1H03P

Human cd55 domains 3 & 4
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
KSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT DECAY-ACCELERATING FACTOR
publication title Mapping Cd55 Function. The Structure of Two Pathogen-Binding Domains at 1.7 A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system protein
total genus 15
structure length 125
sequence length 125
chains with identical sequence Q
ec nomenclature
pdb deposition date 2002-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h03P02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1h03P01
4K12A 4YNXA 2A55A 1H03P 5I0QB 1OK3A 1VVDA 2CG7A 2LOJA 2XRBA 4IGDA 3IX0A 1OK1A 4PZ5A 1H04P 2BZMA 3ERBA 1OK9A 4B2SA 4AYEA 1O9AA 3KZJA 2RL0A 1QUBA 2RLPA 5HYUB 3IU3I 1QGBA 1ELVA 1H2QP 5HYTB 2XWJI 4KKDA 2B5ID 1TPNA 4JHSA 2IZ3A 2XRDA 3O8EB 1MD8A 4AYDA 2KRIA 1E88A 2CG6A 2XWBF 1NWVA 1OJWA 2ERJA 3OXUD 2JRAA 2CKUA 1GKGA 2IZ4A 3EJHA 3OEDC 2JGXA 1LY2A 3TVJA 1OJVA 5HYPA 1VVCA 3GXEA 3L89M 1HFHA 4B2RA 1PPQA 2YRAA 2W80A 3R62A 1Q3XA 3RJ3D 3MQLA 2RKYA 2UWNA 1TPGA 3OP8A 2G7IA 3KXVA 4AYIA 5FO8C 5JPMG 1MD7A 1UOTP 4C16A 1HCCA 1QO6A 1E5GA 3M7PA 1HFIA 1SRZA 1OK2A 3GOVA 1TPMA 2MCYA 2W81A 2RLQA 3CALA 3ZD2A 4LOSA 2WIIC 2EC3A 4DJZA 1GKNA 2O39C 3INBC 4J38B 2JGWA 2MCZA 4CSYA 4LOTA 1G4FA 1FBRA 4A5WB 3T5OA 4WJG2 1E8BA 1G4GA 1GPZA 2YBYA 1Z92B 2XQWC 2RKZA 4FXGG 4F4OC 1CKLA 3SW0X 2KMSA 1SS2A 2QY0A 1ZJKA 4AYMA 4ONTD 3ZD1A 3ZRZA 4ZH1D 1C1ZA 2V8EA 2EHFA 1H2PP 5HZPB 1OJYA 1GHQB 1U5MA 4MUCA 3NFPI
chains in the Genus database with same CATH superfamily
4K12A 4YNXA 2A55A 1H03P 5I0QB 1OK3A 1VVDA 2CG7A 2LOJA 2XRBA 4IGDA 3IX0A 4YIZA 1OK1A 4PZ5A 1H04P 2BZMA 3CI0J 3ERBA 1OK9A 4B2SA 4AYEA 1O9AA 3KZJA 2RL0A 1QUBA 2Y8TA 2RLPA 5HYUB 3IU3I 1QGBA 1ELVA 1H2QP 3ZLEA 5HYTB 2XWJI 4KKDA 2ZYCA 2B5ID 2I2LA 4N7EA 1TPNA 4JHSA 2IZ3A 2XRDA 3O8EB 1MD8A 4AYDA 2KRIA 1E88A 3ZLDA 2Y8SA 2CG6A 2XWBF 1NWVA 1OJWA 4BWCA 2ERJA 3OXUD 5DN4A 2JRAA 2CKUA 1GKGA 2IZ4A 3EJHA 3OEDC 2JGXA 1LY2A 5DN5A 3TVJA 1OJVA 3VWOA 4APLA 5HYPA 