1GPZA

The crystal structure of the zymogen catalytic domain of complement protease c1r
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
396
structure length
368
Chain Sequence
IKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQQIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGIAHDLRFVRLPVANPQACENSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT C1R COMPONENT
publication title The Crystal Structure of the Zymogen Catalytic Domain of Complement Protease C1R Reveals that a Disruptive Mechanical Stress is Required to Trigger Activation of the C1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 76
structure length 368
sequence length 396
chains with identical sequence B
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2001-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gpzA04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA02
4GCHF 4IMQA 1EZQA 4K69A 1TNJA 1E34B 1NO9H 3NXPA 3A80A 1H8IH 2CJIA 2XWJI 3Q00A 4ABFA 2FO9A 1C2MA 1NU7B 1EASA 4MPVA 1DX5M 4Y8ZA 4JCNA 2W81A 3SN8A 1O2ZA 5FXLA 2A31A 1W7GH 2FZZA 3RM2H 3LJJA 4YM9A 1MZDA 1Y3XA 4CRBA 3LGIA 4JHSA 2FP7B 1GCDA 1DLKB 1BB0B 1HIAA 1AFQC 2ZFFH 1RIWB 3TNSA 2Z9LA 1O5EH 3ATMA 2HPQH 1O2QA 1V2TT 4BXWA 3TH2H 5FBIA 2A5IA 1OJYA 2Z3DA 1BCUH 1F92A 3UQOA 3NFPI 4BAOB 1JBUH 2AMQA 4DGJA 3SNDA 1D3TB 4CHAB 3MNSA 1BJVA 3ZD1A 2FI3E 3U98H 5DO4H 1C1OA 2FPZA 1GI8B 3MH5A 3VXEH 1HJ8A 1PQ7A 1O3GA 4OS4A 1L1JA 4IC5A 4X6NA 2WPIS 4Y11E 3A89A 4Q80A 2VIOA 4JK6A 2BVSH 4ZUHA 4A1XA 1C1UH 5A0BA 3V0XA 2BZ6H 2XWBI 1P04A 1GBBA 1UO6A 2JH5D 2UUJB 1NY22 2AERH 1LHDH 4ISIH 1Y8TA 1ELGA 1OK9A 3MH7A 3MQLA 3EQ0H 1C5XB 1CSOE 3T62A 3LKWA 4ABHA 4YOGA 3A8BA 1A5GH 1C4U2 1KXFA 2F9NA 2H5CA 1N8OC 2KAIB 1B0EA 2HGTH 4I8GA 3URDA 4E05H 2ULLA 4F49A 3LGWA 5JB8S 1QBNA 2BD7A 5SGAE 1G36A 2XQWC 1PPFE 1EJNA 1GMHG 4X0WU 1GPZA 3VB5A 1QGBA 2FXRA 1EJAA 1O33A 4B2BA 2V0BA 1F7ZA 1V2KT 1H9LB 1C5QA 2XRBA 2C8WB 3BG8A 3OY5U 2TRMA 2O8UA 3A87A 1ZSKA 4WMFA 1HAPH 3KF2A 3MI4A 4E7RG 2Z7FE 3P70B 1O3EA 2ZU4A 4MNWA 1OP0A 2IN2A 1GI0A 2CF8H 1K1LA 5I0QB 1EZUC 1AB9C 1BHXB 4ZKNU 4A6LA 3BSQA 4WVPE 1XXFA 1AGJA 2G5VA 4M7GA 2WPJS 4FU8A 5HM9A 1FY8E 2HNTF 4NSYA 1O38A 1AZZA 1UVPA 3SI4H 2AFQB 1ELBA 3JZ2B 3MO6A 1F2SE 3TU7H 3VB3A 4AG1A 3E0NB 3BTEE 1HUTH 1ZHMA 1K22H 8LPRA 2BHGA 2UWPA 5AHGH 2XRCA 1GJ7B 2VH0A 3GICB 4IW4E 2XBXA 1C2GA 3SW0X 3BG4B 4WXVA 1O3FA 1K1JA 1PPCE 2FS8A 1FN8A 1EP6A 3OSYA 3OY6U 1UTLM 1TA6A 1WOFA 1GL1A 1CVWH 3UUZA 1GHYH 1YM0A 4JZIA 5CHAB 2AGIX 1T32A 1MU8B 2RA0A 1HAXB 