3ERBA

The crystal structure of c2b, a fragment of complement component c2 produced during c3-convertase formation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
195
structure length
188
Chain Sequence
b'SCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C2
publication title The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 188
sequence length 195
ec nomenclature ec 3.4.21.43: Classical-complement-pathway C3/C5 convertase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA01
2XRBA 1G4FA 2YBYA 2CG6A 2RL0A 3RJ3D 4DJZA 2XWJI 2O39C 2YRAA 4J38B 2RLPA 4B2SA 4AYIA 1E88A 1OK2A 4B2RA 4CSYA 1H03P 3ZRZA 1E5GA 1HCCA 3KXVA 1FBRA 1G4GA 1ELVA 2JGWA 3M7PA 2JRAA 4F4OC 1GKGA 1SS2A 2WIIC 3L89M 3ZD2A 3NFPI 4FXGG 1GPZA 1QUBA 4A5WB 1Q3XA 2W81A 2RKYA 1H2PP 3MQLA 1HFIA 2XRDA 5FO8C 3GOVA 1MD8A 1NWVA 1QGBA 5HYTB 3OXUD 4AYDA 3R62A 4KKDA 2CG7A 2ERJA 4ONTD 3IU3I 4WJG2 1OK1A 4AYMA 4YNXA 2UWNA 1VVCA 3ERBA 1GHQB 1SRZA 1OJYA 1O9AA 2W80A 1QO6A 3KZJA 2EHFA 2G7IA 4AYEA 1GKNA 1HFHA 1PPQA 2RKZA 2EC3A 1E8BA 1VVDA 1OK3A 2QY0A 4LOSA 3INBC 1CKLA 1OJWA 3ZD1A 2A55A 3OP8A 2KRIA 2CKUA 1Z92B 4IGDA 2JGXA 2V8EA 3SW0X 1OJVA 3IX0A 4K12A 5HYPA 3TVJA 4C16A 1H2QP 3EJHA 1UOTP 3GXEA 2MCZA 1MD7A 5I0QB 2IZ4A 1LY2A 1C1ZA 1TPMA 2LOJA 2BZMA 3O8EB 2RLQA 3T5OA 2B5ID 4JHSA 4MUCA 1H04P 4ZH1D 1U5MA 1TPGA 3CALA 2MCYA 3OEDC 2KMSA 5HYUB 5HZPB 2XQWC 5JPMG 4LOTA 1TPNA 1ZJKA 4PZ5A 2IZ3A 1OK9A 2XWBF
chains in the Genus database with same CATH superfamily
2XRBA 4MSLA 1G4FA 3ZLEA 3WSYA 2YBYA 2CG6A 2RL0A 3RJ3D 4DJZA 2XWJI 2O39C 2YRAA 4J38B 2RLPA 4B2SA 4AYIA 1E88A 1OK2A 4B2RA 4CSYA 1H03P 3ZRZA 1E5GA 5DN4A 1HCCA 3KXVA 1FBRA 1G4GA 1ELVA 3FGRA 4N7EA 2JGWA 3M7PA 2JRAA 4F4OC 1GKGA 1SS2A 2WIIC 3L89M 3ZD2A 3NFPI 4FXGG 3CI0J 1GPZA 1QUBA 1RLHA 4A5WB 1Q3XA 2W81A 2RKYA 1H2PP 3MQLA 1HFIA 2XRDA 5FO8C 3VWOA 3GOVA 1MD8A 1NWVA 3ZLDA 1QGBA 3NJAA 5HYTB 3OXUD 4AYDA 4PO7A 3R62A 4KKDA 2CG7A 2ERJA 4ONTD 3IU3I 4WJG2 1OK1A 2Y8SA 4AYMA 4YNXA 2UWNA 1VVCA 3ERBA 1GHQB 1SRZA 1OJYA 1O9AA 