2W81A

Structure of a complex between neisseria meningitidis factor h binding protein and ccps 6-7 of human complement factor h
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
115
Chain Sequence
CDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHYALKAQTVTCMENGWSPTPRCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Neisseria Meningitidis Recruits Factor H Using Protein Mimicry of Host Carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 115
sequence length 119
chains with identical sequence B, E
ec nomenclature
pdb deposition date 2009-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2w81A02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2w81A01
2XWBF 3GOVA 1G4GA 1H2PP 2XQWC 3OEDC 1Z92B 2EC3A 1OK3A 5FO8C 4B2SA 1QGBA 3INBC 2YRAA 1UOTP 5I0QB 2MCZA 4CSYA 5JPMG 4KKDA 1TPGA 4B2RA 2B5ID 1ELVA 4IGDA 4LOSA 4A5WB 2KRIA 4ONTD 5HYTB 1FBRA 2QY0A 4WJG2 2XRBA 1VVCA 4LOTA 3TVJA 1OK9A 3MQLA 2RLQA 1U5MA 2JGWA 3SW0X 1LY2A 2IZ3A 2UWNA 1GHQB 1MD7A 1PPQA 1SS2A 1SRZA 2W80A 2EHFA 2O39C 3M7PA 1Q3XA 3R62A 4AYIA 1OJVA 2CKUA 2RLPA 1E8BA 3RJ3D 2A55A 1HCCA 1OK1A 2MCYA 2V8EA 4YNXA 4JHSA 4K12A 3L89M 1H2QP 1HFIA 3ZD1A 2JGXA 2YBYA 5HYPA 4DJZA 3O8EB 2WIIC 3CALA 3GXEA 1TPMA 2BZMA 4PZ5A 1MD8A 1G4FA 2CG7A 1H03P 2XRDA 2RKYA 4MUCA 3T5OA 3KXVA 2LOJA 2CG6A 1OJWA 4AYMA 1QO6A 4C16A 1GKGA 4AYEA 2G7IA 2JRAA 1CKLA 3KZJA 3EJHA 1HFHA 1E88A 3NFPI 1GPZA 4FXGG 2XWJI 3IX0A 1TPNA 1OK2A 2W81A 4F4OC 1ZJKA 4AYDA 1C1ZA 3ZD2A 4ZH1D 1NWVA 1O9AA 2ERJA 3ERBA 1E5GA 2IZ4A 1OJYA 3OXUD 3ZRZA 1VVDA 3OP8A 1GKNA 2KMSA 2RL0A 4J38B 5HYUB 3IU3I 5HZPB 1H04P 2RKZA 1QUBA
chains in the Genus database with same CATH superfamily
2XWBF 3GOVA 1G4GA 4APLA 1H2PP 2XQWC 3NJAA 1Z92B 3OEDC 4MSLA 3WSXA 2EC3A 1OK3A 5FO8C 4B2SA 1QGBA 3INBC 2YRAA 3FGTA 1UOTP 4N7EA 5I0QB 2MCZA 4CSYA 5JPMG 4KKDA 3K3TA 1TPGA 4B2RA 2Y8SA 3ZLDA 2B5ID 1ELVA 4IGDA 4LOSA 4A5WB 2KRIA 4ONTD 5HYTB 1FBRA 2QY0A 4WJG2 2XRBA 1VVCA 4LOTA 3TVJA 1OK9A 3MQLA 2RLQA 1U5MA 3ZLEA 2JGWA 3SW0X 1LY2A 2IZ3A 3F6KA 2UWNA 1GHQB 1MD7A 1PPQA 1SS2A 1SRZA 