3RDZA 1UCYK 1A61H 4O03A 2V3HH 1Z6EA 1O0DH 3BEFB 5FX5A 1GI3A 1YCPK 5LGOA 2QN5T 2XTTB 4Z6AH 3TVJA 1ZJDA 3EA9A 1VITH 2EEKA 3BTKE 1PPZA 3EJHA 2GDEH 1V2NT 2SGFE 5FBEA 1E37B 1PQ8A 2ZKSA 3UNRA 4QT8C 2FLBH 2GGVB 3M5LA 3V12A 1QRZA 3BIVH 2BZMA 3GY4A 1ZRKA 2ZWLH 3A7ZA 1O5FH 3PMJA 3RXFA 4K12A 1H03P 2P95A 1WV7H 3TLOA 1EXFA 1EAUA 4ZHAA 1HAGE 1TPMA 1MTVA 2W3IA 1J14A 3QGJA 2FM2A 3PO1C 4YT6H 5DP9A 3DD2H 4INLA 1D6WA 5EQQA 1G3BA 1EKBB 1P0SH 1TIOA 4CH2B 3SJKA 2VB0A 1O5CB 5C1UA 2Y5GA 2ZPQA 1TNLA 1O32A 4FUEA 3FZDA 1FV9A 1BMLA 3A84A 4WJG2 3GCTF 1NM6A 3LC3A 2HALA 4WH8A 1TB6H 2FOEA 1P12E 2VIDA 1HAOH 1S0QA 5EGMA 1XX9A 1C4V2 4AN7A 2B5TB 3ZYDA 1GG6C 2G5NA 1DANH 4ISHH 1KDQB 2AMDA 4X1NU 1F5KU 2C8ZB 4BTTB 1ZOMA 1K2I1 4LOTA 1NRPH 2BX3A 1K9OE 2Z94A 1SLWB 1XUKA 1TOMH 1UVOA 2BMGB 4ABIA 5T3HA 1H9IE 4PZ5A 3RXPA 2A55A 4TWWA 1RTKA 2BDCA 7GCHF 4DJZB 4AYVB 3F9GA 1Y59T 3RC5A 2BY7X 1QTFA 1OK2A 1QB9A 4IBLH 2ZHFH 2Z9GA 1QL8A 3BEIB 4ZH1D 2AMPA 3ESTA 2VVUA 1E0FD 1GCTB 3PMBB 3UWIA 3TJOA 1YC0A 1O2PA 5TJXA 1HAVB 3SV2H 4O9VA 3KIDU 4TY7A 2ANMH 3NKKA 1HPGA 2BVXH 4UDWH 3UIRA 1E5GA 3I77A 1D3QB 4AOQA 5I25A 4Y8YA 2ZECA 4GHQA 1ELCA 5AVDA 2O9QA 2W80A 4JZDH 2ZFPH 5PTPA 4NIWA 1UTOA 2ZDMA 1Z8GA 2ODQA 2KAIA 3ZVEA 4IMZA 1ANCA 1RIWC 1YPGH 2ASUB 2EHFA 1HB0B 3BTDE 2ZHDA 1NN6A 3SUDA 1W7XH 1SHHB 2D2DA 3MTYA 2XBWA 3UNQA 2FOHA 1Z7KA 1NFXA 1O3KA 4Y10E 1DUAA 4DVAU 4CHAC 2A4RA 3TH4H 1NT1A 2A4GA 2TGAA 5FAHA 1ZGIA 3D62A 1GHXH 1BTUA 1O3DA 2F9UA 1V2VT 2P3TB 4FUDA 3M5OA 4GVUA 4X2VA 4ZMAH 4A7IB 3UPEA 5DG6A 2UWOA 5E8EH 1KLTA 2FOAA 1AE5A 3FZZA 3LJOA 1HAIH 2JETB 1BTZA 3T27A 3RC4A 1BIOA 3TK9A 4X1SU 2ZGBH 4OS7A 4I8KA 1G9IE 3MNBA 4OS1A 2WUCA 1AVWA 1TMTH 3UQVA 2QAAA 1RS0A 3GISB 2SGPE 4LXBH 2B5ID 1AUTC 3P8OA 1ZMJA 3ATWA 1GJBB 1J17T 1BMNH 1QBOA 2QC2A 2VIPA 2QXHA 3MMGA 4UE7H 2ZU2A 1G30B 2Y7XA 1SRZA 3DHKH 2O8TA 4BTUB 1HGTH 1OK3A 1OWJA 3SOSA 4FU7A 1NRQH 1HAHH 2ZHEH 5C67A 5A2MH 1OWIA 2W5EA 1OOKB 3SV9A 1H04P 5H4IB 2ZC9H 5BPEA 3GDUA 4YNXA 1GBKA 2ZFQH 1TRNA 1QRXA 2J9NA 1L1GA 4XBBA 1HAZB 3QTOH 1NRSH 2OQ5A 4OGYA 3A7TA 4YOIA 1RJXB 5G4BA 5EQSA 1D4PB 2PHBA 1LVBA 1OWDA 4HFPB 1CT4E 5JBTA 3BTGE 4GLYA 3EYDA 2PKSB 3T25A 3SQEE 2XNIA 3ODFA 1ID5H 1G3DA 1ZRBA 1YF4A 3LONA 4X6PA 1LCYA 3QGNB 3N7OA 2QXIA 1WTGH 1UCYH 1SBWA 4H6SB 3GYLB 4FUFA 1ARBA 1C2EA 1ZHRA 1O37A 1W3CA 3VGCB 1PYTD 2VIWA 3SORA 2GCTB 3OX7U 3HKIB 2DE9A 3CS0A 1EOJA 1AFEH 1P2KA 2BDIA 3DFLA 1DICA 1GVKB 1GI9B 2CXVA 4DCDA 1LQEA 3E1XB 3SHAH 1Y5BT 1Z92B 2BY5X 5DGJA 1T8OA 1C5PA 1W11U 1O5DH 1XXDA 4NZLA 2OC0A 4K8YA 1LHFH 