1GPZA

The crystal structure of the zymogen catalytic domain of complement protease c1r
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
396
structure length
368
Chain Sequence
IKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQQIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGIAHDLRFVRLPVANPQACENSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords COMPLEMENT C1R COMPONENT
publication title The Crystal Structure of the Zymogen Catalytic Domain of Complement Protease C1R Reveals that a Disruptive Mechanical Stress is Required to Trigger Activation of the C1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 368
sequence length 396
chains with identical sequence B
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2001-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gpzA04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA02
4FXGH 2AIPA 1GI0A 2DE9A 2UUKB 1Y3VA 1P3EA 3ZZ8A 1ETRH 3GY5A 3Q00A 1PQ8A 8KME2 1O30A 4DCDA 2ANKH 1YPJH 4ABAA 4I8LA 3BF6H 2OD3B 1OSSA 1GHWH 3ZVAA 4I31A 1C1VH 1KXAA 2FOCA 1W8BH 1ELCA 3S9AA 2CJIA 3STIA 2AGGX 3U8RH 1DM4B 1H8IH 2ZGBH 2GZ9A 4XFQA 1ZGVA 4D8NA 2TPIZ 1UVTH 1P2NA 4IN1A 3GYLB 1HUTH 3SV6A 3GY8A 4B2BA 2HNTF 1KLIH 1HAGE 1O39A 6LPRA 2CG7A 1HJ8A 3RMLH 3STJA 2Z94A 4BXSA 2FM2A 1O2VA 2BZAA 3D23A 3GY4A 5FX5A 2XCNA 3MYWA 3QO6A 2STAE 2Y6TA 1MKWH 1ID5H 1S85A 4Q80A 3RXAA 5C20A 3ATMA 1D9IA 1XVMA 3FP7E 4JK6A 1W13U 1OYQA 3MU4A 1JWTA 3RXFA 3OU0A 2CHAC 2NWNA 1TMTH 3F1SB 2BM2A 2BD3A 2GGVB 4H4FA 2C4FH 1ZRKA 3GDUA 4WMFA 5LGOA 2OP9A 1Q2WA 3R0FA 3SJIA 2TGAA 1HJAB 2CMYA 2FX4A 3SW0X 3FVFB 3W95A 1P57B 2P3FH 1SLXB 2QF0A 5K7RA 2F9PA 1O33A 2P16A 2G00A 2FLBH 7GCHG 4GHTA 3A81A 2ZNKH 3PV4A 4UFGH 1UK4A 4X6NA 4KTSA 3PTNA 3RXGA 4YLUA 2VVUA 1C2IA 3M37A 2VVCA 1TMUH 4MPVA 1W2KH 1D4PB 3LGUA 2ZP0H 3SU5A 5L2YH 3BTME 1O9AA 1S84A 2ZDMA 4FU9A 2OC7A 4TPIZ 1WYKA 1NFWA 2H9EH 1LHCH 1FI8A 1RIWC 3A8DA 1AB9C 1ZGIA 3NCLA 1X7AC 4CR5A 3KXVA 1G3EA 3UY9A 1SGYE 1C5NH 3NUMA 1QL9A 1T7CA 3TITA 3Q3XA 3MTYA 2ALVA 1EXFA 3GY6A 2ZU5A 1TPPA 4Y0YE 1UCYK 1VJ9U 1J17T 2EC3A 1UJ1A 1HYLA 5A8YA 1W14U 4IN2A 4YNXA 1OJVA 3E0NB 5F03A 2BLQA 4TWWA 3UR9A 4BAOB 1O3MA 1EJMA 1V2KT 3SV7A 4GLYA 1GJAB 2ZI2H 3M7QA 4JZFH 2JETC 2ZPQA 1FPHH 1GCTC 1FIWA 1P2IA 1D6WA 1VVDA 1HXEH 1Z92B 2SGDE 4X6MA 5EG4A 1ACBE 3SJOA 4ISNA 3TJNA 4CREA 1KIGH 1TGCA 4A1VA 3KQDA 3VPKA 1PYTC 1A4WH 4JMYA 3BV9B 1JBUH 3KL6A 1FBRA 3U98H 3BEUA 2Z9IA 2LNCA 2VVVA 4CBOA 1RD3B 1LHGH 1VCWA 3RXPA 2QF3A 5TCAA 3SJ8A 2QYIA 2XRBA 1LKBA 1WV7H 3A86A 1W7XH 1QJ1B 1TGBA 3VB3A 2DE8A 2QXJA 2C8ZB 3P92A 1AI8H 2BY5X 1OP8A 2ZU2A 5DP4A 3OP8A 2R0KA 2GDDA 2ODPA 2HPQH 2ZC9H 1OXGA 4HFPB 1LPGB 3TJUA 1TNLA 2BDBA 4KGAA 1NU7B 5I25A 2W5EA 3URCA 3GCNA 1NRSH 5DJ7A 3QTOH 1ZPCA 2C8WB 3ZV9A 4FUJA 1E0FD 4LXBH 2ERJA 3BSQA 3BTTE 3LGWA 1UVOA 1YPLH 4DJZB 4TPYA 2QCYA 1MBQA 1BTZA 2ZDAH 1Z7KA 2ZFFH 2ZPSA 4DOQA 2B5TB 4VGCB 3GCTF 1QGBA 3AW1A 3UOUA 1RTLA 4UFDH 1A7SA 1O31A 1GMDG 3M3TA 4MLFB 4BOHA 1C2MA 1ETSH 2FS9A 2NU2E 1TX7A 3ZVFA 1A3EH 4NSYA 3IITA 3SU2A 1O3KA 1Y5BT 3UR6A 1TPNA 2ZTZA 3ZZ5A 2FYQA 1WTGH 4H42U 1AD8H 4AYYB 2AMDA 1SGFG 5HM9A 2VNTA 1QNJA 2OQ5A 3A8BA 3RC4A 3UIRA 1G4GA 4F4OC 2FESH 1YCPM 1GI7B 4H6SB 1F7ZA 1C1SA 1AVXA 6CHAB 1ZHMA 2VIQA 2HRVA 1XUIA 1OJWA 1TA2A 1A0JA 1ZOMA 4ISOA 2ZU3A 3UNSA 1G32B 1TQ0B 1Z8IB 1QQUA 1QTFA 1TAWA 1GL0E 1MQ6A 1MTUA 3EJHA 3EA8A 4JZEH 2OTVA 5F8TA 5T6DA 1E38B 3ZZ7A 1C4Y2 1L4DA 2FOEA 2QGRA 1ZMJA 4CHAC 1SVPA 1N8OC 3F9FA 2QXGA 3LONA 4GPGA 1HBTH 1Y5UT 1H04P 1GBDA 1ARCA 1EZQA 1SC8U 5CHAB 3F9EA 2I6SA 3PM3A 1AHTH 3GISB 4B75A 2HPPH 1NRPH 1NPMA 1O3PB 2RKZA 1O2TA 4X8TH 5HM2A 3BTQE 2FMJA 2WPMS 2ZHDA 2B7DH 4NA9H 4O3UA 1GDUA 1F0RA 1K28D 2UWNA 3M5MA 2XCFA 1H4WA 1QL7A 3M36A 4X8UH 4YZUA 1D3PB 1O3EA 1TBRH 2FP7B 4PROA 1GJCB 4X1QU 2VWOA 1UCYE 3L33A 5EXLA 1F0TA 2ZDLA 2B0FA 5FAHA 3ZRZA 3GOVB 3S0NA 1EX3A 1O3JA 1DY9A 4A7IB 2OXSA 1C2HA 1V2LT 4M7GA 4AYIA 1DITH 1V2UT 5JPMH 1GPZA 2BY6X 1C1PA 4X0WU 1PQ7A 1GGDC 4X2WA 3RLYH 1YGCH 4WJG2 4OS5A 1BZXE 1GBHA 4Y0ZE 5DP7A 2PUXB 3QLPH 2BQWB 4U2WA 1DXPA 2NU0E 1QRXA 1TQ7B 2PSYA 3QX5H 4WWYA 3EGKH 2G52A 2RL0A 1Z8JB 3VB4A 1KTTB 2ZKSA 2EI6A 3SNAA 3MNCA 4XBDA 1NRQH 3QZQA 1O2SA 4JZDH 5LH8A 1UTLM 1C2FA 1MKWK 2ZCHP 3OSYA 1ABIH 4Q7XA 2IJOB 1ZHPA 1MAYA 4LK4A 4I8JA 4O03A 1C5SA 2BLWA 2QA9E 2TIOA 3EA9A 2PGBB 4K2YA 4BAHB 4DT7B 3AVZA 3O8DA 2AERH 2ZDNA 5DP5A 2J2UA 3CS7A 1B5GH 1W11U 4K1TA 2XQWC 3KIDU 4IW4E 3SORA 3I77A 2UWPA 2W7UA 4B2CA 1EUFA 2ZG0H 1FN8A 2PTNA 3K9XB 2HVXA 3PTBA 1T4VH 4RSPA 2CHAB 1O38A 2XBVA 4TWYA 3RU4D 4MNXA 1NESE 6ESTA 4JZ1A 2BVXH 3GY7A 2EHFA 3JZ1B 2MCYA 1YBWA 2G4TA 1GBJA 3ATWA 4YOGA 3SU4A 2WIIC 1V2OT 2XNIA 4J1YA 4DJZA 3SI4H 2NU3E 1V2RT 2FX6A 2BY8X 3VGCC 2FS8A 2A2XH 3DT0H 3TH3H 2AH4X 3ZZ4A 3F6UH 1H2QP 4DG4A 2CG6A 3OEDC 1FPCH 2NU1E 2O8LA 3IX0A 1DANH 5EPYA 1VCQA 5CMXH 1GL1A 1YKTA 1TOMH 3ODDA 1HFDA 1ELAA 1PQAA 5C5NA 2BDIA 2EI8A 1DDJA 1P03A 3BTDE 1V2WT 4ZAEA 3RP2A 5EGMA 1BTXA 2GDEH 3H7TA 1O2QA 3KEEA 1OWDA 1AB9B 3KN2A 4BAKB 1GHQB 4K8YA 3PMAB 2VB0A 1MKXH 2VJ1A 4ABBA 2H2ZA 1EQ9A 5TJXA 1T32A 4XBBA 1FJSA 1O3LA 2ALPA 1YLDA 1LHFH 1RGQA 1TA6A 