2W80A 1QO6A 3KZJA 2EHFA 2G7IA 4YIZA 4AYEA 1GKNA 1HFHA 1PPQA 3FGTA 2I2LA 2RKZA 2EC3A 1E8BA 1VVDA 1OK3A 2QY0A 4LOSA 5DN5A 3INBC 1CKLA 1OJWA 3ZD1A 2A55A 3OP8A 2KRIA 2CKUA 1Z92B 4IGDA 2JGXA 2V8EA 3F6KA 3SW0X 1OJVA 4BWCA 3IX0A 4K12A 5HYPA 3TVJA 4C16A 1H2QP 3EJHA 1UOTP 3GXEA 2MCZA 2Y8TA 1MD7A 2X2ZA 4APLA 5I0QB 2IZ4A 1LY2A 3K3TA 1C1ZA 1TPMA 2LOJA 2BZMA 3O8EB 2RLQA 3T5OA 2B5ID 4JHSA 4MUCA 1H04P 4ZH1D 1U5MA 1TPGA 2ZYCA 3CALA 3WSXA 2MCYA 3OEDC 2KMSA 5HYUB 5HZPB 2XQWC 5JPMG 4LOTA 1TPNA 1ZJKA 2Y8RA 4PZ5A 2IZ3A 1OK9A 2XWBF
chains in the Genus database with same CATH topology
2XRBA 1G4FA 2YBYA 2CG6A 2RL0A 3RJ3D 4DJZA 2XWJI 2O39C 2YRAA 4J38B 2RLPA 4B2SA 4AYIA 1E88A 1OK2A 4B2RA 4CSYA 1H03P 3ZRZA 1E5GA 1HCCA 3KXVA 1FBRA 1G4GA 1ELVA 2JGWA 3M7PA 2JRAA 4F4OC 1GKGA 1SS2A 2WIIC 3L89M 3ZD2A 3NFPI 4FXGG 1GPZA 1QUBA 4A5WB 1Q3XA 2W81A 2RKYA 1H2PP 3MQLA 1HFIA 2XRDA 5FO8C 3GOVA 1MD8A 1NWVA 1QGBA 5HYTB 3OXUD 4AYDA 3R62A 4KKDA 2CG7A 2ERJA 4ONTD 3IU3I 4WJG2 1OK1A 4AYMA 4YNXA 2UWNA 1VVCA 3ERBA 1GHQB 1SRZA 1OJYA 1O9AA 2W80A 1QO6A 3KZJA 2EHFA 2G7IA 4AYEA 1GKNA 1HFHA 1PPQA 2RKZA 2EC3A 1E8BA 1VVDA 1OK3A 2QY0A 4LOSA 3INBC 1CKLA 1OJWA 3ZD1A 2A55A 3OP8A 2KRIA 2CKUA 1Z92B 4IGDA 2JGXA 2V8EA 3SW0X 1OJVA 3IX0A 4K12A 5HYPA 3TVJA 4C16A 1H2QP 3EJHA 1UOTP 3GXEA 2MCZA 1MD7A 5I0QB 2IZ4A 1LY2A 1C1ZA 1TPMA 2LOJA 2BZMA 3O8EB 2RLQA 3T5OA 2B5ID 4JHSA 4MUCA 1H04P 4ZH1D 1U5MA 1TPGA 3CALA 2MCYA 3OEDC 2KMSA 5HYUB 5HZPB 2XQWC 5JPMG 4LOTA 1TPNA 1ZJKA 4PZ5A 2IZ3A 1OK9A 2XWBF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRB A;  1G4F A;  2YBY A;  2CG6 A;  2RL0 A;  3RJ3 D;  4DJZ A;  2XWJ I;  2O39 C;  2YRA A;  4J38 B;  2RLP A;  4B2S A;  4AYI A;  1E88 A;  1OK2 A;  4B2R A;  4CSY A;  1H03 P;  3ZRZ A;  1E5G A;  1HCC A;  3KXV A;  1FBR A;  1G4G A;  1ELV A;  2JGW A;  3M7P A;  2JRA A;  4F4O C;  1GKG A;  1SS2 A;  2WII C;  3L89 M;  3ZD2 A;  3NFP I;  4FXG G;  1GPZ A;  1QUB A;  4A5W B;  1Q3X A;  2W81 A;  2RKY A;  1H2P P;  3MQL A;  1HFI A;  2XRD A;  5FO8 C;  3GOV A;  1MD8 