2LOJA

Solution nmr structure of tstm1273 from salmonella typhimurium lt2, nesg target stt322, csgid target idp01027 and ocsp target tstm1273
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
63
Chain Sequence
MSRMDNTELPHPKEIDNETLLPAAERRVNSQALLGPDGKVIIDHNGQEYLLRKTQAGKLLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative cytoplasmic protein
publication title Solution NMR structure of TSTM1273 from Salmonella typhimurium LT2, NESG target STT322, CSGID target IDP01027 and OCSP target TSTM1273
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Structural genomics, unknown function
total genus 8
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10636 hemP Hemin uptake protein hemP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2lojA01
1G4GA 4A5WB 1GHQB 1ZJKA 1Z92B 3O8EB 1NWVA 4AYEA 4CSYA 2KRIA 2RKYA 1H2PP 3KZJA 1PPQA 2EHFA 1SS2A 1OJWA 1VVCA 1U5MA 4AYIA 3IU3I 1E5GA 1C1ZA 4B2SA 4DJZA 2JGWA 2MCZA 4LOSA 3NFPI 1OK3A 3OEDC 2B5ID 1GKGA 3OXUD 4FXGG 3CALA 3ZD1A 2JGXA 1G4FA 3INBC 1MD8A 2CG7A 2EC3A 4WJG2 4F4OC 4J38B 3L89M 2MCYA 2IZ4A 3ZD2A 2CKUA 1TPNA 2JRAA 3RJ3D 1TPMA 2RLQA 2XRDA 3GXEA 1ELVA 4KKDA 1E88A 2A55A 1E8BA 5HYUB 1UOTP 1OK2A 3EJHA 1H03P 2CG6A 4B2RA 2G7IA 2ERJA 4AYMA 1HFIA 1QO6A 3SW0X 2KMSA 2XWBF 2YBYA 1Q3XA 3ERBA 2QY0A 4ONTD 1TPGA 3IX0A 4AYDA 1FBRA 5FO8C 5JPMG 4MUCA 5HYPA 2O39C 3GOVA 2RL0A 3ZRZA 2LOJA 5HYTB 1QUBA 5HZPB 4JHSA 2XRBA 2RKZA 2YRAA 3OP8A 3MQLA 1QGBA 4LOTA 1SRZA 4IGDA 1VVDA 1CKLA 3T5OA 1H2QP 1GKNA 2W80A 5I0QB 4C16A 1O9AA 2XWJI 2WIIC 4YNXA 1GPZA 1OK9A 1H04P 1OJYA 1OJVA 1LY2A 4PZ5A 2IZ3A 3KXVA 1MD7A 1OK1A 2UWNA 3M7PA 4K12A 4ZH1D 2V8EA 2BZMA 2XQWC 3R62A 1HFHA 2RLPA 1HCCA 2W81A 3TVJA
chains in the Genus database with same CATH superfamily
1G4GA 4A5WB 1GHQB 5DN5A 1ZJKA 1Z92B 3CI0J 3O8EB 1NWVA 4AYEA 4CSYA 2KRIA 2RKYA 1H2PP 3KZJA 1PPQA 2EHFA 1SS2A 1OJWA 1VVCA 1U5MA 2Y8TA 3ZLEA 4AYIA 3IU3I 1E5GA 1C1ZA 3K3TA 4B2SA 3FGTA 2ZYCA 5DN4A 4DJZA 2JGWA 2MCZA 4LOSA 3NFPI 1OK3A 3OEDC 2B5ID 4BWCA 3VWOA 1GKGA 3OXUD 4FXGG 3CALA 3ZD1A 3WSXA 4YIZA 2JGXA 3WSYA 1G4FA 