1ESTA 3ZZBA 4LZ1H 4JYTA 1GJ5H 2UWOA 4ONTD 3PB1E 4INHA 4NGAH 2RLPA 4I33A 2KRIA 2PLXA 1MTNC 1T4UH 2SNWA 4KKDA 2XXLA 1K1MA 1ANDA 1CT2E 2FTLE 2YBYA 1CT0E 1OJYA 2Z3DA 3MMGA 2JETB 5PTPA 1MCTA 4CR9A 1G2MA 1Z6JH 7GCHF 1BRUP 1K1PA 1P3CA 4GHQA 4AGKA 4B76A 4E06H 1C2EA 2XC4A 1G37A 4YESB 3SBKA 1DVAH 1ELBA 4I32A 3UOPA 4CH8B 1K1OA 1DWCH 5GIBA 4NWLA 3SV2H 5EODA 1UTPA 3T29A 1RTFB 2WPIS 1TFXA 1E36B 4NG9H 1D3DB 1UK3A 1ELFA 5DPAA 3PROA 3TK9A 5ESBA 2W3KA 1IQIA 2EEKA 2CKUA 3QGNB 4DY7B 2FOAA 3GCOA 8LPRA 3Q76A 2FIRH 3DFJA 1O2LA 2YRAA 3LC5A 1BIOA 1NTPA 1GDNA 1GHBF 1FV9A 1Y3UA 3FP8E 3QZRA 3ESTA 1IQKA 4NZLA 4TY6A 5DKMA 3TU7H 2P59A 2WUBA 3U8OH 2Y81A 4MPXA 3LC3A 3A7XA 1LQEA 4Y71A 9ESTA 3LGTA 1FDPA 2ZO3H 2ZDKA 1UHBB 3GOVA 3BIUH 3RC5A 4FVBA 1VR1H 3LJJA 2F9NA 1AN1E 2WPLS 4F49A 5T3HA 2BZMA 1C5RA 1OK2A 1BMMH 5BPEA 3RU4T 3MOCA 3MNXA 1BTWA 1RXPA 1THRH 2EC9H 3A89A 1IAUA 4IMQA 1W3CA 1QJ6B 2O8TA 1KYNA 1C1WH 1HFIA 1HIAB 3K2UA 4RN6A 3SU0A 5HYTB 1FLEE 1O2ZA 1Z6EA 2BQ6B 4ISHH 3K6ZA 2RCEA 2STBE 1C5VA 1BMLA 4Y8XA 1CHGA 1DWDH 4Q2KA 4NWKA 9LPRA 4X8VH 1YLCA 1HAHH 1ZJDA 1GVLA 3PMBB 3DD2H 4K3JA 1CA0C 1Y59T 4K60A 1OWEA 3ATLA 4WH8A 2ZFPH 4I8KA 1QQ4A 2GD4B 3V3MA 1HCGA 2SGQE 3SNDA 2GTBA 3TNTA 2V3HH 5DP8A 3TJOA 1QJ7B 1OKXA 2O8UA 2P94A 2FI3E 4NFFA 4BTTB 1H1BA 1GHAF 3UREA 5C67A 2Q1JA 3O8EB 1BHXF 4A6LA 1GWAA 3BN9A 4ABEA 1A2CH 7KMEH 4WMDA 1EPTC 2F9OA 3V12A 4A1TA 3M5OA 1MUEB 1Y5AT 1FY8E 1O2RA 2A4QA 1DICA 3B8JA 5DP3A 2JGXA 1C5WB 1XXFA 1Z1IA 1C5UA 2VINA 3ATKA 1SFIA 2J38A 1JOUB 2OCVB 3E0PB 1EOJA 3PMJA 1VGCC 4CHAB 2PTCE 3RXJA 2VIVA 4WY3A 1LHEH 1N8OB 1RJXB 1GI2A 1ANEA 3SNBA 5AF9H 1G36A 4ZXYH 1IQMA 3NKKA 3U8TH 3M35A 5AVDA 1C1UH 4XBCA 1J9CH 3TJVA 3RC6A 4JHSA 1W7GH 1GMDF 1YC0A 1AFQC 3MO3A 1QIXB 3TLOA 4ABHA 3CALA 5FBIA 1KDQA 2XWBI 1OS8A 3PO1C 2IPHA 4U32A 2O39C 3SJ9A 2FI4E 2GX4A 3KHVA 3AASA 4U30A 1P02A 1QBNA 2PKAB 1ESBA 4HZHA 1SGCA 3RXEA 1SOTA 1AVWA 4ZUHA 1EZSC 1HRTH 1O3DA 1P0SH 2Z9JA 4WF8A 2FLRH 2ZHQH 1PPCE 3FAOA 3M7TA 1SLVB 4J2YB 2F9BH 1L1JA 3D49H 1C4V2 5FBEA 4IBLH 4Q7ZA 1UTNA 1O37A 4CBNA 1GJ4H 4OGYA 3NXPA 1EKBB 5C1UA 1GBMA 3LU9B 1D6RA 2F91A 3EDXB 3S9CA 1Y3WA 1DWEH 2CF9H 1GMCG 3EAJA 3R3GB 1O2PA 1GBTA 1GGDB 1PPZA 4YTAA 1BOQA 1SQAA 3M61U 1GHBG 3I29A 1SGNE 2UUYA 3RMMH 4YLQH 4ZHLU 5EXNA 5TCCA 3MHWU 4JYUH 1SG8B 4MNVA 1TALA 1PPEE 1C2LA 3TK6A 4FUCA 1CBWB 3GCHC 1OOKB 1F92A 2WYJA 3OYPA 1H2PP 3A80A 4BANB 5FO8C 1C5ZB 3BIVH 1SGTA 4UFEH 1WSSH 3V13A 5E8EH 1OWIA 1YPGH 8GCHG 1O2HA 1F5LA 1GHXH 3T62A 1TNGA 2ZHWH 2UUFB 1K2I1 1HAVB 2V8EA 1OP2A 1TBZH 1BJVA 1AKSB 1OK1A 1P09A 1TPSA 3HGPA 1LY2A 4A5WB 1UHBA 4AG2A 1G2LA 3MWIU 5JBAS 2P93A 3PLBA 1P12E 4CSYA 1V3XA 1ZMNA 1UMAH 1JIRA 3RXKA 1C1QA 3SHCH 1VITH 2ZEBA 1BCUH 1BHXB 1J16A 4GSOA 1P11E 1DFPA 4AX9H 1LCYA 1HIAA 1BB0B 3I78A 1GHAG 3PLPA 2SGAA 1V2TT 4CRBA 1IQLA 4FXGG 1NN6A 1KY9A 3PWBA 3LDXH 5A09A 2WV5A 2P8OC 1K21H 1QB6A 3KQBA 2BMGB 4GUXA 4ISLA 5JBBS 4FUGA 3ZZ9A 1HAXB 2JH5D 2A2QH 5DG6A 2AGEX 3MH4A 5EQQA 4ESTE 1QA0A 1B0FA 1AIXH 3KF2A 2DUCA 1QO6A 2BB4A 1DS2E 3SUDA 3TPIZ 3A85A 3S9BA 3PWCA 4TY7A 3SU3A 1PPQA 4AYDA 1O32A 2HLCA 2R3YA 2B9LA 2GV7A 1P2KA 1QRWA 1O2WA 2P3UB 3F9GA 4ZKOU 1HFHA 1GBCA 1Y3XA 1Q3XA 1GHVH 4UE7H 3SW2B 3SOSA 3ZZAA 4X2VA 1GG6C 2R2WU 5GJ4B 4NZQA 5B6OA 2FWWA 3UFAA 1GI1A 2ANMH 1AUTC 3JZ2B 4ZH1D 2FZZA 3ZVCA 5FPYA 3A84A 2Z9LA 1TABE 1NRNH 4X2XA 1A46H 2OUAA 3E1XB 1SGQE 3HK3B 1KTSB 2BDGA 5GPIB 1Q31A 3DUXH 1O5AB 4K5ZA 3RXQA 4KTUA 1VJAU 5FPSA 4LZ4B 3V0XA 1FMGA 3BTHE 4IGDA 1W12U 1WU1A 1D3QB 5JB8S 2THFB 4K1SA 1EZXC 1CT4E 3BG4C 1GJ8B 2AGIX 2ZZUH 3T5OA 1EZUC 2Q6GA 1JRTA 1GBAA 4LOYH 3P8OA 4YM9A 2B8OH 1V2QT 3HKJB 1XVOA 2GCHF 1DUAA 5A8XA 5J4QA 3VFEA 5C1XA 3M7PA 1NT1A 2PKAA 3ZD2A 1PPBH 1SL3A 2TRMA 2O9QA 4B2AA 1C1TA 1Y3YA 1ARBA 4FVDA 1G3BA 2A0QB 5E0HA 2CGAA 1TMBH 1AU8A 4CRAA 1OWKA 4ABFA 1GCDA 4ISIH 1TNJA 5HYUB 2BX4A 1E35B 1WOFA 5IDKA 3ZZCA 2ULLA 1QGFA 1O3NA 4U01A 1YPHC 3MH7A 1DE7H 1LPKB 1UVUH 2VIPA 1RTKA 5GDSH 1Z8GA 2ZA5A 3E8LA 2ASUB 1HAPH 1ABJH 2VIWA 1P06A 2BLVA 1P05A 4ZXXH 1KXEA 3KQCA 4XE4A 4FU8A 1PPHE 3MQLA 1PQ5A 1C9TA 2PWXA 1FY3A 3L3TA 4AFUA 1P2OA 3OX7U 2OLGA 3CENA 1GI8B 2GZ8A 1N6XA 2XBXA 4MG3A 2Y5GA 5ABWA 4C16A 1J15A 2XWJI 1O2NA 3NK8A 2A7CA 1GI4A 1FN6A 2GT8A 5AFYH 1OWHA 5FCRA 1NROH 1CHOG 2PKSC 2VH0A 2A45B 2AMPA 1ZYOA 1ZPZA 2Y5HA 2BD7A 1HCCA 2IOTA 2W3IA 2Z9GA 4GCHF 1C5YB 4ASHA 2K1QA 5LPRA 2BZ6H 4ZROA 3S7HB 1QRZA 1ZSJA 3HKIB 1BDAA 2Y7XA 1DT2A 2A31A 4IMZA 1MD8A 1QB9A 1O3CA 2I6QA 1AE5A 2O8WA 3SU6A 1DOJA 2PV9B 1FIZA 5JDUB 2FOFA 1IQNA 1HV7A 1O2IA 1TPMA 4D7GA 1MMJN 1HAVA 3P95A 1WQSA 4AYMA 3C27B 2BD9A 1AKSA 1GJDB 3LJOA 3UNRA 1MU6B 1ZJKA 1O2KA 1G3CA 1H03P 1ZSLA 4CRFA 3ENSB 3LGIA 1P9SA 1GJ7B 1S0RA 2AYWA 1QL8A 2VIDA 4AFSA 4AN7A 4AYVB 4AZ2B 3QTVH 1UTOA 1O3AA 1ZTKA 2TGPZ 1DXWA 3KZJA 1PYTD 1MH0A 3A83A 1ELDE 1VITG 3ZVGA 3SQEE 1AZ8A 5EXMA 4ZH8A 1YPEH 1W0YH 3D62A 1U6QA 2IZ3A 2ZCKP 4BNRA 2FOGA 3U1JB 1EASA 1GBIA 1NFXA 1TYNA 1XUGA 3LPRA 1LDTT 5SGAE 1AVGH 1YPHE 5I0QB 3LKWA 4CRCA 3M3VA 7ESTE 1FNIA 2D2DA 1A61H 1NY22 1O5CB 1SB1H 3SNCA 1BBRH 3GICB 1INCA 1J8AA 3VXFH 3MNSA 4NIXA 2VIOA 1XUJA 2H5CA 1LMWB 3TNSA 4OGXA 5L6NH 2PHBA 3P70B 1SSXA 