1VVCA 3GXEA 3L89M 2Y8RA 1HFHA 4B2RA 1PPQA 2YRAA 2W80A 3R62A 1Q3XA 3RJ3D 3MQLA 2RKYA 2UWNA 1TPGA 3FGTA 3OP8A 2G7IA 3KXVA 4AYIA 5FO8C 5JPMG 1MD7A 1UOTP 4C16A 3FGRA 1HCCA 1QO6A 1E5GA 3NJAA 3M7PA 1HFIA 1SRZA 1OK2A 4PO7A 3GOVA 1TPMA 2MCYA 2W81A 3F6KA 2RLQA 3CALA 3ZD2A 4LOSA 1RLHA 2WIIC 2EC3A 4DJZA 1GKNA 2O39C 3INBC 4J38B 2JGWA 2MCZA 4CSYA 4LOTA 1G4FA 1FBRA 4A5WB 3T5OA 4WJG2 1E8BA 1G4GA 1GPZA 2YBYA 1Z92B 2XQWC 2RKZA 4FXGG 2X2ZA 1CKLA 4F4OC 4MSLA 3SW0X 2KMSA 1SS2A 2QY0A 1ZJKA 4AYMA 4ONTD 3ZD1A 3WSXA 3ZRZA 4ZH1D 1C1ZA 2V8EA 2EHFA 1H2PP 5HZPB 1OJYA 1GHQB 3K3TA 1U5MA 3WSYA 4MUCA 3NFPI
chains in the Genus database with same CATH topology
4K12A 4YNXA 2A55A 1H03P 5I0QB 1OK3A 1VVDA 2CG7A 2LOJA 2XRBA 4IGDA 3IX0A 1OK1A 4PZ5A 1H04P 2BZMA 3ERBA 1OK9A 4B2SA 4AYEA 1O9AA 3KZJA 2RL0A 1QUBA 2RLPA 5HYUB 3IU3I 1QGBA 1ELVA 1H2QP 5HYTB 2XWJI 4KKDA 2B5ID 1TPNA 4JHSA 2IZ3A 2XRDA 3O8EB 1MD8A 4AYDA 2KRIA 1E88A 2CG6A 2XWBF 1NWVA 1OJWA 2ERJA 3OXUD 2JRAA 2CKUA 1GKGA 2IZ4A 3EJHA 3OEDC 2JGXA 1LY2A 3TVJA 1OJVA 5HYPA 1VVCA 3GXEA 3L89M 1HFHA 4B2RA 1PPQA 2YRAA 2W80A 3R62A 1Q3XA 3RJ3D 3MQLA 2RKYA 2UWNA 1TPGA 3OP8A 2G7IA 3KXVA 4AYIA 5FO8C 5JPMG 1MD7A 1UOTP 4C16A 1HCCA 1QO6A 1E5GA 3M7PA 1HFIA 1SRZA 1OK2A 3GOVA 1TPMA 2MCYA 2W81A 2RLQA 3CALA 3ZD2A 4LOSA 2WIIC 2EC3A 4DJZA 1GKNA 2O39C 3INBC 4J38B 2JGWA 2MCZA 4CSYA 4LOTA 1G4FA 1FBRA 4A5WB 3T5OA 4WJG2 1E8BA 1G4GA 1GPZA 2YBYA 1Z92B 2XQWC 2RKZA 4FXGG 4F4OC 1CKLA 3SW0X 2KMSA 1SS2A 2QY0A 1ZJKA 4AYMA 4ONTD 3ZD1A 3ZRZA 4ZH1D 1C1ZA 2V8EA 2EHFA 1H2PP 5HZPB 1OJYA 1GHQB 1U5MA 4MUCA 3NFPI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K12 A;  4YNX A;  2A55 A;  1H03 P;  5I0Q B;  1OK3 A;  1VVD A;  2CG7 A;  2LOJ A;  2XRB A;  4IGD A;  3IX0 A;  1OK1 A;  4PZ5 A;  1H04 P;  2BZM A;  3ERB A;  1OK9 A;  4B2S A;  4AYE A;  1O9A A;  3KZJ A;  2RL0 A;  1QUB A;  2RLP A;  5HYU B;  3IU3 I;  1QGB A;  1ELV A;  1H2Q P;  5HYT B;  2XWJ I;  4KKD A;  2B5I D;  1TPN A;  4JHS A;  2IZ3 A;  2XRD A;  3O8E B;  1MD8 A;  4AYD A;  2KRI A;  1E88 A;  2CG6 A;  2XWB