3ERBA

The crystal structure of c2b, a fragment of complement component c2 produced during c3-convertase formation
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
195
structure length
188
Chain Sequence
SCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPASRLCKSSGQWQTPKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDGFILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSNLVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C2
publication title The structure of C2b, a fragment of complement component C2 produced during C3 convertase formation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 36
structure length 188
sequence length 195
ec nomenclature ec 3.4.21.43: Classical-complement-pathway C3/C5 convertase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3erbA01
4J38B 1O9AA 2W80A 1VVDA 2KMSA 1QGBA 3KZJA 1OJYA 5FO8C 5HYUB 1E5GA 4KKDA 4K12A 4YNXA 3IX0A 2EHFA 1TPGA 1E88A 1QUBA 2XQWC 3GXEA 1GKNA 1OJVA 1SS2A 1H04P 1ELVA 1NWVA 1OK3A 3RJ3D 1GKGA 2IZ4A 1GPZA 2XRBA 1G4FA 1OK9A 5JPMG 1MD8A 1CKLA 2XWJI 4AYEA 1OJWA 1PPQA 2JGXA 4AYDA 3M7PA 3NFPI 1H2PP 3KXVA 3ERBA 1OK1A 2RLQA 2RKZA 1U5MA 2WIIC 1Q3XA 4PZ5A 4LOTA 3ZD2A 1UOTP 2LOJA 3INBC 3OXUD 1Z92B 3R62A 3T5OA 2O39C 1LY2A 2KRIA 2CG6A 4MUCA 2B5ID 1H03P 2XWBF 1HFIA 2YRAA 2IZ3A 4B2RA 4FXGG 1HFHA 4AYIA 1MD7A 2V8EA 2YBYA 2RL0A 5HZPB 2CKUA 4DJZA 1VVCA 5HYPA 4C16A 4CSYA 5I0QB 3IU3I 4LOSA 2QY0A 2W81A 2MCYA 4ONTD 3GOVA 4ZH1D 2CG7A 2XRDA 2EC3A 1H2QP 2RKYA 3ZD1A 1QO6A 4IGDA 2JRAA 3OP8A 3TVJA 3MQLA 4F4OC 3ZRZA 2A55A 1ZJKA 2BZMA 1OK2A 1SRZA 1E8BA 3CALA 3O8EB 3OEDC 4JHSA 4WJG2 4B2SA 3SW0X 3L89M 2UWNA 5HYTB 1FBRA 1TPMA 2JGWA 1HCCA 1TPNA 2ERJA 2RLPA 4AYMA 4A5WB 3EJHA 2G7IA 1GHQB 1G4GA 1C1ZA 2MCZA
chains in the Genus database with same CATH superfamily