2A5KA 1GBBA 2GV6A 2SGFE 2BOHB 4CRDA 2A1DB 4MQAA 1K1LA 4XDEA 2ZFRH 4GVUA 2J9NA 4FUDA 2ANWA 5JYIA 3SU1A 4AOQA 1S6FA 1ZMLA 1QBOA 1SHYA 1C1ZA 5K0HA 3AAUA 1GBEA 4OS6A 4HTCH 1KDQB 1SGFA 1T8NA 2GCHG 2RA3A 2RKYA 1PJPA 1DPOA 1RIWB 4MNYA 1GDQA 3SUGA 1TPGA 3T5FH 5LPEA 1P2JA 1ZLRA 2BD5A 1H8DH 1EATA 2OC8A 4KELA 4D9RA 1EAXA 4X2YA 1AWFH 1YF4A 2XC5A 1UTKA 4NA8A 5A0CA 4O3TA 4Z6AH 3V7TA 1SRZA 1IQEA 1ZTLA 4JCNA 2Y7ZA 1UTMA 1A0HB 4IC6A 1A3BH 4I8HA 2JH6D 1KXBA 3GCHB 5JBCS 1UOTP 2R9PA 1PFXC 2EI7A 2ZTXA 4B73A 2BD8A 4X8SH 2ZWLH 5AFZH 3RUOA 2OQUA 2W80A 3E90B 4AB9A 1DLKB 1K1JA 1QBVH 2VH6A 3ZD1A 1OK3A 1GCTB 1SQTA 3Q3YA 3QUMP 5C2ZA 3FZZA 4O9VA 5FHTA 2FO9A 3TH2H 1JXPA 2ZFSA 3MH6A 1Z1JA 4FUFA 1DWBH 1BMAA 1FY1A 4YOJA 2VWMA 1YCPH 2Q6FA 2FODA 5L2ZH 3H7OA 3TVJB 4GCHG 1GKGA 1JMOH 1GHZA 3P17H 2HOBA 5DGJA 1GMCF 4ABJA 2TGTA 1BRCE 2ZU1A 4ZMAH 1KXDA 1E5GA 1LVMA 3DHKH 4QT8C 4BTIB 6CHAC 1GI5A 3UQOA 1HGTH 1A1RA 2BTCE 2ZU4A 1XUFA 5GCHG 4NIVA 1QY6A 1V2MT 2AMQA 1T31A 1HAIH 4WVPE 3SGAE 5DP9A 3MO9A 1SBWA 3WY8A 2P8OB 2ODYB 1TRMA 1K22H 4B2RA 4FUBA 3BG8A 5F8ZA 3FFGA 1XUHA 1SLUB 5H4IB 1C1OA 1AQ7A 5JPMG 8GCHF 2NU4E 2OC0A 2XW9A 3QDZB 3RXCA 4X1PU 4AFQA 2BDAA 4JZIA 5FXLA 1C1MA 2BOKA 1G9IE 2BX3A 1CE5A 4R0IA 3Q3KA 3PLKA 1QHRB 4NIWA 3SI3H 1GMHG 1NO9H 2OINA 1NC6A 3MU8A 1C9PA 4DGJA 3GY2A 3KCGH 2YNBA 3NFPI 4AG1A 1O2JA 1QB1A 1TNKA 2FYRA 1GG6B 4WXIA 3SV8A 3SO3A 4Y8ZA 5GXPA 2BD2A 4AORA 1O3FA 1JIMA 5HYPA 3VB6A 4SGAE 1E8BA 1MTSA 2ZGJA 2ZQ2A 1LO6A 3FP6E 1AUJA 1KLJH 3G01A 3PMHB 2A55A 3SHAH 1SR5C 1W10U 3BG4B 2G4UA 2R2MB 2JGWA 3TK5A 1UK2A 3TH4H 1DUEA 2W26A 4K69A 5DK1A 1IQFA 3BTEE 2BY7X 1CSOE 1EB2A 4WMEA 1OP0A 1P04A 5DP6A 1VCPA 4Y7AA 1P01A 3ZYDA 1N6YA 2VGCC 1VZQH 2QC2A 3C1KA 4YT7H 3ODFA 5AHGH 2OBOA 4FUEA 1C5LH 1HPGA 4WH6A 3RXBA 1FZZA 1S6HA 2ANYA 5I46H 2A5IA 3RXRA 1SGIB 1OYTH 2G51A 4THNH 2G7IA 2XRCA 1AFEH 1ORFA 4YO9A 2XTTB 5A8ZA 5T6FA 3BTKE 1BQYA 2Y82A 3RMOH 1O3IA 3GY3A 5HYOA 1HJ9A 1V2NT 2WYGA 3KNXA 2P95A 1QFKH 3KGPA 1CGJE 1AE8H 3RXOA 1L2EA 5E0JA 2KAIB 1NS3A 4FU7A 4GAWA 2QN5T 1TX8A 1THPB 4WXVA 2XWBF 1ANBA 2XWAA 2FPZA 1A0LA 4ZKNU 1V2VT 1EOLA 1ZHRA 2XYAA 2VWNA 3AW0A 5F8XA 3E3TA 4NCYA 1CGIE 2OBQA 1B0EA 1TRYA 2HWLB 1IOEA 2PKSB 4MDSA 1C5XB 3TIUA 1V2PT 3NZIA 4K8BA 2J92A 1TIOA 1A5HA 1XXDA 4DW2U 2R3UA 4CH2B 3SV9A 2Q6DA 2ZCLP 4PZ5A 3A7ZA 1K9OE 4ABGA 5EQRA 2F3CE 1NRRH 1M9UA 1PPFE 5A0AE 3TGIE 2F9UA 1MCVA 1BTUA 5L30H 2LPRA 1C2KA 1TOCB 1B7XB 2Z3EA 3EYDA 3S69A 1TPAE 5DO4H 1BT7A 3RXDA 2A7JA 3RXVA 1D3TB 2BHGA 1XX9A 3UNQA 4B2SA 3S7KB 2AIQA 6GCHF 1P2MA 2ZTYA 4RKOB 2GMTC 2QV1A 2BDYA 1FXYA 3DA9B 3A7VA 4MNWA 1ELGA 4JYVH 3VB5A 1P2QA 3TVJA 2KMSA 3SUEA 5JBTA 3HPTB 5JB9S 4INKA 3AAVA 2AEIH 4TYDA 5ETXA 1HAZB 3A8AA 1L0ZA 1HDTH 4Y8YA 3QGJA 1CKLA 3O8RA 4CRGA 4MUCA 1BUIA 3A8CA 5EOKA 3BTGE 1ANCA 3ZVBA 1C2JA 3L89M 2ZDVH 4AFZA 1MTVA 1SI5H 1Z8RA 4DVAU 4ABDA 2D26C 1SLWB 1TGSZ 2BXUH 2ZHEH 1O0DH 1CHOF 2PGQB 2SGPE 2EA3A 1SHHB 4E05H 4ZKRU 1BBRK 1KXCA 3MU5A 1XUKA 1TNIA 1XM1A 2FXRA 3F68H 2ZGCA 3LT3A 4A1XA 2CV3A 4O97A 1S81A 1C5TA 1MAXA 4UDWH 2GZ7A 3VGCB 1N1LA 3L6PA 5LPFA 3B23B 2ZGHA 1WTHD 3ZVDA 4E7NA 2V35A 1S5SA 1EP6A 1IHSH 2UWLA 1SFQB 4MPWA 1JRSA 1MU8B 4ZHMU 5IYTA 1VVCA 4MTBA 1E88A 3EE0B 2GCTC 3ZYEA 3ZZ3A 1MZDA 7LPRA 1MZAA 1WQVH 1SQOA 1T8OA 2A4OA 3MO6A 1LKAA 1L1GA 3U9AH 3IU3I 3TGJE 4SGBE 3FZDA 3MNBA 1VITF 2ZQ1A 1MKXK 1O5FH 1AMHA 4B1TA 3BEIB 4NIYA 5A0BA 2LOJA 1NWVA 1HAYB 1ELTA 3MFJA 1O2UA 2XC0A 1O2OA 2BXTH 1DY8A 2V0BA 3A7TA 3M3SA 3KQEA 1O5EH 1LPZB 3SNEA 3LGVA 1MTNB 5ESTE 2WPJS 2ILNA 3OTJE 1O2GH 3H5CB 3UTUH 1G4FA 2C90B 2JKHA 3F9HA 2IZ4A 2A4RA 1DX5M 2BD4A 2FTMA 3IG6B 3ZZ6A 4A92A 2BQ7B 1YCPK 5C3NA 5J4SA 1O3BA 5C1YA 4H6TA 1GJ9B 1QCPA 3O8BA 3B9FH 4KTCA 4X6OA 1O36A 5EW1H 2SFAA 2CF8H 3BEFB 5FPTA 2FDAA 3ERBA 1GKNA 4NFEA 2HALA 1AGJA 1WCZA 4DIIH 2GT7A 1OWJA 3GDVA 2ESTE 2G5NA 2KAIA 3A82A 1NFUA 1L4ZA 1BRAA 1UTJA 2SGEE 1FQ3A 3INBC 1MQ5A 1XKAC 1C1NA 5E2PA 2WINI 1O5GH 4J38B 1KLTA 1AWHB 4OS2A 2XBWA 2TGDA 4AGJA 1TRNA 6GCHG 1Y8TA 1EAIA 1S83A 4A5TS 3NWUA 1ZSKA 4Y7BA 4OS4A 4NSVA 2D1JA 3ATIA 4D7FA 3RXSA 2HGTH 2V3OH 4OS7A 2B5ID 1GI3A 1TGTA 1CU1A 1EP5A 2J4IA 2ZPRA 5C5OA 3SGQE 1BRBE 1O2XA 2Z6BD 3HK6B 3RU4E 1YPMH 3CP7A 2H9TH 1P10A 1E34B 1QA7A 1ZR0A 5E0GA 1BA8B 4Y6DA 5EU8A 3P8NA 2XBYA 2GKVE 5GWZA 3IWMA 3RXHA 3P6ZB 3LH3A 4YT6H 3RM0H 1SMFE 3QN7A 3ITIA 3VXEH 1ELVA 1MTWA 2C8YB 4K12A 1GHYH 2G8TA 3K6YA 1K1NA 3GXEA 1HJAC 1LQDB 2R0LA 1IQGA 1EJNA 1Z71A 1U5MA 3TGKE 3P8GA 1CA0B 1LTOA 2FI5E 1THSH 4ZKSU 1TX6A 1FAKH 2QIQA 3GYMA 2J94A 4KP0A 2RG3A 1GI9B 1K1IA 4UD9H 1P8VC 2Y5FA 1EB1H 1BTYA 2A4GA 1ZTJA 1F5KU 1UO6A 2FOBA 2H6MA 4NA7A 2UUJB 4UEHH 4LOTA 1V6DA 2H5DA 1SGDE 1G3DA 4Y76A 4R8TB 3MU0A 3A87A 5GCHF 1HB0B 1EPTB 2WV4A 4BAQB 4OS1A 1IHTH 2QY0B 1C5QA 2ZIQH 1BBRE 3SUFA 3EA7A 3QK1A 1J14A 3PYHA 1H9IE 1P9UA 2Z7FE 2FOHA 1CO7E 3ZVEA 3QWCH 1DSTA 1GBKA 4Z0KA 1O5DH 1RS0A 2VGCB 1BTPA 1SPJA 2ZGXH 1O3GA 4Q7YA 2W7SA 2GVFA 4YOIA 3VB7A 1BITA 2BVSH 1CBWC 1TNHA 1VGCB 3A88A 3SJKA 4JK5A 4BAMB 1AZZA 3SN8A 1PPGE 2J34A 1GMHF 1AY6H 3M5NA 5EQSA 1UCYH 3D65E 1ETTH 1EJAA 4IC5A 2IN2A 1AFQB 2Y80A 4I7YH 1TWXB 1O2YA 2AS9A 1XMNB 2PFEA 5CE1A 4BXWA 