2W80A 2EHFA 2O39C 3M7PA 1Q3XA 3R62A 4AYIA 1OJVA 2CKUA 2RLPA 1E8BA 3RJ3D 2A55A 1HCCA 1OK1A 2MCYA 2V8EA 4YNXA 4JHSA 4K12A 3L89M 1H2QP 1HFIA 3ZD1A 2JGXA 2YBYA 5HYPA 3WSYA 4DJZA 3O8EB 2WIIC 4YIZA 3CALA 3GXEA 1TPMA 2BZMA 4PZ5A 1MD8A 3CI0J 1G4FA 2CG7A 1H03P 2XRDA 2RKYA 4MUCA 3T5OA 3KXVA 2LOJA 2CG6A 1OJWA 4AYMA 1QO6A 4C16A 1GKGA 4AYEA 2G7IA 2JRAA 1CKLA 3KZJA 3EJHA 1HFHA 2Y8TA 1E88A 3NFPI 1GPZA 4FXGG 2XWJI 2ZYCA 4PO7A 5DN4A 3IX0A 1TPNA 1RLHA 2Y8RA 1OK2A 2W81A 4F4OC 4BWCA 3VWOA 1ZJKA 4AYDA 1C1ZA 3ZD2A 4ZH1D 1NWVA 1O9AA 2ERJA 3ERBA 1E5GA 2IZ4A 1OJYA 5DN5A 3OXUD 3ZRZA 2X2ZA 1VVDA 3OP8A 1GKNA 2KMSA 2RL0A 2I2LA 4J38B 5HYUB 3IU3I 5HZPB 1H04P 2RKZA 1QUBA 3FGRA
chains in the Genus database with same CATH topology
2XWBF 3GOVA 1G4GA 1H2PP 2XQWC 3OEDC 1Z92B 2EC3A 1OK3A 5FO8C 4B2SA 1QGBA 3INBC 2YRAA 1UOTP 5I0QB 2MCZA 4CSYA 5JPMG 4KKDA 1TPGA 4B2RA 2B5ID 1ELVA 4IGDA 4LOSA 4A5WB 2KRIA 4ONTD 5HYTB 1FBRA 2QY0A 4WJG2 2XRBA 1VVCA 4LOTA 3TVJA 1OK9A 3MQLA 2RLQA 1U5MA 2JGWA 3SW0X 1LY2A 2IZ3A 2UWNA 1GHQB 1MD7A 1PPQA 1SS2A 1SRZA 2W80A 2EHFA 2O39C 3M7PA 1Q3XA 3R62A 4AYIA 1OJVA 2CKUA 2RLPA 1E8BA 3RJ3D 2A55A 1HCCA 1OK1A 2MCYA 2V8EA 4YNXA 4JHSA 4K12A 3L89M 1H2QP 1HFIA 3ZD1A 2JGXA 2YBYA 5HYPA 4DJZA 3O8EB 2WIIC 3CALA 3GXEA 1TPMA 2BZMA 4PZ5A 1MD8A 1G4FA 2CG7A 1H03P 2XRDA 2RKYA 4MUCA 3T5OA 3KXVA 2LOJA 2CG6A 1OJWA 4AYMA 1QO6A 4C16A 1GKGA 4AYEA 2G7IA 2JRAA 1CKLA 3KZJA 3EJHA 1HFHA 1E88A 3NFPI 1GPZA 4FXGG 2XWJI 3IX0A 1TPNA 1OK2A 2W81A 4F4OC 1ZJKA 4AYDA 1C1ZA 3ZD2A 4ZH1D 1NWVA 1O9AA 2ERJA 3ERBA 1E5GA 2IZ4A 1OJYA 3OXUD 3ZRZA 1VVDA 3OP8A 1GKNA 2KMSA 2RL0A 4J38B 5HYUB 3IU3I 5HZPB 1H04P 2RKZA 1QUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWB F;  3GOV A;  1G4G A;  1H2P P;  2XQW C;  3OED C;  1Z92 B;  2EC3 A;  1OK3 A;  5FO8 C;  4B2S A;  1QGB A;  3INB C;  2YRA A;  1UOT P;  5I0Q B;  2MCZ A;  4CSY A;  5JPM G;  4KKD A;  1TPG A;  4B2R A;  2B5I D;  1ELV A;  4IGD A;  4LOS A;  4A5W B;  2KRI A;  4ONT D;  5HYT B;  1FBR A;  2QY0 A;  4WJG 2;  2XRB A;  1VVC A;  4LOT A;  3TVJ A;  1OK9 A;  3MQL A;  