F;  1NWV A;  1OJW A;  2ERJ A;  3OXU D;  2JRA A;  2CKU A;  1GKG A;  2IZ4 A;  3EJH A;  3OED C;  2JGX A;  1LY2 A;  3TVJ A;  1OJV A;  5HYP A;  1VVC A;  3GXE A;  3L89 M;  1HFH A;  4B2R A;  1PPQ A;  2YRA A;  2W80 A;  3R62 A;  1Q3X A;  3RJ3 D;  3MQL A;  2RKY A;  2UWN A;  1TPG A;  3OP8 A;  2G7I A;  3KXV A;  4AYI A;  5FO8 C;  5JPM G;  1MD7 A;  1UOT P;  4C16 A;  1HCC A;  1QO6 A;  1E5G A;  3M7P A;  1HFI A;  1SRZ A;  1OK2 A;  3GOV A;  1TPM A;  2MCY A;  2W81 A;  2RLQ A;  3CAL A;  3ZD2 A;  4LOS A;  2WII C;  2EC3 A;  4DJZ A;  1GKN A;  2O39 C;  3INB C;  4J38 B;  2JGW A;  2MCZ A;  4CSY A;  4LOT A;  1G4F A;  1FBR A;  4A5W B;  3T5O A;  4WJG 2;  1E8B A;  1G4G A;  1GPZ A;  2YBY A;  1Z92 B;  2XQW C;  2RKZ A;  4FXG G;  4F4O C;  1CKL A;  3SW0 X;  2KMS A;  1SS2 A;  2QY0 A;  1ZJK A;  4AYM A;  4ONT D;  3ZD1 A;  3ZRZ A;  4ZH1 D;  1C1Z A;  2V8E A;  2EHF A;  1H2P P;  5HZP B;  1OJY A;  1GHQ B;  1U5M A;  4MUC A;  3NFP I; 
#chains in the Genus database with same CATH topology
 4K12 A;  4YNX A;  2A55 A;  1H03 P;  5I0Q B;  1OK3 A;  1VVD A;  2CG7 A;  2LOJ A;  2XRB A;  4IGD A;  3IX0 A;  4YIZ A;  1OK1 A;  4PZ5 A;  1H04 P;  2BZM A;  3CI0 J;  3ERB A;  1OK9 A;  4B2S A;  4AYE A;  1O9A A;  3KZJ A;  2RL0 A;  1QUB A;  2Y8T A;  2RLP A;  5HYU B;  3IU3 I;  1QGB A;  1ELV A;  1H2Q P;  3ZLE A;  5HYT B;  2XWJ I;  4KKD A;  2ZYC A;  2B5I D;  2I2L A;  4N7E A;  1TPN A;  4JHS A;  2IZ3 A;  2XRD A;  3O8E B;  1MD8 A;  4AYD A;  2KRI A;  1E88 A;  3ZLD A;  2Y8S A;  2CG6 A;  2XWB F;  1NWV A;  1OJW A;  4BWC A;  2ERJ A;  3OXU D;  5DN4 A;  2JRA A;  2CKU A;  1GKG A;  2IZ4 A;  3EJH A;  3OED C;  2JGX A;  1LY2 A;  5DN5 A;  3TVJ A;  1OJV A;  3VWO A;  4APL A;  5HYP A;  1VVC A;  3GXE A;  3L89 M;  2Y8R A;  1HFH A;  4B2R A;  1PPQ A;  2YRA A;  2W80 A;  3R62 A;  1Q3X A;  3RJ3 D;  3MQL A;  2RKY A;  2UWN A;  1TPG A;  3FGT A;  3OP8 A;  2G7I A;  3KXV A;  4AYI A;  5FO8 C;  5JPM G;  1MD7 A;  1UOT P;  4C16 A;  3FGR A;  1HCC A;  1QO6 A;  1E5G A;  3NJA A;  3M7P A;  1HFI A;  1SRZ A;  1OK2 A;  4PO7 A;  3GOV