2WPKS 1H9LB 1KXFA 1FUJA 3PO1B 1FY5A 3NPSA 2OC1A 1TBQH 1BTHH 2GP9B 2VU8E 1NU9A 1RRKA 3VEQB 2F9VA 2YOLA 4X1RU 5HMAA 2AFQB 3SGBE 1NZQH 2SNVA 2BYAX 3GCTG 4UFFH 3T2NA 1CA8B 1UVPA 2BDCA 2PSXA 3MI4A 2C93B 1HNEE 2F83A 3OY5U 2BLOA 3UUZA 5BRRE 1HAOH 2FOMB 2P3TB 3MH5A 1TPOA 1UVSH 2ZFQH 2QXHA 1DSUA 1TB6H 3GDSA 1O5BB 2JH0D 1OX1A 4Y11E 3W94A 2BVRH 4B74A 3RXUA 1QURH 1C4U2 5A2MH 1TONA 3BTFE 2ZECA 1C5OH 2Z3CA 4RKJB 1T8MA 3HATH 2A32A 2FEQH 2QAAA 2BY9X 1OPHB 2HNTC 1C2GA 3BTWE 3T27A 3ZZDA 1CVWH 3RXTA 2G55A 3UWJH 3U1IB 2V6NA 1SGRE 1NFYA 1V2ST 1RFNA 3FANA 1GJ6A 1GBLA 1F5RA 1T8LA 3Q77A 3RM2H 3M7UA 2GMTB 3URDA 1SGEE 4AB8A 3U69H 3UPEA 4D76A 2A5AA 5FCKA 2ZHFH 4X1NU 1S82A 2G5VA 1DLEA 1S0QA 1C1RA 4XSKU 3R62A 3CS0A 4IS5A 8ESTE 4LOSA 1C5PA 1ZPBA 1V2JT 2QXIA 1TLDA 3E16B 2ODQA 1GVKB 1LVYA 3HGNA 4FUIA 1O35A 1ELEE 1L1NA 5FX6A 1UTQA 4VGCC 1SOZA 1WBGB 2WUCA 1O3HA 1LVOA 2PW8H 4X1SU 1KSNA 2D8WA 2YNAA 1ZZZA 4HI3A 4Y79A 3OXUD 1YP9A 3LIWA 3P8FA 1YYY1 3MU1A 4INLA 3T26A 4K1EA 2W81A 2WPHS 1CGHA 1NM6A 1GVZA 2MCZA 1WAYB 1H9HE 1TE0A 4XOJA 5E2OA 1O34A 3SQHE 4B71A 3O8CA 1GJBB 3M5LA 1FY4A 3ELAH 3EQ0H 2H1UA 2J95A 4BTUB 3RDZA 5T6GA 3A7WA 1O2MA 1FAXA 4X6PA 1MD7A 2XRDA 1EAUA 4DURA 3SZNA 1CQQA 1F2SE 1W0ZU 4UONA 4HGCA 4DIHH 1A5IA 4ABIA 5F6MA 2JRAA 1IQJA 1FONA 2H9HA 2Z9KA 1GBFA 3ZV8A 3RJ3D 1HLTH 3A7YA 3RMNH 3T28A 1AO5A 1C2DA 1LVBA 1O3OA 1WUNH 2GCTB 2M5TA 2RLQA 1MBMA 1BJUA 3T25A 3UWIA 4I8GA 2C3SA 2ZF0H 1EAWA 1SGPE 4MVNA 3LH1A 2C8XB 4Y10E 1QR3E 4ZHAA 2TBSA 1A5GH 2O8MA 1OK9A 1XKBC 1QUBA 3LOXA 2ZFTA 4MPUA 3DFLA 2HNTE 2CXVA 1C5MD 1GI6A 5HZPB 1YM0A 5CHAC 5HGGA 5EPNA 1TGNA 3RXLA 1SS2A 1ESAA 3LGYA 3RLWH 3N7OA 2PR3A 3RXIA 2G81E 4FUHA 2PUQH 5G4BA 1EPTA 2RDLA 5EW2H 1BMNH 2CN0H 4AYEA 2QY0A 1F0UA 1ZRBA 1IQHA 1YPKH 2VWLA 4D9QA 1G30B 2RA0A 2A7HA 3RXMA 3UQVA 3K65B 1HXFH 1LHDH 5HXFA 3E91A 4E7RG 3E6PH 1E37B 3OY6U 2BDHA 1F0SA
chains in the Genus database with same CATH superfamily
4FXGH 2AIPA 1GI0A 2DE9A 2UUKB 1Y3VA 1P3EA 3ZZ8A 1ETRH 3GY5A 3Q00A 1PQ8A 8KME2 1O30A 4DCDA 1BMFD 2ANKH 1YPJH 2QF5A 2RDEA 4ABAA 4I8LA 3BF6H 2OD3B 1OSSA 1GHWH 3ZVAA 4I31A 1C1VH 1KXAA 2FOCA 1W8BH 1ELCA 3S9AA 2CJIA 1MABB 3STIA 2AGGX 3U8RH 1DM4B 1H8IH 2ZGBH 2GZ9A 4XFQA 1ZGVA 4D8NA 2TPIZ 1UVTH 1P2NA 4IN1A 3GYLB 1HUTH 3SV6A 3GY8A 4B2BA 2HNTF 2KCOA 1KLIH 1HAGE 1O39A 6LPRA 2CG7A 1HJ8A 3RMLH 3K3TA 3STJA 4MSLA 2Z94A 4BXSA 2FM2A 1O2VA 2BZAA 3D23A 3GY4A 5FX5A 2XCNA 3MYWA 3QO6A 2STAE 2Y6TA 2RFKC 1MKWH 1ID5H 1S85A 4Q80A 3RXAA 5C20A 3ATMA 1D9IA 1XVMA 3FP7E 4JK6A 1W13U 1OYQA 2PP6A 3MU4A 1JWTA 3RXFA 3OU0A 2CHAC 2NWNA 1TMTH 3F1SB 2BM2A 2BD3A 2GGVB 4H4FA 2C4FH 1ZRKA 3GDUA 4WMFA 5LGOA 2OP9A 1Q2WA 2AHME 2M2AA 3R0FA 3SJIA 2TGAA 1HJAB 2CMYA 2FX4A 3SW0X 3FVFB 5FL7D 3W95A 1P57B 2P3FH 1SLXB 2QF0A 5K7RA 2F9PA 1O33A 2P16A 2G00A 2FLBH 7GCHG 4GHTA 3A81A 2ZNKH 3PV4A 4UFGH 1UK4A 5C0TA 4X6NA 4KTSA 3PTNA 3RXGA 4YLUA 2VVUA 1C2IA 3M37A 2VVCA 1TMUH 4MPVA 1W2KH 1D4PB 3LGUA 2ZP0H 3OEHD 3SU5A 5L2YH 3PV5A 3BTME 1O9AA 1S84A 2ZDMA 4FU9A 2OC7A 4TPIZ 1WYKA 1NFWA 2EY4C 2H9EH 1LHCH 1FI8A 1RIWC 3A8DA 4XD7D 1AB9C 1ZGIA 3NCLA 1X7AC 4CR5A 3KXVA 1G3EA 3UY9A 1SGYE 1C5NH 3NUMA 1QL9A 1T7CA 3TITA 3Q3XA 3FGRA 3MTYA 2ALVA 2WV9A 2YMSD 1EXFA 3GY6A 2ZU5A 1TPPA 4Y0YE 3WSXA 1UCYK 1VJ9U 1J17T 4RT0A 2EC3A 1UJ1A 1HYLA 5A8YA 1W14U 4IN2A 4DT4A 4YNXA 1OJVA 3E0NB 5F03A 2BLQA 4TWWA 3UR9A 4BAOB 1O3MA 1EJMA 1V2KT 3SV7A 4GLYA 1GJAB 2ZI2H 3M7QA 4JZFH 2JETC 2ZPQA 1FPHH 1GCTC 1FIWA 1P2IA 1D6WA 1VVDA 1HXEH 1Z92B 2SGDE 4X6MA 5EG4A 1ACBE 3SJOA 4ISNA 3TJNA 4CREA 1KIGH 1TGCA 4A1VA 3F2HA 3KQDA 3VPKA 1PYTC 1A4WH 4JMYA 3BV9B 4Z1MD 1W0KD 5HKKD 1JBUH 3KL6A 1FBRA 3U98H 3BEUA 2Z9IA 2LNCA 2VVVA 4CBOA 1WDIA 1RD3B 1LHGH 1VCWA 3RXPA 5C94A 2QF3A 5TCAA 3SJ8A 3WWBA 2QYIA 2XRBA 1LKBA 1WV7H 3A86A 1W7XH 1QJ1B 1TGBA 3VB3A 2DE8A 2QXJA 2C8ZB 3P92A 1AI8H 2BY5X 1OP8A 2ZU2A 5DP4A 3OP8A 2R0KA 2GDDA 2ODPA 2HPQH 2ZC9H 1OXGA 4HFPB 1LPGB 3TJUA 1TNLA 2BDBA 4KGAA 2W6JD 2Y8TA 1NU7B 5I25A 2W5EA 3URCA 3GCNA 1NRSH 4TSFD 5DJ7A 3QTOH 1ZPCA 2C8WB 3ZV9A 4FUJA 1E0FD 4LXBH 5C17A 2ERJA 3BSQA 3BTTE 3LGWA 1UVOA 1YPLH 4DJZB 4TPYA 2QCYA 1MBQA 1BTZA 2ZDAH 1Z7KA 2ZFFH 2ZPSA 4DOQA 2B5TB 4VGCB 3GCTF 1QGBA 3AW1A 3UOUA 1RTLA 4UFDH 1A7SA 1O31A 1GMDG 3M3TA 4MLFB 4BOHA 1C2MA 1ETSH 2FS9A 2NU2E 1TX7A 3ZVFA 1A3EH 4NSYA 3IITA 3SU2A 1O3KA 1Y5BT 3UR6A 1TPNA 2ZTZA 3ZZ5A 2FYQA 1WTGH 4H42U 1AD8H 5CHBA 4AYYB 2AMDA 1SGFG 5HM9A 2VNTA 1QNJA 2OQ5A 3A8BA 3RC4A 3UIRA 1G4GA 4F4OC 2FESH 1YCPM 1GI7B 4H6SB 1F7ZA 1C1SA 1AVXA 6CHAB 1ZHMA 2VIQA 2HRVA 1XUIA 1OJWA 1TA2A 1A0JA 1ZOMA 4ISOA 2ZU3A 3UNSA 1G32B 1TQ0B 1Z8IB 1QQUA 1QTFA 1TAWA 3DCLA 1GL0E 3PRBA 1MQ6A 1MTUA 3EJHA 3EA8A 4JZEH 2OTVA 5F8TA 5T6DA 1E38B 4Q4LA 4ZCNA 3ZZ7A 1C4Y2 1L4DA 2FOEA 2QGRA 1ZMJA 4CHAC 1SVPA 1N8OC 3F9FA 2QXGA 3LONA 4GPGA 1HBTH 1Y5UT 1H04P 1GBDA 1ARCA 1EZQA 1SC8U 5CHAB 3F9EA 2I6SA 3PM3A 1AHTH 3GISB 4B75A 2HPPH 1NRPH 2K8IA 1NPMA 1O3PB 2RKZA 1O2TA 4X8TH 5HM2A 3BTQE 2FMJA 1E79D 2WPMS 2ZHDA 2B7DH 4NA9H 4O3UA 1GDUA 1F0RA 1K28D 2UWNA 3M5MA 2XCFA 1H4WA 1QL7A 3M36A 4X8UH 4YZUA 1D3PB 1O3EA 1TBRH 2FP7B 5DN4A 2KR7A 4PROA 1GJCB 4X1QU 2VWOA 1UCYE 3L33A 5EXLA 1F0TA 