2RLQ A;  1U5M A;  2JGW A;  3SW0 X;  1LY2 A;  2IZ3 A;  2UWN A;  1GHQ B;  1MD7 A;  1PPQ A;  1SS2 A;  1SRZ A;  2W80 A;  2EHF A;  2O39 C;  3M7P A;  1Q3X A;  3R62 A;  4AYI A;  1OJV A;  2CKU A;  2RLP A;  1E8B A;  3RJ3 D;  2A55 A;  1HCC A;  1OK1 A;  2MCY A;  2V8E A;  4YNX A;  4JHS A;  4K12 A;  3L89 M;  1H2Q P;  1HFI A;  3ZD1 A;  2JGX A;  2YBY A;  5HYP A;  4DJZ A;  3O8E B;  2WII C;  3CAL A;  3GXE A;  1TPM A;  2BZM A;  4PZ5 A;  1MD8 A;  1G4F A;  2CG7 A;  1H03 P;  2XRD A;  2RKY A;  4MUC A;  3T5O A;  3KXV A;  2LOJ A;  2CG6 A;  1OJW A;  4AYM A;  1QO6 A;  4C16 A;  1GKG A;  4AYE A;  2G7I A;  2JRA A;  1CKL A;  3KZJ A;  3EJH A;  1HFH A;  1E88 A;  3NFP I;  1GPZ A;  4FXG G;  2XWJ I;  3IX0 A;  1TPN A;  1OK2 A;  2W81 A;  4F4O C;  1ZJK A;  4AYD A;  1C1Z A;  3ZD2 A;  4ZH1 D;  1NWV A;  1O9A A;  2ERJ A;  3ERB A;  1E5G A;  2IZ4 A;  1OJY A;  3OXU D;  3ZRZ A;  1VVD A;  3OP8 A;  1GKN A;  2KMS A;  2RL0 A;  4J38 B;  5HYU B;  3IU3 I;  5HZP B;  1H04 P;  2RKZ A;  1QUB A; 
#chains in the Genus database with same CATH topology
 2XWB F;  3GOV A;  1G4G A;  4APL A;  1H2P P;  2XQW C;  3NJA A;  1Z92 B;  3OED C;  4MSL A;  3WSX A;  2EC3 A;  1OK3 A;  5FO8 C;  4B2S A;  1QGB A;  3INB C;  2YRA A;  3FGT A;  1UOT P;  4N7E A;  5I0Q B;  2MCZ A;  4CSY A;  5JPM G;  4KKD A;  3K3T A;  1TPG A;  4B2R A;  2Y8S A;  3ZLD A;  2B5I D;  1ELV A;  4IGD A;  4LOS A;  4A5W B;  2KRI A;  4ONT D;  5HYT B;  1FBR A;  2QY0 A;  4WJG 2;  2XRB A;  1VVC A;  4LOT A;  3TVJ A;  1OK9 A;  3MQL A;  2RLQ A;  1U5M A;  3ZLE A;  2JGW A;  3SW0 X;  1LY2 A;  2IZ3 A;  3F6K A;  2UWN A;  1GHQ B;  1MD7 A;  1PPQ A;  1SS2 A;  1SRZ A;  2W80 A;  2EHF A;  2O39 C;  3M7P A;  1Q3X A;  3R62 A;  4AYI A;  1OJV A;  2CKU A;  2RLP A;  1E8B A;  3RJ3 D;  2A55 A;  1HCC A;  1OK1 A;  2MCY A;  2V8E A;  4YNX A;  4JHS A;  4K12 A;  3L89 M;  1H2Q P;  1HFI A;  3ZD1 A;  2JGX A;  2YBY A;  5HYP A;  3WSY A;  4DJZ A;  3O8E B;  2WII C;  4YIZ A;  3CAL A;  3GXE A;  1TPM A;  2BZM A;  4PZ5 A;  1MD8 A;  3CI0 J;  1G4F A;  2CG7 A;  1H03 P;  2XRD A;  2RKY A;  4MUC A;  3T5O A;  