A;  1TPM A;  2MCY A;  2W81 A;  3F6K A;  2RLQ A;  3CAL A;  3ZD2 A;  4LOS A;  1RLH A;  2WII C;  2EC3 A;  4DJZ A;  1GKN A;  2O39 C;  3INB C;  4J38 B;  2JGW A;  2MCZ A;  4CSY A;  4LOT A;  1G4F A;  1FBR A;  4A5W B;  3T5O A;  4WJG 2;  1E8B A;  1G4G A;  1GPZ A;  2YBY A;  1Z92 B;  2XQW C;  2RKZ A;  4FXG G;  2X2Z A;  1CKL A;  4F4O C;  4MSL A;  3SW0 X;  2KMS A;  1SS2 A;  2QY0 A;  1ZJK A;  4AYM A;  4ONT D;  3ZD1 A;  3WSX A;  3ZRZ A;  4ZH1 D;  1C1Z A;  2V8E A;  2EHF A;  1H2P P;  5HZP B;  1OJY A;  1GHQ B;  3K3T A;  1U5M A;  3WSY A;  4MUC A;  3NFP I; 
#chains in the Genus database with same CATH homology
 4K12 A;  4YNX A;  2A55 A;  1H03 P;  5I0Q B;  1OK3 A;  1VVD A;  2CG7 A;  2LOJ A;  2XRB A;  4IGD A;  3IX0 A;  1OK1 A;  4PZ5 A;  1H04 P;  2BZM A;  3ERB A;  1OK9 A;  4B2S A;  4AYE A;  1O9A A;  3KZJ A;  2RL0 A;  1QUB A;  2RLP A;  5HYU B;  3IU3 I;  1QGB A;  1ELV A;  1H2Q P;  5HYT B;  2XWJ I;  4KKD A;  2B5I D;  1TPN A;  4JHS A;  2IZ3 A;  2XRD A;  3O8E B;  1MD8 A;  4AYD A;  2KRI A;  1E88 A;  2CG6 A;  2XWB F;  1NWV A;  1OJW A;  2ERJ A;  3OXU D;  2JRA A;  2CKU A;  1GKG A;  2IZ4 A;  3EJH A;  3OED C;  2JGX A;  1LY2 A;  3TVJ A;  1OJV A;  5HYP A;  1VVC A;  3GXE A;  3L89 M;  1HFH A;  4B2R A;  1PPQ A;  2YRA A;  2W80 A;  3R62 A;  1Q3X A;  3RJ3 D;  3MQL A;  2RKY A;  2UWN A;  1TPG A;  3OP8 A;  2G7I A;  3KXV A;  4AYI A;  5FO8 C;  5JPM G;  1MD7 A;  1UOT P;  4C16 A;  1HCC A;  1QO6 A;  1E5G A;  3M7P A;  1HFI A;  1SRZ A;  1OK2 A;  3GOV A;  1TPM A;  2MCY A;  2W81 A;  2RLQ A;  3CAL A;  3ZD2 A;  4LOS A;  2WII C;  2EC3 A;  4DJZ A;  1GKN A;  2O39 C;  3INB C;  4J38 B;  2JGW A;  2MCZ A;  4CSY A;  4LOT A;  1G4F A;  1FBR A;  4A5W B;  3T5O A;  4WJG 2;  1E8B A;  1G4G A;  1GPZ A;  2YBY A;  1Z92 B;  2XQW C;  2RKZ A;  4FXG G;  4F4O C;  1CKL A;  3SW0 X;  2KMS A;  1SS2 A;  2QY0 A;  1ZJK A;  4AYM A;  4ONT D;  3ZD1 A;  3ZRZ A;  4ZH1 D;  1C1Z A;  2V8E A;  2EHF A;  1H2P P;  5HZP B;  1OJY A;  1GHQ B;  1U5M A;  4MUC A;  3NFP I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...