A;  1NWV A;  1QGB A;  5HYT B;  3OXU D;  4AYD A;  3R62 A;  4KKD A;  2CG7 A;  2ERJ A;  4ONT D;  3IU3 I;  4WJG 2;  1OK1 A;  4AYM A;  4YNX A;  2UWN A;  1VVC A;  3ERB A;  1GHQ B;  1SRZ A;  1OJY A;  1O9A A;  2W80 A;  1QO6 A;  3KZJ A;  2EHF A;  2G7I A;  4AYE A;  1GKN A;  1HFH A;  1PPQ A;  2RKZ A;  2EC3 A;  1E8B A;  1VVD A;  1OK3 A;  2QY0 A;  4LOS A;  3INB C;  1CKL A;  1OJW A;  3ZD1 A;  2A55 A;  3OP8 A;  2KRI A;  2CKU A;  1Z92 B;  4IGD A;  2JGX A;  2V8E A;  3SW0 X;  1OJV A;  3IX0 A;  4K12 A;  5HYP A;  3TVJ A;  4C16 A;  1H2Q P;  3EJH A;  1UOT P;  3GXE A;  2MCZ A;  1MD7 A;  5I0Q B;  2IZ4 A;  1LY2 A;  1C1Z A;  1TPM A;  2LOJ A;  2BZM A;  3O8E B;  2RLQ A;  3T5O A;  2B5I D;  4JHS A;  4MUC A;  1H04 P;  4ZH1 D;  1U5M A;  1TPG A;  3CAL A;  2MCY A;  3OED C;  2KMS A;  5HYU B;  5HZP B;  2XQW C;  5JPM G;  4LOT A;  1TPN A;  1ZJK A;  4PZ5 A;  2IZ3 A;  1OK9 A;  2XWB F; 
#chains in the Genus database with same CATH topology
 2XRB A;  4MSL A;  1G4F A;  3ZLE A;  3WSY A;  2YBY A;  2CG6 A;  2RL0 A;  3RJ3 D;  4DJZ A;  2XWJ I;  2O39 C;  2YRA A;  4J38 B;  2RLP A;  4B2S A;  4AYI A;  1E88 A;  1OK2 A;  4B2R A;  4CSY A;  1H03 P;  3ZRZ A;  1E5G A;  5DN4 A;  1HCC A;  3KXV A;  1FBR A;  1G4G A;  1ELV A;  3FGR A;  4N7E A;  2JGW A;  3M7P A;  2JRA A;  4F4O C;  1GKG A;  1SS2 A;  2WII C;  3L89 M;  3ZD2 A;  3NFP I;  4FXG G;  3CI0 J;  1GPZ A;  1QUB A;  1RLH A;  4A5W B;  1Q3X A;  2W81 A;  2RKY A;  1H2P P;  3MQL A;  1HFI A;  2XRD A;  5FO8 C;  3VWO A;  3GOV A;  1MD8 A;  1NWV A;  3ZLD A;  1QGB A;  3NJA A;  5HYT B;  3OXU D;  4AYD A;  4PO7 A;  3R62 A;  4KKD A;  2CG7 A;  2ERJ A;  4ONT D;  3IU3 I;  4WJG 2;  1OK1 A;  2Y8S A;  4AYM A;  4YNX A;  2UWN A;  1VVC A;  3ERB A;  1GHQ B;  1SRZ A;  1OJY A;  1O9A A;  2W80 A;  1QO6 A;  3KZJ A;  2EHF A;  2G7I A;  4YIZ A;  4AYE A;  1GKN A;  1HFH A;  1PPQ A;  3FGT A;  2I2L A;  2RKZ A;  2EC3 A;  1E8B A;  1VVD A;  1OK3 A;  2QY0 A;  4LOS A;  5DN5 A;  3INB C;  1CKL A;  1OJW A;  3ZD1 A;  2A55 A;  3OP8 A;  2KRI A;  2CKU A;  