3KXV A;  2LOJ A;  2CG6 A;  1OJW A;  4AYM A;  1QO6 A;  4C16 A;  1GKG A;  4AYE A;  2G7I A;  2JRA A;  1CKL A;  3KZJ A;  3EJH A;  1HFH A;  2Y8T A;  1E88 A;  3NFP I;  1GPZ A;  4FXG G;  2XWJ I;  2ZYC A;  4PO7 A;  5DN4 A;  3IX0 A;  1TPN A;  1RLH A;  2Y8R A;  1OK2 A;  2W81 A;  4F4O C;  4BWC A;  3VWO A;  1ZJK A;  4AYD A;  1C1Z A;  3ZD2 A;  4ZH1 D;  1NWV A;  1O9A A;  2ERJ A;  3ERB A;  1E5G A;  2IZ4 A;  1OJY A;  5DN5 A;  3OXU D;  3ZRZ A;  2X2Z A;  1VVD A;  3OP8 A;  1GKN A;  2KMS A;  2RL0 A;  2I2L A;  4J38 B;  5HYU B;  3IU3 I;  5HZP B;  1H04 P;  2RKZ A;  1QUB A;  3FGR A; 
#chains in the Genus database with same CATH homology
 2XWB F;  3GOV A;  1G4G A;  1H2P P;  2XQW C;  3OED C;  1Z92 B;  2EC3 A;  1OK3 A;  5FO8 C;  4B2S A;  1QGB A;  3INB C;  2YRA A;  1UOT P;  5I0Q B;  2MCZ A;  4CSY A;  5JPM G;  4KKD A;  1TPG A;  4B2R A;  2B5I D;  1ELV A;  4IGD A;  4LOS A;  4A5W B;  2KRI A;  4ONT D;  5HYT B;  1FBR A;  2QY0 A;  4WJG 2;  2XRB A;  1VVC A;  4LOT A;  3TVJ A;  1OK9 A;  3MQL A;  2RLQ A;  1U5M A;  2JGW A;  3SW0 X;  1LY2 A;  2IZ3 A;  2UWN A;  1GHQ B;  1MD7 A;  1PPQ A;  1SS2 A;  1SRZ A;  2W80 A;  2EHF A;  2O39 C;  3M7P A;  1Q3X A;  3R62 A;  4AYI A;  1OJV A;  2CKU A;  2RLP A;  1E8B A;  3RJ3 D;  2A55 A;  1HCC A;  1OK1 A;  2MCY A;  2V8E A;  4YNX A;  4JHS A;  4K12 A;  3L89 M;  1H2Q P;  1HFI A;  3ZD1 A;  2JGX A;  2YBY A;  5HYP A;  4DJZ A;  3O8E B;  2WII C;  3CAL A;  3GXE A;  1TPM A;  2BZM A;  4PZ5 A;  1MD8 A;  1G4F A;  2CG7 A;  1H03 P;  2XRD A;  2RKY A;  4MUC A;  3T5O A;  3KXV A;  2LOJ A;  2CG6 A;  1OJW A;  4AYM A;  1QO6 A;  4C16 A;  1GKG A;  4AYE A;  2G7I A;  2JRA A;  1CKL A;  3KZJ A;  3EJH A;  1HFH A;  1E88 A;  3NFP I;  1GPZ A;  4FXG G;  2XWJ I;  3IX0 A;  1TPN A;  1OK2 A;  2W81 A;  4F4O C;  1ZJK A;  4AYD A;  1C1Z A;  3ZD2 A;  4ZH1 D;  1NWV A;  1O9A A;  2ERJ A;  3ERB A;  1E5G A;  2IZ4 A;  1OJY A;  3OXU D;  3ZRZ A;  1VVD A;  3OP8 A;  1GKN A;  2KMS A;  2RL0 A;  4J38 B;  5HYU B;  3IU3 I;  5HZP B;  1H04 P;  2RKZ A;  1QUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...