2ZDLA 2B0FA 5FAHA 3ZRZA 3GOVB 3S0NA 1EX3A 1O3JA 2XNDD 1DY9A 4A7IB 2OXSA 1C2HA 1V2LT 4M7GA 4AYIA 1DITH 1V2UT 5JPMH 1GPZA 2BY6X 1C1PA 4X0WU 1PQ7A 1GGDC 2VBCA 4X2WA 3RLYH 1YGCH 4WJG2 4OS5A 1BZXE 1GBHA 4Y0ZE 5DP7A 3FGTA 2PUXB 3QLPH 2BQWB 4U2WA 1DXPA 2NU0E 1QRXA 1TQ7B 2PSYA 3QX5H 4WWYA 3EGKH 2G52A 2RL0A 1Z8JB 3VB4A 1KTTB 2ZKSA 4YXWD 2EI6A 3SNAA 3MNCA 4XBDA 1NRQH 3ZIAD 3QZQA 1O2SA 4JZDH 5LH8A 1UTLM 1C2FA 1MKWK 2ZCHP 3OSYA 1ABIH 2JJ2D 4Q7XA 2IJOB 1ZHPA 1MAYA 4LK4A 4I8JA 4O03A 1C5SA 2BLWA 2QA9E 2TIOA 3EA9A 3KQ5A 2PGBB 4K2YA 4BAHB 4DT7B 3ZLEA 3AVZA 3O8DA 2AERH 2ZDNA 5DP5A 2J2UA 3CS7A 1B5GH 1W11U 4K1TA 2XQWC 3KIDU 4IW4E 3SORA 3I77A 2UWPA 2W7UA 4B2CA 1EUFA 2ZG0H 1FN8A 2PTNA 3K9XB 2HVXA 3PTBA 1T4VH 4RSPA 2CHAB 1O38A 2XBVA 4TWYA 3RU4D 4MNXA 1NESE 5HIZA 6ESTA 4B6FA 4JZ1A 2BVXH 3GY7A 2EHFA 3JZ1B 2MCYA 1YBWA 2G4TA 1GBJA 3ATWA 4YOGA 3SU4A 2WIIC 1V2OT 2XNIA 4J1YA 4DJZA 3SI4H 2NU3E 1V2RT 2FX6A 2BY8X 3VGCC 2FS8A 2A2XH 3DT0H 3TH3H 2AH4X 3ZZ4A 3F6UH 1H2QP 4DG4A 2CG6A 3OEDC 1FPCH 2NU1E 2O8LA 3IX0A 1DANH 3F2GA 1VCQA 5EPYA 5CMXH 1GL1A 1YKTA 1TOMH 3ODDA 1HFDA 1ELAA 1PQAA 5C5NA 2BDIA 2EI8A 1DDJA 1P03A 3BTDE 1V2WT 4ZAEA 3RP2A 5EGMA 2IPQX 1BTXA 2GDEH 3H7TA 1O2QA 3KEEA 1OWDA 1AB9B 4N7EA 3KN2A 4BAKB 1GHQB 4K8YA 3PMAB 2VB0A 3VG8A 1MKXH 2VJ1A 4ABBA 2H2ZA 3KYFA 1EQ9A 5TJXA 1T32A 4XBBA 1FJSA 1O3LA 2ALPA 1YLDA 1LHFH 1RGQA 1TA6A 1ESTA 3ZZBA 4LZ1H 4JYTA 1GJ5H 2UWOA 4ONTD 3PB1E 4INHA 4NGAH 2RLPA 4I33A 2KRIA 1KMHB 2PLXA 1MTNC 1T4UH 2SNWA 4KKDA 2XXLA 1K1MA 1ANDA 1CT2E 2FTLE 2YBYA 4Q63A 1CT0E 1OJYA 2Z3DA 3MMGA 2JETB 5PTPA 1MCTA 4CR9A 1G2MA 1Z6JH 7GCHF 1BRUP 1K1PA 1P3CA 4GHQA 4AGKA 1RLHA 4B76A 4E06H 1C2EA 2XC4A 1G37A 4YESB 5EJLA 3SBKA 1DVAH 1ELBA 4I32A 3UOPA 4CH8B 1K1OA 1DWCH 5GIBA 4NWLA 1UW7A 5EODA 1UTPA 3SV2H 3T29A 1RTFB 2WPIS 1TFXA 1E36B 4NG9H 1D3DB 1UK3A 1ELFA 5DPAA 3PROA 3TK9A 5ESBA 2W3KA 1IQIA 2EEKA 2CKUA 3QGNB 4DY7B 2FOAA 3GCOA 8LPRA 3Q76A 2FIRH 3DFJA 1O2LA 2YRAA 3LC5A 1BIOA 1NTPA 1GDNA 1GHBF 4B6EA 1FV9A 1Y3UA 3FP8E 3QZRA 3ESTA 3WWFA 1IQKA 4NZLA 4TY6A 5DKMA 3TU7H 2P59A 2WUBA 3U8OH 2Y81A 4MPXA 3LC3A 3A7XA 1LQEA 3N99A 4Y71A 9ESTA 3LGTA 1FDPA 2ZO3H 2ZDKA 1UHBB 3GOVA 3BIUH 3RC5A 4FVBA 1VR1H 3LJJA 2F9NA 1AN1E 2WPLS 4F49A 2WPDD 5T3HA 2BZMA 1C5RA 1OK2A 1BMMH 5BPEA 4HG6A 3RU4T 3MOCA 3MNXA 1BTWA 1RXPA 1THRH 2EC9H 3A89A 1IAUA 4IMQA 1W3CA 1QJ6B 2O8TA 1KYNA 5GNDA 1C1WH 1HFIA 1HIAB 3K2UA 3F0OA 4RN6A 3SU0A 5HYTB 3F0PA 1FLEE 1O2ZA 1Z6EA 2BQ6B 4ISHH 3K6ZA 2RCEA 2STBE 1C5VA 1BMLA 4Y8XA 1CHGA 1DWDH 4Q2KA 4NWKA 9LPRA 4X8VH 5DSFA 1YLCA 1HAHH 1ZJDA 1GVLA 4RI0A 3PMBB 3DD2H 4K3JA 1CA0C 1Y59T 4P02A 4K60A 1OWEA 3ATLA 4WH8A 2ZFPH 4I8KA 1QQ4A 2GD4B 3V3MA 1HCGA 2SGQE 3SNDA 2GTBA 3TNTA 2V3MA 2V3HH 5DP8A 3TJOA 1QJ7B 1OKXA 2O8UA 2P94A 2FI3E 4NFFA 4BTTB 1H1BA 1GHAF 3UREA 5C67A 2Q1JA 3O8EB 1BHXF 4A6LA 4F55A 1GWAA 3BN9A 4ABEA 1A2CH 7KMEH 4WMDA 1EPTC 2F9OA 3V12A 4A1TA 3M5OA 1MUEB 1Y5AT 1FY8E 1O2RA 2A4QA 1DICA 3B8JA 5DP3A 2JGXA 1C5WB 1XXFA 1Z1IA 1C5UA 2VINA 3ATKA 1SFIA 2J38A 1JOUB 2OCVB 3E0PB 1EOJA 3PMJA 1VGCC 2WZQA 4CHAB 2PTCE 3RXJA 2VIVA 4WY3A 1LHEH 1N8OB 1RJXB 1GI2A 1ANEA 3SNBA 5AF9H 1G36A 4ZXYH 1IQMA 3NKKA 3U8TH 3M35A 5AVDA 1C1UH 4XBCA 1J9CH 3TJVA 3RC6A 4JHSA 1W7GH 1GMDF 1YC0A 1AFQC 3MO3A 1QIXB 3AK5A 3TLOA 4ABHA 3N7DA 3NRLA 3CALA 5FBIA 1KDQA 2XWBI 1OS8A 3PO1C 2IPHA 4U32A 2O39C 3SJ9A 2FI4E 2GX4A 3KHVA 3AASA 4U30A 1P02A 1QBNA 2PKAB 1ESBA 4HZHA 1SGCA 3RXEA 1SOTA 3UB0A 1AVWA 4ZUHA 1EZSC 1HRTH 1O3DA 1P0SH 2Z9JA 3CNRA 4WF8A 2FLRH 2ZHQH 1PPCE 3FAOA 3M7TA 1SLVB 4J2YB 2F9BH 1L1JA 3D49H 1C4V2 5FBEA 4IBLH 1SKYE 4Q7ZA 1UTNA 1O37A 4CBNA 1GJ4H 4OGYA 3OAAD 3NXPA 1EKBB 5C1UA 1GBMA 3LU9B 1D6RA 2EQNA 2F91A 3EDXB 3S9CA 1Y3WA 1DWEH 2CF9H 1GMCG 3EAJA 3R3GB 1O2PA 1GBTA 1GGDB 1PPZA 4YTAA 1BOQA 1SQAA 3SZEA 3M61U 1GHBG 3I29A 1SGNE 2UUYA 3RMMH 4YLQH 4ZHLU 5EXNA 5TCCA 3MHWU 4JYUH 1SG8B 4MNVA 1TALA 4ACBA 1PPEE 1C2LA 3TK6A 4FUCA 1CBWB 3GCHC 1OOKB 1F92A 2WYJA 3OYPA 1H2PP 3A80A 4BANB 5FO8C 1C5ZB 3BIVH 1SGTA 4UFEH 2LP6A 1WSSH 3V13A 5E8EH 3MQKC 1OWIA 1YPGH 8GCHG 1O2HA 1F5LA 1GHXH 3T62A 1TNGA 2ZHWH 2UUFB 1K2I1 1HAVB 2V8EA 1OP2A 1YWUA 4ACAA 1TBZH 1BJVA 1AKSB 1OK1A 1P09A 1TPSA 3HGPA 3F6KA 1LY2A 4A5WB 1UHBA 4AG2A 1G2LA 3MWIU 5JBAS 2P93A 3PLBA 1P12E 4CSYA 1V3XA 1ZMNA 1UMAH 1JIRA 3RXKA 1C1QA 3SHCH 1VITH 2ZEBA 1BCUH 1BHXB 1J16A 4GSOA 1P11E 1DFPA 4AX9H 1LCYA 1HIAA 1BB0B 3I78A 5EIYA 1GHAG 3PLPA 2SGAA 1V2TT 4CRBA 1IQLA 4FXGG 1NN6A 1KY9A 3PWBA 3LDXH 5A09A 2WV5A 2P8OC 1K21H 1QB6A 3KQBA 2BMGB 4GUXA 4ISLA 5JBBS 4FUGA 3ZZ9A 1HAXB 2JH5D 2A2QH 5DG6A 2AGEX 3MH4A 5EQQA 4ESTE 1QA0A 1B0FA 1AIXH 3KF2A 2DUCA 1QO6A 2BB4A 1DS2E 3SUDA 3TPIZ 3A85A 3S9BA 3PWCA 4TY7A 3SU3A 1PPQA 4AYDA 1O32A 2HLCA 2R3YA 2B9LA 2GV7A 1P2KA 1QRWA 1O2WA 2P3UB 3F9GA 4ZKOU 4AC9A 1HFHA 1GBCA 1Y3XA 1Q3XA 1GHVH 4UE7H 3SW2B 3SOSA 3ZZAA 4X2VA 1GG6C 2R2WU 5GJ4B 4NZQA 5B6OA 2FWWA 3UFAA 1GI1A 2ANMH 1AUTC 3JZ2B 4ZH1D 2FZZA 3UAIC 5FPYA 3ZVCA 3A84A 1K0HA 2Z9LA 1TABE 1NRNH 4X2XA 5DN6D 1A46H 2JDID 2OUAA 1SGQE 3E1XB 3HK3B 1KTSB 2BDGA 5GPIB 1Q31A 3DUXH 1O5AB 4K5ZA 3RXQA 4KTUA 1VJAU 5FPSA 4LZ4B 3V0XA 1FMGA 3BTHE 4IGDA 1W12U 