4ONTD 2NU4E 3BG4C 1AWFH 2PKAB 4ISLA 3O8RA 1AIXH 3DA9B 3ZD2A 2VWOA 3URCA 5CHAC 1KDQA 1C5VA 1QJ7B 3SGBE 1P11E 2Z9KA 2UWLA 1SR5C 2ALPA 3RXJA 1IQEA 1LDTT 1QB6A 3I29A 3MWIU 1HCCA 1MKXH 1ABJH 1CA8B 2Y80A 4NIXA 1O3HA 3M61U 1S81A 4YLQH 1XUJA 1SGPE 2J95A 3FP8E 1Z8RA 2XC0A 4UD9H 1MU6B 2WV4A 1O34A 4Q7XA 1MBQA 2FYRA 3F9FA 1GMCF 1L0ZA 4DURA 4BAQB 5FPTA 1OWHA 4HGCA 1FAXA 3SNAA 4DT7B 2ZO3H 4NWKA 2G8TA 5TCCA 2Z3CA 2OTVA 4Q7ZA 4U30A 4UFDH 1OYTH 1VITG 2GZ8A 3TGJE 4K8BA 2W7SA 4KGAA 1E38B 3SU3A 2F83A 3STJA 1OS8A 4BAMB 3TITA 2HLCA 3M3TA 1UVSH 2BDHA 1MTNB 1P9SA 1SLUB 3GY8A 1ETTH 4FVBA 2OLGA 1GJ8B 3T28A 2JRAA 1UTJA 4NWLA 2Q1JA 4WMEA 1F0UA 2ZEBA 5FO8C 2A5AA 3RXSA 3IU3I 1NZQH 2A4QA 1SGQE 1P2JA 2QCYA 1PPQA 3B9FH 1E88A 1KTSB 1D6RA 1QL7A 1AZ8A 2G51A 4OGXA 1ZHPA 5DP3A 4ZHMU 1QB1A 2CN0H 1N6XA 3TH3H 2FS9A 1UJ1A 3V13A 1MCTA 4JK5A 3SV6A 4INKA 2FOCA 3M3SA 5E0GA 5FX6A 2XWBF 1GI2A 4TPIZ 3T26A 1C9TA 3KQCA 4AGJA 5HZPB 1MTSA 5EQRA 2ZU5A 3HGNA 4X6OA 2BD9A 2OBOA 1L4DA 1KY9A 2QGRA 1F5LA 1KXAA 3RU4T 2FIRH 4Y7BA 1U5MA 3ZVAA 1GCTC 2JH6D 4B74A 3UREA 1QIXB 1UTNA 2ZU1A 3M7QA 4ZHLU 2GVFA 1G32B 2BD4A 1O3CA 3SNCA 1BZXE 3PLPA 3BTHE 1L2EA 4D76A 4OS2A 1NRRH 1W14U 3SUFA 1TE0A 5E0JA 1YLCA 3SJIA 2QIQA 3MU4A 1QO6A 1YPKH 4JYUH 2LOJA 4C16A 3LGYA 1PJPA 3U69H 4ABBA 1W10U 1TNGA 1P2MA 1SSXA 3DUXH 2ZPSA 3KCGH 1K28D 1KSNA 1XKBC 3KQEA 3L3TA 3FP6E 3M5NA 2F3CE 2B9LA 2Y5HA 2YOLA 1AWHB 3Q77A 1TMUH 2BQ7B 1IQLA 2GV7A 3AAUA 2ESTE 2FOMB 2ODYB 1DXWA 1EQ9A 2OD3B 2OC7A 2PTNA 3RU4E 1DE7H 1QA7A 4NSVA 3ZRZA 2SGAA 4AGKA 2WIIC 1TRYA 1TPAE 1MH0A 1ZGVA 1GBAA 1DS2E 2F9OA 1SS2A 1TNKA 3A82A 4YESB 3C27B 3ZV9A 2H6MA 1TALA 2BDAA 3LT3A 1GI7B 4A1VA 3ODDA 1IHSH 5HYTB 1CT2E 2MCYA 4HTCH 4K5ZA 1A2CH 2GCHG 3FP7E 4NGAH 3A7XA 4AX9H 1NFWA 4H6TA 1O3OA 1SPJA 1IQJA 3INBC 2H9EH 1C5SA 3ATKA 4B73A 3ZZDA 1LTOA 1T4UH 1CE5A 1PQ5A 4LK4A 2ZDKA 8GCHG 2OINA 1RTFB 3M35A 3SNEA 1NWVA 4JZ1A 1TGNA 3UOPA 4BAHB 4AYEA 5L2YH 1B0FA 1O3AA 1LO6A 1F5RA 3RXDA 1GL0E 2J38A 4YTAA 2A4OA 3LH1A 2PW8H 3ATLA 1UTMA 1GHQB 5F8XA 1UMAH 2WYGA 1CO7E 1K21H 2FLRH 3SV8A 2BY8X 3E0PB 4JYTA 5T6GA 4B71A 2SNVA 5GDSH 1U6QA 1TYNA 1UK4A 2PKSC 3RXVA 1SGNE 1DWEH 1WBGB 3MU5A 1ELFA 4K1TA 4RKJB 2BLQA 5EODA 1H9HE 2ZQ2A 3U8OH 1KXDA 1SQAA 2FEQH 3VGCC 2GCTC 2C93B 1DSUA 3NPSA 1LY2A 4FXGH 4GPGA 2G00A 4J38B 7KMEH 2BD8A 1GHBF 3HK3B 1XUHA 1C2IA 4YZUA 2CHAB 4MTBA 1WUNH 1V3XA 3RXRA 3S0NA 2PR3A 2IOTA 3NK8A 1FAKH 1TBQH 1TOCB 2ZDLA 1ZZZA 5DP5A 1G37A 4XSKU 2AGGX 1A0HB 1ZSLA 3RXHA 3TJUA 3PWCA 4Q2KA 4NZQA 2GDDA 2PTCE 3OXUD 3SJ8A 2Z3EA 