4J38B 1O9AA 2W80A 1VVDA 2KMSA 1QGBA 3KZJA 2X2ZA 1OJYA 4MSLA 5FO8C 3FGRA 5HYUB 1E5GA 4KKDA 4K12A 4YNXA 3IX0A 3FGTA 2EHFA 1TPGA 1E88A 4N7EA 3ZLEA 1QUBA 2XQWC 3GXEA 1GKNA 1RLHA 1OJVA 1SS2A 1H04P 1ELVA 1NWVA 1OK3A 3WSXA 3RJ3D 1GKGA 2IZ4A 2Y8RA 3VWOA 1GPZA 2XRBA 1G4FA 1OK9A 5JPMG 1MD8A 5DN4A 1CKLA 2XWJI 4AYEA 1OJWA 1PPQA 2JGXA 4AYDA 3M7PA 3NFPI 1H2PP 3KXVA 3ERBA 1OK1A 2RLQA 2RKZA 1U5MA 2WIIC 1Q3XA 4PZ5A 4LOTA 3ZD2A 1UOTP 2LOJA 3INBC 3OXUD 1Z92B 3R62A 3T5OA 2O39C 1LY2A 2KRIA 2CG6A 4MUCA 2B5ID 1H03P 2XWBF 2ZYCA 3ZLDA 1HFIA 2YRAA 2IZ3A 4B2RA 4FXGG 1HFHA 4AYIA 1MD7A 2Y8TA 2V8EA 2YBYA 2RL0A 5DN5A 5HZPB 2CKUA 4DJZA 1VVCA 3CI0J 4YIZA 5HYPA 4C16A 4CSYA 2I2LA 3IU3I 5I0QB 4LOSA 2QY0A 2W81A 2Y8SA 4PO7A 2MCYA 4ONTD 3GOVA 3NJAA 4ZH1D 2CG7A 2XRDA 2EC3A 3F6KA 1H2QP 2RKYA 3ZD1A 1QO6A 4IGDA 2JRAA 3OP8A 3K3TA 4APLA 3TVJA 3MQLA 4F4OC 3ZRZA 2A55A 1ZJKA 2BZMA 1OK2A 1SRZA 4BWCA 1E8BA 3CALA 3O8EB 3OEDC 4JHSA 4WJG2 4B2SA 3SW0X 3L89M 2UWNA 3WSYA 5HYTB 1FBRA 1TPMA 2JGWA 1HCCA 1TPNA 2ERJA 2RLPA 4AYMA 4A5WB 3EJHA 2G7IA 1GHQB 1G4GA 1C1ZA 2MCZA
chains in the Genus database with same CATH topology
4J38B 1O9AA 2W80A 1VVDA 2KMSA 1QGBA 3KZJA 1OJYA 5FO8C 5HYUB 1E5GA 4KKDA 4K12A 4YNXA 3IX0A 2EHFA 1TPGA 1E88A 1QUBA 2XQWC 3GXEA 1GKNA 1OJVA 1SS2A 1H04P 1ELVA 1NWVA 1OK3A 3RJ3D 1GKGA 2IZ4A 1GPZA 2XRBA 1G4FA 1OK9A 5JPMG 1MD8A 1CKLA 2XWJI 4AYEA 1OJWA 1PPQA 2JGXA 4AYDA 3M7PA 3NFPI 1H2PP 3KXVA 3ERBA 1OK1A 2RLQA 2RKZA 1U5MA 2WIIC 1Q3XA 4PZ5A 4LOTA 3ZD2A 1UOTP 2LOJA 3INBC 3OXUD 1Z92B 3R62A 3T5OA 2O39C 1LY2A 2KRIA 2CG6A 4MUCA 2B5ID 1H03P 2XWBF 1HFIA 2YRAA 2IZ3A 4B2RA 4FXGG 1HFHA 4AYIA 1MD7A 2V8EA 2YBYA 2RL0A 5HZPB 2CKUA 4DJZA 1VVCA 5HYPA 4C16A 4CSYA 5I0QB 3IU3I 4LOSA 2QY0A 2W81A 2MCYA 4ONTD 3GOVA 4ZH1D 2CG7A 2XRDA 2EC3A 1H2QP 2RKYA 3ZD1A 1QO6A 4IGDA 2JRAA 3OP8A 3TVJA 3MQLA 4F4OC 3ZRZA 2A55A 1ZJKA 2BZMA 1OK2A 1SRZA 1E8BA 3CALA 3O8EB 3OEDC 4JHSA 4WJG2 4B2SA 3SW0X 3L89M 2UWNA 5HYTB 1FBRA 1TPMA 2JGWA 1HCCA 1TPNA 2ERJA 2RLPA 4AYMA 4A5WB 3EJHA 2G7IA 1GHQB 1G4GA 1C1ZA 2MCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J38 B;  1O9A A;  2W80 A;  1VVD A;  2KMS A;  1QGB A;  3KZJ A;  1OJY A;  5FO8 C;  5HYU B;  1E5G A;  4KKD A;  4K12 A;  4YNX A;  3IX0 A;  2EHF A;  1TPG A;  1E88 A;  1QUB A;  2XQW C;  3GXE A;  1GKN A;  1OJV A;  1SS2 A;  1H04 P;  1ELV A;  1NWV A;  1OK3 A;  3RJ3 D;  1GKG A;  2IZ4 A;  1GPZ A;  2XRB