3INBC 1MD8A 2CG7A 2EC3A 2X2ZA 4WJG2 4MSLA 4F4OC 4J38B 3L89M 2MCYA 4N7EA 2IZ4A 3ZD2A 2CKUA 1TPNA 2JRAA 3RJ3D 1TPMA 2RLQA 2XRDA 3GXEA 1ELVA 2Y8SA 4KKDA 1E88A 2A55A 1RLHA 1E8BA 5HYUB 1UOTP 1OK2A 3EJHA 1H03P 2CG6A 4B2RA 2G7IA 2ERJA 4AYMA 1HFIA 1QO6A 3SW0X 2KMSA 3NJAA 2XWBF 3FGRA 3F6KA 2YBYA 1Q3XA 3ERBA 2QY0A 4ONTD 4PO7A 2I2LA 1TPGA 3IX0A 4AYDA 1FBRA 5FO8C 5JPMG 4MUCA 5HYPA 2O39C 3GOVA 2RL0A 3ZRZA 2LOJA 5HYTB 1QUBA 5HZPB 4JHSA 2XRBA 2RKZA 2YRAA 3OP8A 3MQLA 1QGBA 2Y8RA 4LOTA 1SRZA 4IGDA 1VVDA 1CKLA 3T5OA 1H2QP 1GKNA 2W80A 4APLA 5I0QB 4C16A 1O9AA 2XWJI 2WIIC 4YNXA 1GPZA 1OK9A 1H04P 1OJYA 1OJVA 1LY2A 4PZ5A 2IZ3A 3KXVA 1MD7A 1OK1A 2UWNA 3M7PA 4K12A 4ZH1D 2V8EA 2BZMA 2XQWC 3R62A 1HFHA 3ZLDA 2RLPA 1HCCA 2W81A 3TVJA
chains in the Genus database with same CATH topology
1G4GA 4A5WB 1GHQB 1ZJKA 1Z92B 3O8EB 1NWVA 4AYEA 4CSYA 2KRIA 2RKYA 1H2PP 3KZJA 1PPQA 2EHFA 1SS2A 1OJWA 1VVCA 1U5MA 4AYIA 3IU3I 1E5GA 1C1ZA 4B2SA 4DJZA 2JGWA 2MCZA 4LOSA 3NFPI 1OK3A 3OEDC 2B5ID 1GKGA 3OXUD 4FXGG 3CALA 3ZD1A 2JGXA 1G4FA 3INBC 1MD8A 2CG7A 2EC3A 4WJG2 4F4OC 4J38B 3L89M 2MCYA 2IZ4A 3ZD2A 2CKUA 1TPNA 2JRAA 3RJ3D 1TPMA 2RLQA 2XRDA 3GXEA 1ELVA 4KKDA 1E88A 2A55A 1E8BA 5HYUB 1UOTP 1OK2A 3EJHA 1H03P 2CG6A 4B2RA 2G7IA 2ERJA 4AYMA 1HFIA 1QO6A 3SW0X 2KMSA 2XWBF 2YBYA 1Q3XA 3ERBA 2QY0A 4ONTD 1TPGA 3IX0A 4AYDA 1FBRA 5FO8C 5JPMG 4MUCA 5HYPA 2O39C 3GOVA 2RL0A 3ZRZA 2LOJA 5HYTB 1QUBA 5HZPB 4JHSA 2XRBA 2RKZA 2YRAA 3OP8A 3MQLA 1QGBA 4LOTA 1SRZA 4IGDA 1VVDA 1CKLA 3T5OA 1H2QP 1GKNA 2W80A 5I0QB 4C16A 1O9AA 2XWJI 2WIIC 4YNXA 1GPZA 1OK9A 1H04P 1OJYA 1OJVA 1LY2A 4PZ5A 2IZ3A 3KXVA 1MD7A 1OK1A 2UWNA 3M7PA 4K12A 4ZH1D 2V8EA 2BZMA 2XQWC 3R62A 1HFHA 2RLPA 1HCCA 2W81A 3TVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4G A;  4A5W B;  1GHQ B;  1ZJK A;  1Z92 B;  3O8E B;  1NWV A;  4AYE A;  4CSY A;  2KRI A;  2RKY A;  1H2P P;  3KZJ A;  1PPQ A;  2EHF A;  1SS2 A;  1OJW A;  1VVC A;  1U5M A;  4AYI A;  3IU3 I;  1E5G A;  1C1Z A;  4B2S A;  4DJZ A;  2JGW A;  2MCZ A;  4LOS A;  3NFP I;  1OK3 A;  3OED C;  2B5I D;  1GKG A;  3OXU D;  4FXG