1WU1A 1D3QB 5JB8S 2THFB 4K1SA 1EZXC 1CT4E 3BG4C 1GJ8B 2AGIX 2ZZUH 3T5OA 1EZUC 2Q6GA 1JRTA 1GBAA 4LOYH 3P8OA 4YM9A 2B8OH 1V2QT 3HKJB 1XVOA 2GCHF 1DUAA 5A8XA 5J4QA 1QZ8A 3VFEA 3M7PA 5C1XA 1NT1A 2PKAA 3ZD2A 1PPBH 1SL3A 2TRMA 2O9QA 4B2AA 4M9FA 1C1TA 1Y3YA 1ARBA 4FVDA 1G3BA 2A0QB 5E0HA 5EJ1A 2CGAA 1TMBH 1AU8A 4CRAA 1OWKA 4ABFA 1GCDA 4ISIH 1TNJA 5HYUB 2BX4A 1E35B 1WOFA 5IDKA 3ZZCA 3SYJA 2ULLA 1QGFA 1O3NA 4U01A 1YPHC 2J98B 1DE7H 1LPKB 1UVUH 2VIPA 3MH7A 1RTKA 5GDSH 1Z8GA 2F43B 2ZA5A 2ASUB 3E8LA 1HAPH 1ABJH 2VIWA 1P06A 5CDFE 3OEED 2BLVA 1P05A 4ZXXH 1KXEA 3KQCA 4XE4A 3FOAA 4FU8A 1PPHE 3MQLA 1PQ5A 1C9TA 2PWXA 1FY3A 3L3TA 4AFUA 1P2OA 3OX7U 2OLGA 3CENA 1GI8B 2GZ8A 1N6XA 2XBXA 4MG3A 2Y5GA 5ABWA 4C16A 1J15A 2XWJI 1O2NA 3NK8A 2A7CA 1GI4A 1FN6A 2GT8A 2KZ4A 5AFYH 1OWHA 5FCRA 2Y8SA 1NROH 1CHOG 2PKSC 2VH0A 2A45B 2AMPA 1ZYOA 1ZPZA 2Y5HA 2BD7A 1HCCA 2IOTA 2W3IA 2Z9GA 4GCHF 1C5YB 4ASHA 2K1QA 5LPRA 2BZ6H 4ZROA 3S7HB 1QRZA 1ZSJA 3HKIB 1BDAA 3OE7D 2Y7XA 1DT2A 2A31A 4IMZA 1MD8A 1QB9A 1O3CA 2I6QA 1AE5A 2O8WA 2KCPA 3SU6A 1DOJA 2PV9B 1FIZA 5JDUB 2FOFA 1IQNA 1HV7A 1O2IA 1TPMA 4D7GA 1MMJN 1HAVA 3P95A 1WQSA 4AYMA 3C27B 2BD9A 1AKSA 4P00A 1GJDB 3LJOA 3N7EA 1MU6B 1ZJKA 1O2KA 3UNRA 1G3CA 1H03P 1ZSLA 2V7QD 4CRFA 3ENSB 3LGIA 1P9SA 1GJ7B 1S0RA 2AYWA 1QL8A 2VIDA 4AFSA 4AN7A 4AYVB 4AZ2B 3QTVH 1UTOA 1O3AA 1ZTKA 2TGPZ 1DXWA 3KZJA 3PV2A 3EE7A 1PYTD 1MH0A 3A83A 1ELDE 1VITG 3ZVGA 3SQEE 4F48B 1AZ8A 1NBME 5EXMA 4ZH8A 3PRDA 1YPEH 1W0YH 3D62A 1U6QA 2IZ3A 5KEDA 2ZCKP 4BNRA 2FOGA 3U1JB 1EASA 1GBIA 1NFXA 1TYNA 1XUGA 3LPRA 1LDTT 5SGAE 1AVGH 1YPHE 5I0QB 3LKWA 4CRCA 3M3VA 7ESTE 1FNIA 2D2DA 1A61H 1NY22 1O5CB 1SB1H 3SNCA 1BBRH 3GICB 1INCA 1J8AA 3VXFH 3MNSA 4NIXA 2VIOA 1XUJA 2H5CA 1LMWB 3TNSA 4OGXA 5L6NH 2PHBA 3P70B 1SSXA 2A5KA 2L74A 1GBBA 2GV6A 2SGFE 2BOHB 4CRDA 2A1DB 4MQAA 1K1LA 4XDEA 2ZFRH 4GVUA 2J9NA 4FUDA 2ANWA 5JYIA 3SU1A 4AOQA 1S6FA 1ZMLA 1QBOA 1SHYA 1C1ZA 5K0HA 3AAUA 1GBEA 4OS6A 4HTCH 1KDQB 1SGFA 1T8NA 2GCHG 2RA3A 2RKYA 1PJPA 1DPOA 1RIWB 4MNYA 1GDQA 3SUGA 1TPGA 3T5FH 5LPEA 5HIYA 1P2JA 2ZYCA 1ZLRA 1H8DH 1EATA 2BD5A 2OC8A 4KELA 4D9RA 4BWCA 1EAXA 4X2YA 1AWFH 1YF4A 2XC5A 1UTKA 4NA8A 5A0CA 4O3TA 4Z6AH 3V7TA 1SRZA 1IQEA 1ZTLA 4JCNA 2Y7ZA 1UTMA 1A0HB 4IC6A 1A3BH 4I8HA 2JH6D 1FX0B 1KXBA 3GCHB 3OFND 5JBCS 1UOTP 2R9PA 1PFXC 2WHXA 2EI7A 2ZTXA 4B73A 2BD8A 4X8SH 2ZWLH 5AFZH 3RUOA 2OQUA 2W80A 3E90B 4AB9A 1DLKB 1K1JA 1QBVH 2VH6A 3ZD1A 1OK3A 1GCTB 1SQTA 2QF4A 3Q3YA 3QUMP 5C2ZA 3FZZA 4O9VA 5FHTA 2FO9A 3TH2H 1JXPA 2ZFSA 3MH6A 1Z1JA 4FUFA 2J98A 1DWBH 1BMAA 1FY1A 4YOJA 2VWMA 1YCPH 2Q6FA 1COWD 2FODA 2YMSC 5L2ZH 3H7OA 3TVJB 4GCHG 1GKGA 1JMOH 1GHZA 3P17H 2HOBA 5DGJA 1GMCF 4ABJA 2TGTA 1BRCE 2ZU1A 4ZMAH 1KXDA 1E5GA 1LVMA 3DHKH 4QT8C 4BTIB 6CHAC 2GJGA 1GI5A 3UQOA 1HGTH 1A1RA 2BTCE 2ZU4A 5KGOA 1XUFA 3ZLDA 4NIVA 1QY6A 5GCHG 1V2MT 2AMQA 1T31A 1HAIH 3FN8A 4WVPE 4APLA 3SGAE 5DP9A 3MO9A 1SBWA 3WY8A 2P8OB 2ODYB 1TRMA 1K22H 4B2RA 4FUBA 3BG8A 5F8ZA 3FFGA 4ASUD 2KM0A 1XUHA 1SLUB 5H4IB 1C1OA 1AQ7A 5JPMG 8GCHF 2NU4E 2OC0A 2XW9A 3QDZB 3RXCA 4X1PU 2HLDD 4OM9A 2BDAA 4JZIA 5FXLA 1C1MA 4AFQA 2BOKA 1G9IE 2BX3A 1CE5A 3F3BA 4R0IA 3Q3KA 3PLKA 1QHRB 4NIWA 3SI3H 1GMHG 1NO9H 2OINA 3NJAA 1NC6A 3MU8A 1C9PA 4DGJA 3GY2A 3KCGH 2YNBA 3NFPI 4AG1A 1O2JA 1QB1A 1TNKA 2FYRA 1GG6B 4WXIA 3SV8A 3SO3A 4Y8ZA 5GXPA 2BD2A 4AORA 1O3FA 1JIMA 5HYPA 5IK2D 3VB6A 4SGAE 1E8BA 1MTSA 2ZGJA 2ZQ2A 1LO6A 3FP6E 1AUJA 1KLJH 3G01A 3PMHB 2JIZD 2A55A 3SHAH 1SR5C 1W10U 3KYGA 3BG4B 2G4UA 2R2MB 2JGWA 3TK5A 1UK2A 3TH4H 1DUEA 2W26A 4K69A 4TT3D 5DK1A 4I86A 1IQFA 3BTEE 2BY7X 1CSOE 1EB2A 4WMEA 1OP0A 1P04A 5DP6A 1VCPA 4FOUC 1P01A 4Y7AA 3ZYDA 1N6YA 2VGCC 1VZQH 2QC2A 3C1KA 4YT7H 3ODFA 5AHGH 2OBOA 4FUEA 1C5LH 1HPGA 4WH6A 3RXBA 1FZZA 1S6HA 2ANYA 5I46H 2A5IA 3RXRA 1SGIB 1OYTH 2G51A 4THNH 2Y8RA 2G7IA 2XRCA 1AFEH 1ORFA 4YO9A 2XTTB 5A8ZA 5T6FA 3BTKE 1BQYA 2Y82A 3RMOH 1O3IA 3GY3A 5HYOA 1HJ9A 1V2NT 2WYGA 3KNXA 2P95A 1QFKH 3KGPA 1CGJE 1AE8H 2W6ID 1L2EA 3RXOA 5E0JA 2KAIB 1NS3A 4FU7A 4GAWA 2QN5T 1TX8A 1THPB 4WXVA 2XWBF 3DSOA 1ANBA 2XWAA 2FPZA 1A0LA 4ZKNU 1V2VT 1EOLA 1ZHRA 2XYAA 2VWNA 3AW0A 5F8XA 3E3TA 5B6LA 4NCYA 1CGIE 2OBQA 1B0EA 1TRYA 2HWLB 1IOEA 2PKSB 4MDSA 1C5XB 3TIUA 1V2PT 3NZIA 4K8BA 2J92A 1TIOA 1A5HA 1XXDA 4DW2U 2R3UA 4CH2B 3SV9A 2Q6DA 2ZCLP 4PZ5A 3A7ZA 1K9OE 4ABGA 5EQRA 2F3CE 1NRRH 1M9UA 1PPFE 5A0AE 3TGIE 2F9UA 1MCVA 1BTUA 5L30H 2LPRA 4XRNA 1C2KA 1TOCB 1B7XB 2Z3EA 3EYDA 3S69A 1TPAE 5DO4H 1BT7A 3RXDA 3W1EA 2A7JA 3RXVA 1D3TB 2BHGA 1XX9A 2L6OA 3UNQA 4B2SA 3S7KB 2AIQA 6GCHF 1P2MA 2ZTYA 4RKOB 2GMTC 2QV1A 2BDYA 1FXYA 3DA9B 3A7VA 4MNWA 1ELGA 2X2ZA 4JYVH 3VB5A 1P2QA 3TVJA 2KMSA 3SUEA 5JBTA 3HPTB 5JB9S 4INKA 3AAVA 2AEIH 4TYDA 5ETXA 1HAZB 3A8AA 1L0ZA 1HDTH 4YIZA 4Y8YA 3QGJA 1CKLA 3O8RA 4CRGA 4MUCA 1BUIA 3A8CA 5EOKA 2IJD1 3BTGE 1ANCA 3ZVBA 1C2JA 3L89M 2ZDVH 4AFZA 1MTVA 1SI5H 3FKSD 1Z8RA 4DVAU 4ABDA 2D26C 1SLWB 1TGSZ 1S6LA 2BXUH 2ZHEH 1O0DH 1CHOF 2PGQB 4PO7A 2SGPE 2EA3A 3OTPA 1SHHB 4E05H 4ZKRU 1BBRK 1KXCA 3MU5A 1XUKA 1TNIA 1XM1A 2FXRA 3F68H 2ZGCA 3LT3A 4A1XA 2LELA 2CV3A 4O97A 1S81A 1C5TA 1MAXA 4UDWH 2GZ7A 3VGCB 1N1LA 3L6PA 