A;  1G4F A;  1OK9 A;  5JPM G;  1MD8 A;  1CKL A;  2XWJ I;  4AYE A;  1OJW A;  1PPQ A;  2JGX A;  4AYD A;  3M7P A;  3NFP I;  1H2P P;  3KXV A;  3ERB A;  1OK1 A;  2RLQ A;  2RKZ A;  1U5M A;  2WII C;  1Q3X A;  4PZ5 A;  4LOT A;  3ZD2 A;  1UOT P;  2LOJ A;  3INB C;  3OXU D;  1Z92 B;  3R62 A;  3T5O A;  2O39 C;  1LY2 A;  2KRI A;  2CG6 A;  4MUC A;  2B5I D;  1H03 P;  2XWB F;  1HFI A;  2YRA A;  2IZ3 A;  4B2R A;  4FXG G;  1HFH A;  4AYI A;  1MD7 A;  2V8E A;  2YBY A;  2RL0 A;  5HZP B;  2CKU A;  4DJZ A;  1VVC A;  5HYP A;  4C16 A;  4CSY A;  5I0Q B;  3IU3 I;  4LOS A;  2QY0 A;  2W81 A;  2MCY A;  4ONT D;  3GOV A;  4ZH1 D;  2CG7 A;  2XRD A;  2EC3 A;  1H2Q P;  2RKY A;  3ZD1 A;  1QO6 A;  4IGD A;  2JRA A;  3OP8 A;  3TVJ A;  3MQL A;  4F4O C;  3ZRZ A;  2A55 A;  1ZJK A;  2BZM A;  1OK2 A;  1SRZ A;  1E8B A;  3CAL A;  3O8E B;  3OED C;  4JHS A;  4WJG 2;  4B2S A;  3SW0 X;  3L89 M;  2UWN A;  5HYT B;  1FBR A;  1TPM A;  2JGW A;  1HCC A;  1TPN A;  2ERJ A;  2RLP A;  4AYM A;  4A5W B;  3EJH A;  2G7I A;  1GHQ B;  1G4G A;  1C1Z A;  2MCZ A; 
#chains in the Genus database with same CATH topology
 4J38 B;  1O9A A;  2W80 A;  1VVD A;  2KMS A;  1QGB A;  3KZJ A;  2X2Z A;  1OJY A;  4MSL A;  5FO8 C;  3FGR A;  5HYU B;  1E5G A;  4KKD A;  4K12 A;  4YNX A;  3IX0 A;  3FGT A;  2EHF A;  1TPG A;  1E88 A;  4N7E A;  3ZLE A;  1QUB A;  2XQW C;  3GXE A;  1GKN A;  1RLH A;  1OJV A;  1SS2 A;  1H04 P;  1ELV A;  1NWV A;  1OK3 A;  3WSX A;  3RJ3 D;  1GKG A;  2IZ4 A;  2Y8R A;  3VWO A;  1GPZ A;  2XRB A;  1G4F A;  1OK9 A;  5JPM G;  1MD8 A;  5DN4 A;  1CKL A;  2XWJ I;  4AYE A;  1OJW A;  1PPQ A;  2JGX A;  4AYD A;  3M7P A;  3NFP I;  1H2P P;  3KXV A;  3ERB A;  1OK1 A;  2RLQ A;  2RKZ A;  1U5M A;  2WII C;  1Q3X A;  4PZ5 A;  4LOT A;  3ZD2 A;  1UOT P;  2LOJ A;  3INB C;  3OXU D;  1Z92 B;  3R62 A;  3T5O A;  2O39 C;  1LY2 A;  2KRI A;  2CG6 A;  4MUC A;  2B5I D;  1H03 P;  2XWB F;  2ZYC A;  3ZLD A;  1HFI A;  2YRA A;  2IZ3 A;  4B2R A;  4FXG G;  1HFH A;  4AYI A;  1MD7 A;  2Y8T A;  2V8E A;  2YBY A;  2RL0 A;  5DN5 A;  5HZP B;  2CKU A;  4DJZ A;  1VVC A;  3CI0 J;  4YIZ A;  5HYP A;  4C16 A;  4CSY A;  2I2L A;  3IU3 I;  5I0Q B;  4LOS A;  2QY0 A;  2W81 A;  2Y8S A;  4PO7 A;  2MCY A;  4ONT D;  3GOV A;  3NJA A;  4ZH1 D;  2CG7 A;  2XRD A;  2EC3 A;  3F6K A;  1H2Q P;  2RKY A;  3ZD1 A;  1QO6 A;  4IGD A;  2JRA A;  3OP8 A;  3K3T A;  4APL A;  3TVJ A;  3MQL A;  4F4O C;  3ZRZ A;  2A55 A;  1ZJK A;  2BZM A;  1OK2 A;  1SRZ A;  4BWC A;  1E8B A;  3CAL A;  3O8E B;  3OED C;  4JHS A;  4WJG 2;  4B2S A;  3SW0 X;  3L89 M;  2UWN A;  3WSY A;  5HYT B;  1FBR A;  1TPM A;  2JGW A;  1HCC A;  1TPN A;  2ERJ A;  2RLP A;  4AYM A;  4A5W B;  3EJH A;  2G7I A;  1GHQ B;  1G4G A;  1C1Z A;  2MCZ A; 
#chains in the Genus database with same CATH homology
 4J38 B;  1O9A A;  2W80 A;  1VVD A;  2KMS A;  1QGB A;  3KZJ A;  1OJY A;  5FO8 C;  5HYU B;  1E5G A;  4KKD A;  4K12 A;  4YNX A;  3IX0 A;  2EHF A;  1TPG A;  1E88 A;  1QUB A;  2XQW C;  3GXE A;  1GKN A;  1OJV A;  1SS2 A;  1H04 P;  1ELV A;  1NWV A;  1OK3 A;  3RJ3 D;  1GKG A;  2IZ4 A;  1GPZ A;  2XRB A;  1G4F A;  1OK9 A;  5JPM G;  1MD8 A;  1CKL A;  2XWJ I;  4AYE A;  1OJW A;  1PPQ A;  2JGX A;  4AYD A;  3M7P A;  3NFP I;  1H2P P;  3KXV A;  3ERB A;  1OK1 A;  2RLQ A;  2RKZ A;  1U5M A;  2WII C;  1Q3X A;  4PZ5 A;  4LOT A;  3ZD2 A;  1UOT P;  2LOJ A;  3INB C;  3OXU D;  1Z92 B;  3R62 A;  3T5O A;  2O39 C;  1LY2 A;  2KRI A;  2CG6 A;  4MUC A;  2B5I D;  1H03 P;  2XWB F;  1HFI A;  2YRA A;  2IZ3 A;  4B2R A;  4FXG G;  1HFH A;  4AYI A;  1MD7 A;  2V8E A;  2YBY A;  2RL0 A;  5HZP B;  2CKU A;  4DJZ A;  1VVC A;  5HYP A;  4C16 A;  4CSY A;  5I0Q B;  3IU3 I;  4LOS A;  2QY0 A;  2W81 A;  2MCY A;  4ONT D;  3GOV A;  4ZH1 D;  2CG7 A;  2XRD A;  2EC3 A;  1H2Q P;  2RKY A;  3ZD1 A;  1QO6 A;  4IGD A;  2JRA A;  3OP8 A;  3TVJ A;  3MQL A;  4F4O C;  3ZRZ A;  2A55 A;  1ZJK A;  2BZM A;  1OK2 A;  1SRZ A;  1E8B A;  3CAL A;  3O8E B;  3OED C;  4JHS A;  4WJG 2;  4B2S A;  3SW0 X;  3L89 M;  2UWN A;  5HYT B;  1FBR A;  1TPM A;  2JGW A;  1HCC A;  1TPN A;  2ERJ A;  2RLP A;  4AYM A;  4A5W B;  3EJH A;  2G7I A;  1GHQ B;  1G4G A;  1C1Z A;  2MCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...