1Z92 B;  4IGD A;  2JGX A;  2V8E A;  3F6K A;  3SW0 X;  1OJV A;  4BWC A;  3IX0 A;  4K12 A;  5HYP A;  3TVJ A;  4C16 A;  1H2Q P;  3EJH A;  1UOT P;  3GXE A;  2MCZ A;  2Y8T A;  1MD7 A;  2X2Z A;  4APL A;  5I0Q B;  2IZ4 A;  1LY2 A;  3K3T A;  1C1Z A;  1TPM A;  2LOJ A;  2BZM A;  3O8E B;  2RLQ A;  3T5O A;  2B5I D;  4JHS A;  4MUC A;  1H04 P;  4ZH1 D;  1U5M A;  1TPG A;  2ZYC A;  3CAL A;  3WSX A;  2MCY A;  3OED C;  2KMS A;  5HYU B;  5HZP B;  2XQW C;  5JPM G;  4LOT A;  1TPN A;  1ZJK A;  2Y8R A;  4PZ5 A;  2IZ3 A;  1OK9 A;  2XWB F; 
#chains in the Genus database with same CATH homology
 2XRB A;  1G4F A;  2YBY A;  2CG6 A;  2RL0 A;  3RJ3 D;  4DJZ A;  2XWJ I;  2O39 C;  2YRA A;  4J38 B;  2RLP A;  4B2S A;  4AYI A;  1E88 A;  1OK2 A;  4B2R A;  4CSY A;  1H03 P;  3ZRZ A;  1E5G A;  1HCC A;  3KXV A;  1FBR A;  1G4G A;  1ELV A;  2JGW A;  3M7P A;  2JRA A;  4F4O C;  1GKG A;  1SS2 A;  2WII C;  3L89 M;  3ZD2 A;  3NFP I;  4FXG G;  1GPZ A;  1QUB A;  4A5W B;  1Q3X A;  2W81 A;  2RKY A;  1H2P P;  3MQL A;  1HFI A;  2XRD A;  5FO8 C;  3GOV A;  1MD8 A;  1NWV A;  1QGB A;  5HYT B;  3OXU D;  4AYD A;  3R62 A;  4KKD A;  2CG7 A;  2ERJ A;  4ONT D;  3IU3 I;  4WJG 2;  1OK1 A;  4AYM A;  4YNX A;  2UWN A;  1VVC A;  3ERB A;  1GHQ B;  1SRZ A;  1OJY A;  1O9A A;  2W80 A;  1QO6 A;  3KZJ A;  2EHF A;  2G7I A;  4AYE A;  1GKN A;  1HFH A;  1PPQ A;  2RKZ A;  2EC3 A;  1E8B A;  1VVD A;  1OK3 A;  2QY0 A;  4LOS A;  3INB C;  1CKL A;  1OJW A;  3ZD1 A;  2A55 A;  3OP8 A;  2KRI A;  2CKU A;  1Z92 B;  4IGD A;  2JGX A;  2V8E A;  3SW0 X;  1OJV A;  3IX0 A;  4K12 A;  5HYP A;  3TVJ A;  4C16 A;  1H2Q P;  3EJH A;  1UOT P;  3GXE A;  2MCZ A;  1MD7 A;  5I0Q B;  2IZ4 A;  1LY2 A;  1C1Z A;  1TPM A;  2LOJ A;  2BZM A;  3O8E B;  2RLQ A;  3T5O A;  2B5I D;  4JHS A;  4MUC A;  1H04 P;  4ZH1 D;  1U5M A;  1TPG A;  3CAL A;  2MCY A;  3OED C;  2KMS A;  5HYU B;  5HZP B;  2XQW C;  5JPM G;  4LOT A;  1TPN A;  1ZJK A;  4PZ5 A;  2IZ3 A;  1OK9 A;  2XWB F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...