2UUKB 1RTLA 1V2UT 1NS3A 1XKAC 3LOXA 3EAJA 4AZ2B 4WXIA 1AMHA 3GCNA 1V2OT 2FOFA 3L33A 2WINI 2JH0D 1PYTC 2XXLA 2OP9A 2ZDVH 4D7GA 3LDXH 1PQAA 2WUBA 2FWWA 1L1NA 3G01A 5IYTA 6GCHF 1KIGH 1S5SA 1O9AA 3VB6A 1GMDG 5GIBA 3KHVA 3P8NA 2TGTA 1BUIA 1M9UA 3PLBA 3UR9A 2P8OC 5C2ZA 4X1QU 1WYKA 5GCHG 3SO3A 4E06H 2Y81A 1E36B 1CBWB 4K60A 2RA3A 3T2NA 2YBYA 4HI3A 1OPHB 2ZQ1A 1BBRK 3S7KB 1SGFA 4Y79A 1TAWA 2GD4B 3K2UA 1SLXB 1SGIB 1SQTA 5EW2H 1MUEB 2BDYA 3IG6B 1BT7A 2OXSA 3AW0A 5ABWA 1LPGB 5E2PA 4ABAA 1CGJE 4A5WB 4MG3A 5FPYA 5L6NH 1S6FA 1KYNA 1YBWA 2CGAA 5F8TA 1EUFA 1MTNC 4ZKSU 2XC4A 4UFFH 1HRTH 1EPTB 1NTPA 1O2LA 3KQDA 3Q76A 1ZPZA 1AY6H 1TFXA 1FONA 2DUCA 4FUIA 5HXFA 3GOVB 1SQOA 1CGHA 2WV5A 3RLYH 1HCGA 1HXFH 1GVZA 2BY9X 3QWCH 1O5BB 1EZXC 3DFJA 3P6ZB 4B2SA 1V2ST 4GCHG 1OJWA 1MKXK 3NWUA 1O3MA 3EA7A 4XBCA 1ANEA 3GY6A 4D9RA 1HV7A 1LVYA 1O2IA 1DWBH 1T4VH 2QY0B 3ZVBA 4AORA 4DIHH 5GXPA 1KLIH 1XUIA 1HFIA 3ZZ5A 3KXVA 3UTUH 1UCYE 6ESTA 1BTYA 2FOBA 3F6UH 1GI1A 4X8VH 3GCHB 3Q3KA 2P16A 3A7YA 2VVCA 1BITA 1EOLA 1OXGA 2OQUA 1GHAF 4AFZA 3V3MA 3T29A 4FUCA 4UONA 3M7PA 3HGPA 4AB8A 3SU0A 2PUQH 2ZF0H 1GBDA 3SQHE 1QUBA 2RDLA 5LPFA 2BTCE 3UNSA 1V2JT 1PFXC 4THNH 1HFDA 2A7JA 2GZ9A 3Q3YA 2WYJA 1P09A 3SU5A 1DY8A 3D65E 1VITF 1SVPA 3OYPA 3ZZ6A 1VVDA 2H2ZA 1AI8H 1QJ1B 2VU8E 1WSSH 1G3CA 1WQSA 3ZYEA 1V2MT 1FY4A 1OKXA 4DW2U 4ZAEA 3A8DA 1T8NA 1C1TA 1SOTA 1X7AC 1P02A 1QA0A 2ZCLP 4I32A 1A5HA 1EAIA 1LHCH 3I78A 1CHOG 4H4FA 4DY7B 1C2HA 1UOTP 2CV3A 2XC5A 2AEIH 1C5UA 1HJAB 1PPGE 2Z6BD 4MPUA 3M36A 3PTNA 1HFHA 3T5OA 1BTHH 1K1NA 2QF0A 2ZHWH 1AKSB 4CRFA 4AFUA 3A83A 1W2KH 2PGQB 1Y3VA 4XDEA 1T8LA 2VIQA 4BNRA 2G4TA 3MO9A 3HPTB 4MNXA 1PPHE 4ZXYH 3LC5A 3P17H 1VJ9U 4I8LA 4X8TH 2ZA5A 1EB2A 1DITH 1V6DA 4GSOA 1OK1A 2JGWA 3MU1A 9ESTA 5JB9S 1O2TA 4CRAA 3QTVH 3A8AA 1P10A 2PSXA 4CRDA 1VVCA 1O2NA 1FY3A 4CSYA 2ZGHA 1RD3B 3MFJA 4IC6A 4UFGH 1P57B 1EP5A 2GT7A 3RLWH 3QN7A 2ZG0H 1SB1H 1RRKA 3ZZ9A 4I33A 1IQKA 1RFNA 1V2RT 1EATA 2A2QH 6LPRA 3KL6A 1SGYE 4DG4A 3AW1A 1OX1A 2H1UA 1WU1A 5DP8A 1UHBB 1C1QA 3BEUA 3ZZ7A 4TPYA 5HYPA 4X1PU 1YYY1 2ZU3A 1BRBE 2PV9B 3UFAA 1C5NH 3U9AH 2VVVA 3MYWA 4CREA 1JRSA 2ZDAH 3F1SB 1GHWH 1GBFA 1O3NA 3CENA 5LH8A 1T7CA 1BA8B 2SGDE 2BZAA 1ANBA 1IQHA 2BXTH 2AH4X 1ESTA 2JGXA 1Q2WA 3T5FH 2J94A 3TK6A 1S0RA 1HJ9A 1LPKB 2GMTB 2VWMA 2R3UA 4RKOB 3RXUA 1P3EA 2EI8A 2FI4E 2NU0E 1SGDE 3S9CA 4X2XA 1GI6A 2R3YA 4FUGA 2WPKS 1GWAA 2XCFA 3GY7A 1CGIE 2QYIA 2EI7A 2WPHS 1HAYB 2TIOA 1LKAA 1DUEA 3RJ3D 5GPIB 1CKLA 2AIPA 2CHAC 1ELAA 1FNIA 1C5ZB 2NU1E 2ZTZA 2J2UA 