G;  3CAL A;  3ZD1 A;  2JGX A;  1G4F A;  3INB C;  1MD8 A;  2CG7 A;  2EC3 A;  4WJG 2;  4F4O C;  4J38 B;  3L89 M;  2MCY A;  2IZ4 A;  3ZD2 A;  2CKU A;  1TPN A;  2JRA A;  3RJ3 D;  1TPM A;  2RLQ A;  2XRD A;  3GXE A;  1ELV A;  4KKD A;  1E88 A;  2A55 A;  1E8B A;  5HYU B;  1UOT P;  1OK2 A;  3EJH A;  1H03 P;  2CG6 A;  4B2R A;  2G7I A;  2ERJ A;  4AYM A;  1HFI A;  1QO6 A;  3SW0 X;  2KMS A;  2XWB F;  2YBY A;  1Q3X A;  3ERB A;  2QY0 A;  4ONT D;  1TPG A;  3IX0 A;  4AYD A;  1FBR A;  5FO8 C;  5JPM G;  4MUC A;  5HYP A;  2O39 C;  3GOV A;  2RL0 A;  3ZRZ A;  2LOJ A;  5HYT B;  1QUB A;  5HZP B;  4JHS A;  2XRB A;  2RKZ A;  2YRA A;  3OP8 A;  3MQL A;  1QGB A;  4LOT A;  1SRZ A;  4IGD A;  1VVD A;  1CKL A;  3T5O A;  1H2Q P;  1GKN A;  2W80 A;  5I0Q B;  4C16 A;  1O9A A;  2XWJ I;  2WII C;  4YNX A;  1GPZ A;  1OK9 A;  1H04 P;  1OJY A;  1OJV A;  1LY2 A;  4PZ5 A;  2IZ3 A;  3KXV A;  1MD7 A;  1OK1 A;  2UWN A;  3M7P A;  4K12 A;  4ZH1 D;  2V8E A;  2BZM A;  2XQW C;  3R62 A;  1HFH A;  2RLP A;  1HCC A;  2W81 A;  3TVJ A; 
#chains in the Genus database with same CATH topology
 1G4G A;  4A5W B;  1GHQ B;  5DN5 A;  1ZJK A;  1Z92 B;  3CI0 J;  3O8E B;  1NWV A;  4AYE A;  4CSY A;  2KRI A;  2RKY A;  1H2P P;  3KZJ A;  1PPQ A;  2EHF A;  1SS2 A;  1OJW A;  1VVC A;  1U5M A;  2Y8T A;  3ZLE A;  4AYI A;  3IU3 I;  1E5G A;  1C1Z A;  3K3T A;  4B2S A;  3FGT A;  2ZYC A;  5DN4 A;  4DJZ A;  2JGW A;  2MCZ A;  4LOS A;  3NFP I;  1OK3 A;  3OED C;  2B5I D;  4BWC A;  3VWO A;  1GKG A;  3OXU D;  4FXG G;  3CAL A;  3ZD1 A;  3WSX A;  4YIZ A;  2JGX A;  3WSY A;  1G4F A;  3INB C;  1MD8 A;  2CG7 A;  2EC3 A;  2X2Z A;  4WJG 2;  4MSL A;  4F4O C;  4J38 B;  3L89 M;  2MCY A;  4N7E A;  2IZ4 A;  3ZD2 A;  2CKU A;  1TPN A;  2JRA A;  3RJ3 D;  1TPM A;  2RLQ A;  2XRD A;  3GXE A;  1ELV A;  2Y8S A;  4KKD A;  1E88 A;  2A55 A;  1RLH A;  1E8B A;  5HYU B;  1UOT P;  1OK2 A;  3EJH A;  1H03 P;  2CG6 A;  4B2R A;  2G7I A;  2ERJ A;  4AYM A;  1HFI A;  1QO6 A;  3SW0 X;  2KMS A;  3NJA A;  2XWB F;  3FGR A;  3F6K A;  2YBY A;  1Q3X A;  3ERB A;  2QY0 A;  4ONT D;  4PO7 A;  2I2L A;  1TPG A;  3IX0 A;  4AYD A;  1FBR A;  5FO8 C;  5JPM G;  4MUC A;  5HYP A;  2O39 C;  3GOV A;  2RL0 A;  3ZRZ A;  2LOJ A;  5HYT B;  1QUB A;  5HZP B;  4JHS A;  2XRB A;  2RKZ A;  2YRA A;  3OP8 A;  3MQL A;  1QGB A;  2Y8R A;  4LOT A;  1SRZ A;  4IGD A;  1VVD A;  1CKL A;  3T5O A;  1H2Q P;  1GKN A;  2W80 A;  4APL A;  5I0Q B;  4C16 A;  1O9A A;  2XWJ I;  2WII C;  4YNX A;  1GPZ A;  1OK9 A;  1H04 P;  1OJY A;  1OJV A;  1LY2 A;  4PZ5 A;  2IZ3 A;  3KXV A;  1MD7 A;  1OK1 A;  2UWN A;  3M7P A;  4K12 A;  4ZH1 D;  2V8E A;  2BZM A;  2XQW C;  3R62 A;  1HFH A;  3ZLD A;  2RLP A;  1HCC A;  2W81 A;  3TVJ A; 
#chains in the Genus database with same CATH homology
 1G4G A;  4A5W B;  1GHQ B;  1ZJK A;  1Z92 B;  3O8E B;  1NWV A;  4AYE A;  4CSY A;  2KRI A;  2RKY A;  1H2P P;  3KZJ A;  1PPQ A;  2EHF A;  1SS2 A;  1OJW A;  1VVC A;  1U5M A;  4AYI A;  3IU3 I;  1E5G A;  1C1Z A;  4B2S A;  4DJZ A;  2JGW A;  2MCZ A;  4LOS A;  3NFP I;  1OK3 A;  3OED C;  2B5I D;  1GKG A;  3OXU D;  4FXG G;  3CAL A;  3ZD1 A;  2JGX A;  1G4F A;  3INB C;  1MD8 A;  2CG7 A;  2EC3 A;  4WJG 2;  4F4O C;  4J38 B;  3L89 M;  2MCY A;  2IZ4 A;  3ZD2 A;  2CKU A;  1TPN A;  2JRA A;  3RJ3 D;  1TPM A;  2RLQ A;  2XRD A;  3GXE A;  1ELV A;  4KKD A;  1E88 A;  2A55 A;  1E8B A;  5HYU B;  1UOT P;  1OK2 A;  3EJH A;  1H03 P;  2CG6 A;  4B2R A;  2G7I A;  2ERJ A;  4AYM A;  1HFI A;  1QO6 A;  3SW0 X;  2KMS A;  2XWB F;  2YBY A;  1Q3X A;  3ERB A;  2QY0 A;  4ONT D;  1TPG A;  3IX0 A;  4AYD A;  1FBR A;  5FO8 C;  5JPM G;  4MUC A;  5HYP A;  2O39 C;  3GOV A;  2RL0 A;  3ZRZ A;  2LOJ A;  5HYT B;  1QUB A;  5HZP B;  4JHS A;  2XRB A;  2RKZ A;  2YRA A;  3OP8 A;  3MQL A;  1QGB A;  4LOT A;  1SRZ A;  4IGD A;  1VVD A;  1CKL A;  3T5O A;  1H2Q P;  1GKN A;  2W80 A;  5I0Q B;  4C16 A;  1O9A A;  2XWJ I;  2WII C;  4YNX A;  1GPZ A;  1OK9 A;  1H04 P;  1OJY A;  1OJV A;  1LY2 A;  4PZ5 A;  2IZ3 A;  3KXV A;  1MD7 A;  1OK1 A;  2UWN A;  3M7P A;  4K12 A;  4ZH1 D;  2V8E A;  2BZM A;  2XQW C;  3R62 A;  1HFH A;  2RLP A;  1HCC A;  2W81 A;  3TVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...