5LPFA 3B23B 2ZGHA 1WTHD 3ZVDA 4E7NA 2V35A 2WSSD 1S5SA 1EP6A 1IHSH 1EFRD 2UWLA 1SFQB 4MPWA 1JRSA 1MU8B 3DSGA 5IYTA 1VVCA 4ZHMU 4MTBA 1E88A 2CK3D 3EE0B 2GCTC 3ZYEA 3ZZ3A 1MZDA 7LPRA 1MZAA 1WQVH 2J5UA 1SQOA 1T8OA 2A4OA 3MO6A 5KECA 1LKAA 1L1GA 3U9AH 3IU3I 3TGJE 4SGBE 3FZDA 3MNBA 1VITF 2ZQ1A 1MKXK 1O5FH 1AMHA 4B1TA 3BEIB 4NIYA 5A0BA 2LOJA 1NWVA 1HAYB 1ELTA 3MFJA 2KX4A 1E1RD 2JJ1D 1O2UA 2XC0A 1O2OA 2BXTH 1DY8A 2V0BA 3A7TA 5DN5A 3M3SA 3KQEA 1O5EH 1LPZB 3SNEA 5C0UA 3LGVA 1MTNB 5ESTE 3GS9A 1W0JD 2ILNA 2WPJS 3OTJE 1O2GH 3H5CB 3UTUH 1G4FA 2C90B 2JKHA 3F9HA 2IZ4A 2A4RA 1DX5M 2BD4A 2FTMA 3IG6B 3ZZ6A 4A92A 2BQ7B 1YCPK 5C3NA 5J4SA 1O3BA 5C1YA 4H6TA 1GJ9B 1QCPA 3O8BA 3B9FH 4KTCA 4X6OA 1O36A 5EW1H 2SFAA 2J97A 2CF8H 3BEFB 5FPTA 2FDAA 3ERBA 1VKYA 1GKNA 4NFEA 2YMSB 2HALA 1AGJA 1WCZA 4DIIH 2GT7A 3U28C 1OWJA 3GDVA 2ESTE 2G5NA 2KAIA 3A82A 1NFUA 1L4ZA 1YLNA 1BRAA 1UTJA 2XOKD 2SGEE 3WSYA 1FQ3A 3INBC 1MQ5A 1XKAC 1C1NA 2I2LA 5E2PA 2WINI 1O5GH 4J38B 1KLTA 1AWHB 4OS2A 2XBWA 2TGDA 4AGJA 1TRNA 6GCHG 1Y8TA 1EAIA 1S83A 4A5TS 3NWUA 1ZSKA 4Y7BA 4OS4A 4NSVA 2D1JA 3ATIA 4D7FA 3RXSA 2HGTH 2V3OH 4OS7A 2B5ID 3WW7A 1GI3A 1TGTA 1CU1A 1EP5A 2J4IA 2ZPRA 5C5OA 3SGQE 1BRBE 1O2XA 2Z6BD 3HK6B 3RU4E 1YPMH 3CP7A 2H9TH 1P10A 1E34B 1QA7A 1ZR0A 5E0GA 5F53A 1BA8B 2KCAA 4Y6DA 5EU8A 3P8NA 2XBYA 2GKVE 5GWZA 4RT1A 3IWMA 3RXHA 3P6ZB 3LH3A 4YT6H 3RM0H 1SMFE 3QN7A 3ITIA 3VXEH 1ELVA 2KCYA 1MTWA 2C8YB 2QE7D 4K12A 1GHYH 2G8TA 3K6YA 1K1NA 3GXEA 1HJAC 1LQDB 2R0LA 1IQGA 1EJNA 1Z71A 1U5MA 3TGKE 3P8GA 1CA0B 1LTOA 2FI5E 1THSH 4ZKSU 1TX6A 1FAKH 2QIQA 3GYMA 2J94A 4KP0A 2RG3A 1GI9B 1K1IA 4UD9H 1P8VC 2Y5FA 1EB1H 1BTYA 2A4GA 1ZTJA 1F5KU 1UO6A 2FOBA 2H6MA 4NA7A 2UUJB 4UEHH 4LOTA 1V6DA 2H5DA 1SGDE 1G3DA 4Y76A 4R8TB 3MU0A 3A87A 5GCHF 1HB0B 2F4LA 1EPTB 2WV4A 4BAQB 4OS1A 1OHHD 1IHTH 2QY0B 1C5QA 2ZIQH 1BBRE 3SUFA 3EA7A 3QK1A 1J14A 3PYHA 1H9IE 1P9UA 2Z7FE 2FOHA 1CO7E 3ZVEA 3QWCH 1DSTA 1GBKA 4Z0KA 1O5DH 1RS0A 2VGCB 1BTPA 1SPJA 2ZGXH 1O3GA 4Q7YA 2W7SA 2GVFA 4YOIA 3VB7A 1BITA 2BVSH 4FETA 1CBWC 1TNHA 1VGCB 3A88A 3SJKA 4JK5A 4BAMB 1AZZA 3SN8A 1PPGE 2J34A 1GMHF 1AY6H 3M5NA 3CI0J 5EQSA 1UCYH 3D65E 3F2FA 1ETTH 1EJAA 4IC5A 2IN2A 1AFQB 2Y80A 4I7YH 1TWXB 1O2YA 2AS9A 1XMNB 2PFEA 5CE1A 4BXWA 2WPKS 1H9LB 1KXFA 1FUJA 3PO1B 1FY5A 3NPSA 2OC1A 3VWOA 1TBQH 1BTHH 2GP9B 2VU8E 1NU9A 1RRKA 3VEQB 2F9VA 2YOLA 4X1RU 5HMAA 2AFQB 3SGBE 1NZQH 2SNVA 2BYAX 3GCTG 4UFFH 3T2NA 1CA8B 1UVPA 2BDCA 2PSXA 3MI4A 2C93B 1HNEE 2F83A 3OY5U 2BLOA 3UUZA 5BRRE 1HAOH 2FOMB 2P3TB 3MH5A 1TPOA 1UVSH 2ZFQH 2QXHA 1DSUA 3DSPA 1TB6H 3GDSA 1O5BB 2JH0D 1OX1A 4Y11E 3W94A 2BVRH 4B74A 3RXUA 1QURH 1C4U2 5T1VA 5A2MH 1TONA 3BTFE 2ZECA 1C5OH 2Z3CA 4RKJB 1T8MA 3HATH 2A32A 2FEQH 2QAAA 2BY9X 1OPHB 2HNTC 1C2GA 3BTWE 3T27A 3ZZDA 1CVWH 3RXTA 2G55A 3UWJH 3U1IB 2V6NA 1SGRE 1NFYA 1V2ST 1RFNA 3FANA 3H09A 1SQRA 1GJ6A 1GBLA 1F5RA 1T8LA 3Q77A 3RM2H 3M7UA 2GMTB 3URDA 1SGEE 4AB8A 3U69H 3UPEA 4D76A 2A5AA 5FCKA 2ZHFH 4X1NU 1S82A 2G5VA 1DLEA 1S0QA 1C1RA 4XSKU 3R62A 3CS0A 4IS5A 8ESTE 4LOSA 1C5PA 1ZPBA 1H8ED 1V2JT 2QXIA 1TLDA 3E16B 2ODQA 1GVKB 1LVYA 3HGNA 4FUIA 1O35A 1ELEE 1L1NA 5FX6A 1UTQA 4VGCC 1SOZA 1WBGB 2WUCA 1O3HA 2OK5A 1LVOA 2PW8H 4X1SU 1KSNA 2D8WA 2YNAA 1ZZZA 4HI3A 4Y79A 3OXUD 1YP9A 3LIWA 3P8FA 1YYY1 3MU1A 4INLA 5EJZA 1NBMD 4K1EA 3T26A 2W81A 2WPHS 1CGHA 1NM6A 1GVZA 2MCZA 1WAYB 1H9HE 1TE0A 1YY3A 2K0QA 4XOJA 1E1QD 5E2OA 1O34A 3SQHE 4B71A 3O8CA 1GJBB 3M5LA 1FY4A 3ELAH 3EQ0H 2H1UA 2J95A 4BTUB 3RDZA 5T6GA 3A7WA 1O2MA 1FAXA 4X6PA 1MD7A 2XRDA 1EAUA 4DURA 3SZNA 1CQQA 1F2SE 1W0ZU 4UONA 4HGCA 4DIHH 1A5IA 4ABIA 5F6MA 2JRAA 1IQJA 1FONA 2H9HA 2Z9KA 1GBFA 3ZV8A 2HVYB 3RJ3D 1HLTH 3A7YA 3RMNH 3T28A 1AO5A 1C2DA 1LVBA 1O3OA 1WUNH 2GCTB 2M5TA 2RLQA 1MBMA 1BJUA 3T25A 3UWIA 4I8GA 2C3SA 2ZF0H 1EAWA 1SGPE 4MVNA 3LH1A 2C8XB 4Y10E 1QR3E 4ZHAA 2TBSA 1A5GH 2O8MA 1OK9A 1XKBC 1QUBA 3LOXA 2ZFTA 4MPUA 3DFLA 2HNTE 1C5MD 1GI6A 2CXVA 5HZPB 1YM0A 5CHAC 5HGGA 5EPNA 3FO8D 1TGNA 3RXLA 1SS2A 1ESAA 3LGYA 3RLWH 3N7OA 2PR3A 3RXIA 2G81E 4FUHA 2PUQH 5G4BA 1EPTA 2RDLA 5EW2H 1BMNH 2CN0H 4AYEA 2QY0A 1F0UA 1ZRBA 1WXRA 1IQHA 1YPKH 2VWLA 4D9QA 1G30B 2RA0A 2A7HA 3RXMA 3UQVA 3K65B 1HXFH 1H8HD 1LHDH 5HXFA 3E91A 4E7RG 2KFWA 3E6PH 1E37B 3OY6U 2BDHA 1F0SA
chains in the Genus database with same CATH topology
4FXGH 2AIPA 1GI0A 2DE9A 2UUKB 1Y3VA 1P3EA 3ZZ8A 1ETRH 3GY5A 3Q00A 1PQ8A 8KME2 1O30A 4DCDA 2ANKH 1YPJH 4ABAA 4I8LA 3BF6H 2OD3B 1OSSA 1GHWH 3ZVAA 4I31A 1C1VH 1KXAA 2FOCA 1W8BH 1ELCA 3S9AA 2CJIA 3STIA 2AGGX 3U8RH 1DM4B 1H8IH 2ZGBH 2GZ9A 4XFQA 1ZGVA 4D8NA 2TPIZ 1UVTH 1P2NA 4IN1A 3GYLB 1HUTH 3SV6A 3GY8A 4B2BA 2HNTF 1KLIH 1HAGE 1O39A 6LPRA 2CG7A 1HJ8A 3RMLH 3STJA 2Z94A 4BXSA 2FM2A 1O2VA 2BZAA 3D23A 3GY4A 5FX5A 2XCNA 3MYWA 3QO6A 2STAE 2Y6TA 1MKWH 1ID5H 1S85A 4Q80A 3RXAA 5C20A 3ATMA 1D9IA 1XVMA 3FP7E 4JK6A 1W13U 1OYQA 3MU4A 1JWTA 3RXFA 3OU0A 2CHAC 2NWNA 1TMTH 3F1SB 2BM2A 2BD3A 2GGVB 4H4FA 2C4FH 1ZRKA 3GDUA 4WMFA 5LGOA 2OP9A 1Q2WA 3R0FA 3SJIA 2TGAA 1HJAB 2CMYA 2FX4A 3SW0X 3FVFB 3W95A 1P57B 2P3FH 1SLXB 2QF0A 5K7RA 2F9PA 1O33A 2P16A 2G00A 2FLBH 7GCHG 4GHTA 3A81A 2ZNKH 3PV4A 4UFGH 