1ELDE 2TPIZ 3M37A 5L30H 1O2RA 1W0ZU 1DSTA 3F9EA 4AYMA 2NU2E 2FODA 4LZ1H 2G7IA 3EDXB 1HIAB 1BBRH 1SHYA 1LPZB 1ZR0A 5F03A 1YPMH 2QXJA 1KXEA 1CQQA 4GHTA 4U01A 1XVMA 4OS5A 3PMHB 4FXGG 2VNTA 2Y82A 3KGPA 1C9PA 1Y3UA 2ZGXH 2JKHA 1QL9A 5JPMH 1HNEE 2ZFRH 3ENSB 3RXBA 2Q6FA 5J4QA 2FTLE 4AB9A 5EXMA 1MCVA 4Y0ZE 4ABJA 1EJMA 1C1WH 5HMAA 5FCKA 4Y0YE 3SGAE 1V2PT 2VWNA 3E6PH 2R9PA 3TGIE 2GT8A 1GJ9B 4JMYA 2A45B 5LPRA 4CH8B 4NIVA 2O39C 4RN6A 3OTJE 1GJAB 1O3LA 2EA3A 2XBVA 3KQBA 4UFEH 5C3NA 1A0JA 1A4WH 2VGCB 1Z71A 4HZHA 1BHXF 1SFQB 1TRMA 2ZCKP 1CBWC 3NUMA 3K6YA 3RXQA 3OU0A 1FBRA 4YT7H 2M5TA 4DJZA 2VIVA 1GMHF 4ABDA 5F6MA 2OUAA 1UTQA 3PLKA 3B23B 1VCWA 3RMMH 2G55A 2BY6X 3MNCA 1VGCB 2W26A 1O30A 1HAVA 3BN9A 3RU4D 3SHCH 1P01A 1DWDH 4NA9H 2XRDA 1IQIA 1F0SA 1EPTC 4R8TB 4O3TA 1UVUH 1V2LT 1VR1H 1OJVA 4JYVH 3SU6A 3ZZ8A 1MTUA 1C1SA 1MQ5A 1YP9A 1KXBA 1QY6A 2TBSA 1K1IA 3EA8A 3QZQA 3O8CA 4AYDA 1BTWA 1FDPA 2WPMS 2A7HA 1C2KA 1BJUA 4K2YA 2BDGA 5CMXH 5A8ZA 5K7RA 7GCHG 1S82A 1AKSA 4IS5A 1O2XA 2A7CA 1F0RA 2YNBA 1P2NA 3RMNH 2A32A 2ZGJA 3SU4A 1C5MD 1K1PA 1GJ5H 1SG8B 1FIWA 3BF6H 3QX5H 5I46H 1THPB 1H8DH 4X1RU 3RXKA 1DT2A 1QRWA 3ZZCA 3SJ9A 3UY9A 5FHTA 1DDJA 2OBQA 2AYWA 3EE0B 7ESTE 2BOKA 2XWAA 1O2WA 2D1JA 1Y3YA 3GCHC 4UEHH 3EGKH 3TK5A 3ZZAA 3DT0H 1UTKA 4ABEA 3BTFE 2F9BH 1Q3XA 2AS9A 2CMYA 2Z9IA 1FQ3A 3JZ1B 2I6QA 8ESTE 1O36A 4U2WA 1GMDF 5LPEA 2ZI2H 1C1PA 1GDNA 2ZNKH 3MH6A 1SGCA 1HDTH 2BXUH 5DPAA 1EB1H 4TY6A 3FFGA 1FPCH 1THSH 3B8JA 3A86A 3P92A 4SGBE 2Y5FA 3ATIA 4I8HA 1FIZA 4YOJA 1NROH 1QCPA 1O2GH 3RM0H 2BX4A 3RXAA 1P05A 2V3OH 5EOKA 1OP2A 4U32A 4MQAA 1C5LH 1GJ6A 1UHBA 4A92A 3SNBA 1MKWK 2B8OH 2P3UB 5DP4A 2UUFB 2P3FH 1G4FA 1FPHH 1HYLA 4LOSA 1H1BA 3O8DA 1W13U 1QNJA 1J9CH 1O35A 3K9XB 1HJAC 1O2OA 2J92A 1IAUA 5GJ4B 4Z0KA 3WY8A 2C90B 2FDAA 2HPPH 1TONA 1CA0B 1Z1IA 1S6HA 1DY9A 4A5TS 1P03A 1L4ZA 4FVDA 3NZIA 1BTXA 4WWYA 1BQYA 2C8YB 2NWNA 1D9IA 1ZSJA 3BTME 3HKJB 3R3GB 3W94A 5DKMA 3RMLH 1DPOA 3A7WA 1AN1E 1IHTH 1Z6JH 3LIWA 3ZVFA 1FJSA 3SI3H 5F8ZA 2JETC 1A0LA 1SGTA 5B6OA 2BDBA 3CALA 4WH6A 3KEEA 1DVAH 2BOHB 1C1NA 5A0CA 3QDZB 4NFFA 3A8CA 3LPRA 5BRRE 3TGKE 2ILNA 1AQ7A 3TJVA 2Q6DA 4IN1A 1NU9A 2C4FH 2GKVE 1VCPA 2EC3A 3H7TA 4B1TA 4J1YA 5JBAS 1C5YB 1WCZA 3F9HA 1TMBH 2PKAA 2BYAX 3H7OA 1SFIA 1XVOA 2BD3A 3P8GA 3RP2A 3E8LA 3ZZ4A 1CHOF 5AFYH 5C5OA 2GX4A 1GJ4H 3A81A 4MLFB 1OSSA 2K1QA 4KELA 4CR9A 2VWLA 1C5RA 1AHTH 2STBE 3RXGA 4OS6A 4XOJA 1P2IA 1ELTA 1ESBA 2GMTC 2SGQE 1ABIH 1GBEA 2A2XH 1C5TA 4JZFH 3ZZ3A 2OC1A 3SV7A 1O39A 4WF8A 1MAYA 1BRUP 3OP8A 