A;  2RLP A;  4N7E A;  2LOJ A;  1LY2 A;  3IX0 A;  4A5W B;  3ZD2 A;  5FO8 C;  2W80 A;  2IZ3 A;  4BWC A;  4PZ5 A;  1OJV A;  4IGD A;  2BZM A;  2Y8R A;  3GXE A;  2UWN A;  3L89 M;  3WSX A;  4LOT A;  4F4O C;  1TPN A;  1PPQ A;  2G7I A;  2I2L A;  4AYE A;  1G4G A;  2CG6 A;  3NFP I;  1G4F A;  1TPG A;  2V8E A;  1ELV A;  1MD7 A;  2JGW A;  4PO7 A;  4WJG 2;  5DN5 A;  2WII C;  2Y8S A;  1ZJK A;  1OJW A;  2XQW C;  4B2R A;  2RLQ A;  2IZ4 A;  3TVJ A;  3K3T A;  3ZLD A;  5HYT B;  5HZP B;  1GKG A;  2QY0 A;  1SS2 A;  3M7P A;  4DJZ A;  4C16 A;  2B5I D;  1VVC A;  5HYU B;  1Z92 B;  2CG7 A;  2RKY A;  4B2S A;  4APL A;  3NJA A;  2JGX A;  2YRA A;  3R62 A;  2XWB F;  3FGR A;  3FGT A;  3OP8 A;  2O39 C;  3F6K A;  4MUC A;  3ZD1 A;  1H2P P;  3RJ3 D;  1OK9 A;  2XRD A;  4YNX A;  1GHQ B;  4MSL A;  1OK1 A;  1OK2 A;  3EJH A;  1U5M A;  3GOV A;  5HYP A;  3SW0 X;  2EC3 A;  3OXU D;  3ERB A;  2ERJ A;  1HCC A;  1C1Z A;  4K12 A;  2XRB A;  1Q3X A;  3KXV A;  2MCZ A;  2XWJ I;  3KZJ A;  4JHS A;  3ZLE A;  4ZH1 D;  1H2Q P;  3O8E B;  4CSY A;  1OK3 A;  4AYD A;  3T5O A;  1RLH A;  2EHF A;  2RKZ A;  1E8B A;  1UOT P;  2MCY A;  2YBY A;  1H04 P;  1O9A A;  2CKU A;  3CAL A;  1VVD A;  4AYI A;  2JRA A;  2A55 A;  3IU3 I;  1HFH A;  1QGB A;  1OJY A;  4YIZ A;  2W81 A;  4KKD A;  2Y8T A;  1TPM A; 
#chains in the Genus database with same CATH homology
 1GPZ A;  1QO6 A;  1FBR A;  3ZRZ A;  3OED C;  3INB C;  1MD8 A;  2RL0 A;  1QUB A;  2KRI A;  4J38 B;  4AYM A;  4LOS A;  4FXG G;  1H03 P;  1NWV A;  5I0Q B;  1E88 A;  1SRZ A;  2KMS A;  1GKN A;  1E5G A;  1HFI A;  3MQL A;  5JPM G;  4ONT D;  1CKL A;  2RLP A;  2LOJ A;  1LY2 A;  3IX0 A;  4A5W B;  3ZD2 A;  5FO8 C;  2W80 A;  2IZ3 A;  4PZ5 A;  1OJV A;  4IGD A;  2BZM A;  3GXE A;  2UWN A;  3L89 M;  4LOT A;  4F4O C;  1TPN A;  1PPQ A;  2G7I A;  4AYE A;  1G4G A;  2CG6 A;  3NFP I;  1G4F A;  1TPG A;  2V8E A;  1ELV A;  1MD7 A;  2JGW A;  4WJG 2;  2WII C;  1ZJK A;  1OJW A;  2XQW C;  4B2R A;  2IZ4 A;  2RLQ A;  3TVJ A;  5HYT B;  5HZP B;  1GKG A;  2QY0 A;  1SS2 A;  3M7P A;  4DJZ A;  4C16 A;  2B5I D;  1VVC A;  5HYU B;  1Z92 B;  2CG7 A;  2RKY A;  4B2S A;  2JGX A;  2YRA A;  3R62 A;  2XWB F;  3OP8 A;  2O39 C;  4MUC A;  3ZD1 A;  1H2P P;  3RJ3 D;  1OK9 A;  2XRD A;  4YNX A;  1GHQ B;  1OK1 A;  1OK2 A;  3EJH A;  1U5M A;  3GOV A;  5HYP A;  3SW0 X;  2EC3 A;  3OXU D;  3ERB A;  2ERJ A;  1HCC A;  1C1Z A;  4K12 A;  2XRB A;  1Q3X A;  3KXV A;  2MCZ A;  2XWJ I;  3KZJ A;  4JHS A;  4ZH1 D;  1H2Q P;  3O8E B;  4CSY A;  1OK3 A;  4AYD A;  3T5O A;  2EHF A;  2RKZ A;  1E8B A;  1UOT P;  2MCY A;  2YBY A;  1H04 P;  1O9A A;  2CKU A;  3CAL A;  1VVD A;  4AYI A;  2JRA A;  2A55 A;  3IU3 I;  1HFH A;  1QGB A;  1OJY A;  2W81 A;  4KKD A;  1TPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...