1UK4A 4X6NA 4KTSA 3PTNA 3RXGA 4YLUA 2VVUA 1C2IA 3M37A 2VVCA 1TMUH 4MPVA 1W2KH 1D4PB 3LGUA 2ZP0H 3SU5A 5L2YH 3BTME 1O9AA 1S84A 2ZDMA 4FU9A 2OC7A 4TPIZ 1WYKA 1NFWA 2H9EH 1LHCH 1FI8A 1RIWC 3A8DA 1AB9C 1ZGIA 3NCLA 1X7AC 4CR5A 3KXVA 1G3EA 3UY9A 1SGYE 1C5NH 3NUMA 1QL9A 1T7CA 3TITA 3Q3XA 3MTYA 2ALVA 1EXFA 3GY6A 2ZU5A 1TPPA 4Y0YE 1UCYK 1VJ9U 1J17T 2EC3A 1UJ1A 1HYLA 5A8YA 1W14U 4IN2A 4YNXA 1OJVA 3E0NB 5F03A 2BLQA 4TWWA 3UR9A 4BAOB 1O3MA 1EJMA 1V2KT 3SV7A 4GLYA 1GJAB 2ZI2H 3M7QA 4JZFH 2JETC 2ZPQA 1FPHH 1GCTC 1FIWA 1P2IA 1D6WA 1VVDA 1HXEH 1Z92B 2SGDE 4X6MA 5EG4A 1ACBE 3SJOA 4ISNA 3TJNA 4CREA 1KIGH 1TGCA 4A1VA 3KQDA 3VPKA 1PYTC 1A4WH 4JMYA 3BV9B 1JBUH 3KL6A 1FBRA 3U98H 3BEUA 2Z9IA 2LNCA 2VVVA 4CBOA 1RD3B 1LHGH 1VCWA 3RXPA 2QF3A 5TCAA 3SJ8A 2QYIA 2XRBA 1LKBA 1WV7H 3A86A 1W7XH 1QJ1B 1TGBA 3VB3A 2DE8A 2QXJA 2C8ZB 3P92A 1AI8H 2BY5X 1OP8A 2ZU2A 5DP4A 3OP8A 2R0KA 2GDDA 2ODPA 2HPQH 2ZC9H 1OXGA 4HFPB 1LPGB 3TJUA 1TNLA 2BDBA 4KGAA 1NU7B 5I25A 2W5EA 3URCA 3GCNA 1NRSH 5DJ7A 3QTOH 1ZPCA 2C8WB 3ZV9A 4FUJA 1E0FD 4LXBH 2ERJA 3BSQA 3BTTE 3LGWA 1UVOA 1YPLH 4DJZB 4TPYA 2QCYA 1MBQA 1BTZA 2ZDAH 1Z7KA 2ZFFH 2ZPSA 4DOQA 2B5TB 4VGCB 3GCTF 1QGBA 3AW1A 3UOUA 1RTLA 4UFDH 1A7SA 1O31A 1GMDG 3M3TA 4MLFB 4BOHA 1C2MA 1ETSH 2FS9A 2NU2E 1TX7A 3ZVFA 1A3EH 4NSYA 3IITA 3SU2A 1O3KA 1Y5BT 3UR6A 1TPNA 2ZTZA 3ZZ5A 2FYQA 1WTGH 4H42U 1AD8H 4AYYB 2AMDA 1SGFG 5HM9A 2VNTA 1QNJA 2OQ5A 3A8BA 3RC4A 3UIRA 1G4GA 4F4OC 2FESH 1YCPM 1GI7B 4H6SB 1F7ZA 1C1SA 1AVXA 6CHAB 1ZHMA 2VIQA 2HRVA 1XUIA 1OJWA 1TA2A 1A0JA 1ZOMA 4ISOA 2ZU3A 3UNSA 1G32B 1TQ0B 1Z8IB 1QQUA 1QTFA 1TAWA 1GL0E 1MQ6A 1MTUA 3EJHA 3EA8A 4JZEH 2OTVA 5F8TA 5T6DA 1E38B 3ZZ7A 1C4Y2 1L4DA 2FOEA 2QGRA 1ZMJA 4CHAC 1SVPA 1N8OC 3F9FA 2QXGA 3LONA 4GPGA 1HBTH 1Y5UT 1H04P 1GBDA 1ARCA 1EZQA 1SC8U 5CHAB 3F9EA 2I6SA 3PM3A 1AHTH 3GISB 4B75A 2HPPH 1NRPH 1NPMA 1O3PB 2RKZA 1O2TA 4X8TH 5HM2A 3BTQE 2FMJA 2WPMS 2ZHDA 2B7DH 4NA9H 4O3UA 1GDUA 1F0RA 1K28D 2UWNA 3M5MA 2XCFA 1H4WA 1QL7A 3M36A 4X8UH 4YZUA 1D3PB 1O3EA 1TBRH 2FP7B 4PROA 1GJCB 4X1QU 2VWOA 1UCYE 3L33A 5EXLA 1F0TA 2ZDLA 2B0FA 5FAHA 3ZRZA 3GOVB 3S0NA 1EX3A 1O3JA 1DY9A 4A7IB 2OXSA 1C2HA 1V2LT 4M7GA 4AYIA 1DITH 1V2UT 5JPMH 1GPZA 2BY6X 1C1PA 4X0WU 1PQ7A 1GGDC 4X2WA 3RLYH 1YGCH 4WJG2 4OS5A 1BZXE 1GBHA 4Y0ZE 5DP7A 2PUXB 3QLPH 2BQWB 4U2WA 1DXPA 2NU0E 1QRXA 1TQ7B 2PSYA 3QX5H 4WWYA 3EGKH 2G52A 2RL0A 1Z8JB 3VB4A 1KTTB 2ZKSA 2EI6A 3SNAA 3MNCA 4XBDA 1NRQH 3QZQA 1O2SA 4JZDH 5LH8A 1UTLM 1C2FA 1MKWK 2ZCHP 3OSYA 1ABIH 4Q7XA 2IJOB 1ZHPA 1MAYA 4LK4A 4I8JA 4O03A 1C5SA 2BLWA 2QA9E 2TIOA 3EA9A 2PGBB 4K2YA 4BAHB 4DT7B 3AVZA 3O8DA 2AERH 2ZDNA 5DP5A 2J2UA 3CS7A 1B5GH 1W11U 4K1TA 2XQWC 3KIDU 4IW4E 3SORA 3I77A 2UWPA 2W7UA 4B2CA 1EUFA 2ZG0H 1FN8A 2PTNA 3K9XB 2HVXA 3PTBA 1T4VH 4RSPA 2CHAB 1O38A 2XBVA 4TWYA 3RU4D 4MNXA 1NESE 6ESTA 4JZ1A 2BVXH 3GY7A 2EHFA 3JZ1B 2MCYA 1YBWA 2G4TA 1GBJA 3ATWA 4YOGA 3SU4A 2WIIC 1V2OT 2XNIA 4J1YA 4DJZA 3SI4H 2NU3E 1V2RT 2FX6A 2BY8X 3VGCC 2FS8A 2A2XH 3DT0H 3TH3H 2AH4X 3ZZ4A 3F6UH 1H2QP 4DG4A 2CG6A 3OEDC 1FPCH 2NU1E 2O8LA 3IX0A 1DANH 5EPYA 1VCQA 5CMXH 1GL1A 1YKTA 1TOMH 3ODDA 1HFDA 1ELAA 1PQAA 5C5NA 2BDIA 2EI8A 1DDJA 1P03A 3BTDE 1V2WT 4ZAEA 3RP2A 5EGMA 1BTXA 2GDEH 3H7TA 1O2QA 3KEEA 1OWDA 1AB9B 3KN2A 4BAKB 1GHQB 4K8YA 3PMAB 2VB0A 1MKXH 2VJ1A 4ABBA 2H2ZA 1EQ9A 5TJXA 1T32A 4XBBA 1FJSA 1O3LA 2ALPA 1YLDA 1LHFH 1RGQA 1TA6A 1ESTA 3ZZBA 4LZ1H 4JYTA 1GJ5H 2UWOA 4ONTD 3PB1E 4INHA 4NGAH 2RLPA 4I33A 2KRIA 2PLXA 1MTNC 1T4UH 2SNWA 4KKDA 2XXLA 1K1MA 1ANDA 1CT2E 2FTLE 2YBYA 1CT0E 1OJYA 2Z3DA 3MMGA 2JETB 5PTPA 1MCTA 4CR9A 1G2MA 1Z6JH 7GCHF 1BRUP 1K1PA 1P3CA 4GHQA 4AGKA 4B76A 4E06H 1C2EA 2XC4A 1G37A 4YESB 3SBKA 1DVAH 1ELBA 4I32A 3UOPA 4CH8B 1K1OA 1DWCH 5GIBA 4NWLA 3SV2H 5EODA 1UTPA 3T29A 1RTFB 2WPIS 1TFXA 1E36B 4NG9H 1D3DB 1UK3A 1ELFA 5DPAA 3PROA 3TK9A 5ESBA 2W3KA 1IQIA 2EEKA 2CKUA 3QGNB 4DY7B 2FOAA 3GCOA 8LPRA 3Q76A 2FIRH 3DFJA 1O2LA 2YRAA 3LC5A 1BIOA 1NTPA 1GDNA 1GHBF 1FV9A 1Y3UA 3FP8E 3QZRA 3ESTA 1IQKA 4NZLA 4TY6A 5DKMA 3TU7H 2P59A 2WUBA 3U8OH 2Y81A 4MPXA 3LC3A 3A7XA 1LQEA 4Y71A 9ESTA 3LGTA 1FDPA 2ZO3H 2ZDKA 1UHBB 3GOVA 3BIUH 3RC5A 4FVBA 1VR1H 3LJJA 2F9NA 1AN1E 2WPLS 4F49A 5T3HA 2BZMA 1C5RA 1OK2A 1BMMH 5BPEA 3RU4T 3MOCA 3MNXA 1BTWA 1RXPA 1THRH 2EC9H 3A89A 1IAUA 4IMQA 1W3CA 1QJ6B 2O8TA 1KYNA 1C1WH 1HFIA 1HIAB 3K2UA 4RN6A 3SU0A 5HYTB 1FLEE 1O2ZA 1Z6EA 2BQ6B 4ISHH 3K6ZA 2RCEA 2STBE 1C5VA 1BMLA 4Y8XA 1CHGA 1DWDH 4Q2KA 4NWKA 9LPRA 4X8VH 1YLCA 1HAHH 1ZJDA 1GVLA 3PMBB 3DD2H 4K3JA 1CA0C 1Y59T 4K60A 1OWEA 3ATLA 4WH8A 2ZFPH 4I8KA 1QQ4A 2GD4B 3V3MA 1HCGA 2SGQE 3SNDA 2GTBA 3TNTA 2V3HH 5DP8A 3TJOA 1QJ7B 1OKXA 2O8UA 2P94A 2FI3E 4NFFA 4BTTB 1H1BA 1GHAF 3UREA 5C67A 2Q1JA 3O8EB 1BHXF 4A6LA 1GWAA 3BN9A 4ABEA 1A2CH 7KMEH 4WMDA 1EPTC 2F9OA 3V12A 4A1TA 3M5OA 1MUEB 1Y5AT 1FY8E 1O2RA 2A4QA 1DICA 3B8JA 5DP3A 2JGXA 1C5WB 1XXFA 1Z1IA 1C5UA 2VINA 3ATKA 1SFIA 2J38A 1JOUB 2OCVB 3E0PB 1EOJA 3PMJA 1VGCC 4CHAB 2PTCE 3RXJA 2VIVA 4WY3A 1LHEH 1N8OB 1RJXB 1GI2A 1ANEA 3SNBA 5AF9H 1G36A 4ZXYH 1IQMA 3NKKA 3U8TH 3M35A 5AVDA 1C1UH 4XBCA 1J9CH 3TJVA 3RC6A 4JHSA 1W7GH 1GMDF 1YC0A 1AFQC 3MO3A