1GJDB 2Y6TA 1TX6A 5A0AE 1JOUB 5ETXA 1ETSH 1LQDB 2CF9H 1C1ZA 3FVFB 1C5WB 1HXEH 1W0YH 2XBYA 2BD5A 3E91A 2D8WA 2VJ1A 3K65B 1MZAA 2HNTC 4X2WA 3STIA 4MPWA 3A85A 5ESBA 4BOHA 4ZKOU 4YLUA 1G2MA 3ITIA 5A8YA 4KKDA 2IJOB 4X8UH 2Q6GA 1A5IA 2PSYA 1Z8IB 1E8BA 2BM2A 1C2JA 4IN2A 1VCQA 2J34A 1T31A 1ZJKA 1P2QA 2ZTXA 4Y6DA 3VEQB 1P2OA 3MO3A 3PYHA 5JBCS 1NPMA 2W3KA 2QXGA 3SUEA 3O8EB 3UR6A 1GMCG 4CR5A 3GXEA 2BQ6B 2QF3A 5AFZH 3IITA 3BIUH 4AFQA 3GDSA 1C1MA 3QO6A 2HWLB 4AYYB 1YGCH 2RCEA 4XFQA 1KTTB 3RXTA 1Z1JA 1O3PB 1O2HA 1LHEH 2P93A 4MPXA 3SBKA 2PFEA 2SFAA 4ZROA 2H9TH 2VGCC 1MQ6A 3A7VA 5L2ZH 1YPHE 1ZTKA 1D3DB 4CRCA 5JPMG 1SGEE 1GGDB 3PB1E 3RXCA 2ODPA 2LNCA 3VXFH 1YPJH 2LPRA 4J2YB 4XE4A 1BMMH 1QQUA 2ZIQH 4MDSA 4AG2A 1IQMA 2P59A 3CS7A 1VGCC 1FY5A 4Y8XA 1GI4A 4Y71A 5K0HA 2VH6A 3E3TA 1GJCB 4MNVA 3P8FA 4X6MA 1TNHA 1OYQA 1WAYB 2WPLS 4INHA 3LGTA 1Q31A 1ELVA 3UWJH 1W8BH 3FANA 4WY3A 2O8LA 1XMNB 4O3UA 5DP6A 1G3EA 1FUJA 2ANWA 1C2DA 3U1JB 2ZFTA 4AFSA 3E90B 1ZTJA 5HYOA 1OP8A 3O8BA 4CBOA 1ELEE 4NFEA 3ZVDA 3BTWE 5EXLA 2GV6A 2G81E 2F91A 1GKGA 4RSPA 3TIUA 3FAOA 2IPHA 1CU1A 3M7TA 4YO9A 5EU8A 2PGBB 2XCNA 3R0FA 4WMDA 3PTBA 3ZZBA 5CE1A 2IZ3A 1GBIA 1MKWH 2C3SA 1LVOA 1YCPM 2RLQA 4XBDA 2FI5E 1GBCA 1INCA 4PROA 3U8RH 1SC8U 2FYQA 2ZFSA 3M5MA 3E16B 4MNYA 2B7DH 2OC8A 1YPLH 1JMOH 2MCZA 1KLJH 1UVTH 4R0IA 1C1VH 5JYIA 3D23A 3VPKA 5AF9H 3VB7A 3GY5A 3F68H 4BAKB 5FCRA 5IDKA 2C8XB 2XYAA 3HATH 1V2QT 1KXCA 2ALVA 4B75A 3PV4A 2BD2A 1BBRE 5DJ7A 1GBLA 1C2LA 1H2PP 1H4WA 1J8AA 4NA8A 1OWKA 1QQ4A 1B5GH 1ZPBA 4NG9H 4VGCB 4DOQA 1GDUA 4Q7YA 5EW1H 1O5GH 1CHGA 1DOJA 3RXIA 4Y76A 3LU9B 1QURH 3QK1A 4ISNA 4FUJA 3MU0A 1O3BA 1C4Y2 6CHAB 2FOGA 1BMAA 1FXYA 1ORFA 4K3JA 1EAXA 3PMAB 4B2CA 4LZ4B 2HOBA 1BOQA 1BRAA 1EAWA 1AVGH 2STAE 1O5AB 3SU2A 4AYIA 4D7FA 2XW9A 1CA0C 2BLOA 2ZP0H 2R2WU 5T6DA 1MTWA 1UTPA 1TPGA 4K1SA 2TGPZ 1BDAA 8KME2 2IZ4A 2A5KA 2BB4A 2THFB 1TABE 1WTHD 1DXPA 1A3BH 1TGSZ 1GBJA 2ZCHP 1TPSA 1P3CA 2NU3E 3LH3A 1E35B 1TQ0B 1A1RA 1O2MA 2PWXA 1P8VC 3GYMA 1SGRE 1WQVH 3V7TA 1S85A 1LHGH 3ZVCA 2O8WA 3QZRA 3MOCA 1MAXA 3SW2B 1QFKH 1ZLRA 3PM3A 1G2LA 1C1RA 4I8JA 1SI5H 3GCOA 1S83A 1GBMA 1GHZA 3K6ZA 5DK1A 5C20A 2RL0A 1J16A 1Y5UT 1XUGA 2OCVB 4K1EA 5ESTE 1ZYOA 4ZXXH 9LPRA 1PPBH 1C2FA 2ZDNA 2G52A 2V35A 1QHRB 2FX6A 5EXNA 2SGEE 3ZVGA 2ANYA 1AFQB 1C5OH 2EI6A 2HVXA 1TWXB 4NCYA 3ZV8A 2F9VA 3L6PA 3ELAH 2FESH 3C1KA 1QJ6B 5C1XA 2CG7A 4Y7AA 3RUOA 1JRTA 2RKZA 1ESAA 2TGDA 3KZJA 1SL3A 3CP7A 4KTCA 1MMJN 2RKYA 1YPHC 2EC9H 2PLXA 3RXEA 2P94A 3NCLA 1GHBG 4B76A 1ZTLA 1TX8A 1BTPA 3QLPH 1D3PB 3W95A 1O2YA 1ZPCA 2RG3A 2GP9B 1LVMA 3MNXA 1ZMLA 1DLEA 3SUGA 5HGGA 7LPRA 2YNAA 1LMWB 4O97A 2BVRH 1GBTA 1RXPA 1JWTA 2R0LA 1OWEA 2A1DB 4NA7A 1MD8A 3RXLA 4B2AA 1VZQH 2RLPA 1H2QP 2ZGCA 2KRIA 2QV1A 2O8MA 1B7XB 1TBZH 2D26C 2KMSA 3GY3A 1FMGA 4KTUA 1EZSC 1TLDA 2GTBA 2H5DA 4X8SH 1UK2A 2YRAA 1FY1A 2W7UA 3PWBA 2GCHF 1EPTA 3L89M 1TX7A 1JXPA 1NESE 1RGQA 5A09A 2SNWA 2AIQA 5DP7A 4SGAE 3Q3XA 3HK6B 4ABGA 6GCHG 1ZMNA 1F0TA 2A0QB 5FPSA 3GOVA 1N8OB 1O2KA 1SMFE 3S7HB 4BXSA 4KP0A 1O3IA 2Z9JA 8GCHF 4TYDA 1MBMA 3SJOA 1TGBA 1V2WT 2ZPRA 3OEDC 1SOZA 1CT0E 5C1YA 2QY0A 4D9QA 1IQGA 1O3JA 1YCPH 3RC6A 3MU8A 1Y3WA 1GGDC 2ZHQH 3S9AA 3ERBA 3QUMP 2R2MB 1UK3A 2HRVA 1GBHA 1AE8H 1IQNA 1DWCH 1IQFA 1ACBE 1YPEH 3M3VA 3IWMA 1AB9B 3A88A 4H42U 4BTIB 2UUYA 4ZKRU 2ANKH 2BQWB 2DE8A 3SGQE 3BTQE 3P95A 4BANB 1O2SA 5E0HA 3LGUA 1GVLA 4CBNA 3UOUA 4MUCA 1AUJA 3U1IB 5EG4A 5EPNA 3GCTG 1A3EH 2F9PA 4E7NA 2Y7ZA 1ANDA 3TNTA 1TBRH 1YLDA 1S84A 4B2RA 1QBVH 1N1LA 5E2OA 3RXMA 1GI5A 4ASHA 3RMOH 5TCAA 1THRH 4ISOA 2FTMA 1ETRH 4ZH8A 1P06A 2HNTE 2G4UA 1TPNA 2I6SA 1NFYA 1O2JA 4FUHA 5C5NA 4MVNA 2J4IA 1FLEE 3KN2A 4FUBA 1K1MA 1A7SA 1TA2A 1GHAG 1TGTA 3AAVA 4JZEH 1BRCE 1T8MA 1MD7A 4GAWA 3S9BA 1VJAU 2H9HA 5J4SA 2P8OB 4I7YH 3M7UA 1K1OA 2FX4A 1AU8A 5HM2A 1G4GA 2GZ7A 2R0KA 3RXOA 1DM4B 1GHVH 1SLVB 3R62A 1Y5AT 3LGVA 1FZZA 1NRNH 4I31A 1GDQA 5T6FA 3BTTE 2UWNA 1AD8H 1N6YA 1ARCA 2V6NA 3BV9B 1W12U 3TJNA 3SZNA 1AVXA 2FMJA 2CKUA 4TWYA 4X2YA 3MHWU 3TPIZ 3D49H 4GUXA 1HBTH 1IOEA 3GDVA 2QA9E 4A1TA 1P9UA 2BLWA 3S69A 2BLVA 5EPYA 1DFPA 3PO1B 4VGCC 3H5CB 3MH4A 1XM1A 1TPOA 5A8XA 3VB4A 5GCHF 1GKNA 4F4OC 4KTSA 1HLTH 2B0FA 2CG6A 1XUFA 4IGDA 1A46H 4D8NA 4ESTE 3VFEA 6CHAC 3PROA 2VINA 1SGFG 1NFUA 1FN6A 2PUXB 3KNXA 3AVZA 2V8EA 1O31A 1JIMA 1FI8A 1TQ7B 1J15A 1TPPA 1O2VA 1QGFA 1GG6B 4CRGA 4FU9A 2ERJA 1TGCA 2ZTYA 2ZZUH 5JBBS 3SU1A 1JIRA 2AGEX 1QR3E 5GWZA 4DIIH 1AO5A 4NIYA 3GY2A 3IX0A 1Z8JB 3AASA 5JDUB 1O2UA 1PPEE 3U8TH 5HYUB 1TNIA 1EX3A 1LKBA 3TVJB 1NC6A 1YKTA 4LOYH
chains in the Genus database with same CATH superfamily
4GCHF 4IMQA 1EZQA 4K69A 1TNJA 1E34B 1NO9H 3NXPA 3A80A 2Y8SA 1H8IH 2CJIA 2XWJI 2YMSC 3Q00A 4ABFA 2FO9A 1C2MA 1NU7B 1EASA 4MPVA 1DX5M 4Y8ZA 4JCNA 2W81A 3SN8A 2RFKC 1O2ZA 5FXLA 2A31A 1W7GH 2FZZA 3RM2H 3LJJA 4YM9A 1MZDA 1Y3XA 4CRBA 3LGIA 4JHSA 2FP7B 1GCDA 1DLKB 1BB0B 1HIAA 1AFQC 2WPDD 2ZFFH 1RIWB 3TNSA 2Z9LA 1O5EH 3ATMA 2HPQH 1O2QA 1V2TT 4BXWA 3TH2H 5FBIA 2A5IA 1OJYA 2Z3DA 1BCUH 1F92A 2KCYA 3UQOA 3NFPI 4BAOB 1JBUH 2AMQA 3ZLDA 4DGJA 3SNDA 1D3TB 4CHAB 3MNSA 1BJVA 3ZD1A 2FI3E 3U98H 5DO4H 1C1OA 2FPZA 1GI8B 1YY3A 3MH5A 3VXEH 1HJ8A 1PQ7A 1O3GA 4OS4A 1L1JA 4IC5A 4X6NA 2WPIS 4Y11E 3A89A 4Q80A 2VIOA 4JK6A 2BVSH 4ZUHA 4A1XA 1C1UH 5A0BA 3V0XA 2BZ6H 3NRLA 2XWBI 1P04A 1GBBA 1UO6A 2JH5D 2UUJB 1NY22 2AERH 1LHDH 4ISIH 1Y8TA 1ELGA 1OK9A 5CHBA 3MH7A 3MQLA 3EQ0H 3F6KA 4Q4LA 1C5XB 1CSOE 2QE7D 3T62A 3LKWA 4ABHA 4YOGA 3A8BA 1A5GH 1C4U2 1KXFA 5C94A 2F9NA 2H5CA 1N8OC 2KAIB 1B0EA 2HGTH 4I8GA 3URDA 4E05H 2ULLA 4N7EA 4F49A 3LGWA 5JB8S 1QBNA 2BD7A 2ZYCA 5SGAE 1G36A 2XQWC 1PPFE 1EJNA 1GMHG 4X0WU 5EIYA 1GPZA 3VB5A 1QGBA 2FXRA 1EJAA 1O33A 4B2BA 2V0BA 1F7ZA 1V2KT 1H9LB 1C5QA 2XRBA 2C8WB 3BG8A 3OY5U 2TRMA 2O8UA 3A87A 1ZSKA 4WMFA 1HAPH 3KF2A 3MI4A 4E7RG 2Z7FE 3P70B 1O3EA 2ZU4A 4MNWA 1OP0A 2IN2A 1GI0A 1WDIA 1K1LA 2CF8H 5I0QB 1EZUC 1AB9C 1BHXB 4ZKNU 4A6LA 3BSQA 4APLA 4WVPE 1XXFA 1AGJA 2G5VA 4M7GA 2WPJS 4FU8A 5HM9A 1FY8E 2HNTF 4NSYA 1O38A 1AZZA 1UVPA 3SI4H 2AFQB 1ELBA 3JZ2B 3MO6A 1F2SE 3TU7H 3VB3A 4AG1A 3E0NB 4B6EA 3BTEE 1HUTH 1ZHMA 1K22H 8LPRA 2BHGA 2UWPA 5AHGH 2XRCA 1GJ7B 2VH0A 3GICB 4IW4E 2XBXA 1C2GA 3SW0X 3BG4B 4WXVA 1O3FA 1K1JA 1PPCE 2FS8A 1FN8A 1EP6A 3OSYA 3OY6U 1UTLM 1TA6A 1WOFA 1GL1A 1CVWH 3UUZA 1GHYH 1YM0A 4JZIA 5CHAB 3KYGA 2AGIX 3FN8A 1T32A 1MU8B 2RA0A 1HAXB 3RDZA 1UCYK 1A61H 4O03A 2V3HH 1Z6EA 1O0DH 3BEFB 5FX5A 1GI3A 1YCPK 5LGOA 2QN5T 2XTTB 4Z6AH 3TVJA 1ZJDA 3EA9A 1VITH 2EEKA 3BTKE 1PPZA 3EJHA 2GDEH 1V2NT 2SGFE 5FBEA 1E37B 1E1RD 1PQ8A 2ZKSA 3UNRA 4QT8C 2FLBH 2GGVB 3M5LA 3V12A 1QRZA 3BIVH 2BZMA 3GY4A 1ZRKA 2ZWLH 3A7ZA 1O5FH 3PMJA 3RXFA 4K12A 1H03P 2P95A 1WV7H 3TLOA 1EXFA 1EAUA 4ZHAA 1HAGE 1TPMA 1MTVA 2W3IA 1J14A 3QGJA 2FM2A 3PO1C 4YT6H 1H8HD 5DP9A 3DD2H 4INLA 1D6WA 5EQQA 1G3BA 1EKBB 1P0SH 1TIOA 4CH2B 3SJKA 2VB0A 1O5CB 5C1UA 2Y5GA 3ZLEA 2ZPQA 1TNLA 1O32A 2WZQA 4FUEA 3FZDA 1FV9A 1BMLA 3A84A 4WJG2 3GCTF 1NM6A 3LC3A 2HALA 4WH8A 1TB6H 2FOEA 1P12E 2VIDA 1HAOH 1S0QA 5EGMA 1XX9A 1C4V2 2KFWA 4AN7A 1YWUA 2B5TB 3ZYDA 1GG6C 2G5NA 1DANH 4ISHH 1K0HA 2YMSD 1KDQB 2AMDA 4X1NU 1F5KU 2C8ZB 4BTTB 1ZOMA 1K2I1 4LOTA 1NRPH 2BX3A 1K9OE 2Z94A 1SLWB 1XUKA 1TOMH 1UVOA 2BMGB 4ABIA 5T3HA 1H9IE 4PZ5A 2L6OA 2A55A 3RXPA 4TWWA 3WW7A 4B6FA 1RTKA 2BDCA 7GCHF 4DJZB 4AYVB 3F9GA 1Y59T 3RC5A 2BY7X 1QTFA 1OK2A 1QB9A 4IBLH 2ZHFH 2Z9GA 1QL8A 3BEIB 4ZH1D 2AMPA 3ESTA 2VVUA 4DT4A 1E0FD 1GCTB 3PMBB 3UWIA 3TJOA 1YC0A 1O2PA 5TJXA 1HAVB 3SV2H 4O9VA 3KIDU 4TY7A 2ANMH 3NKKA 1HPGA 2BVXH 4UDWH 3UIRA 1E5GA 3I77A 1D3QB 4AOQA 5I25A 4Y8YA 2ZECA 4GHQA 1ELCA 5AVDA 2O9QA 2W80A 4JZDH 5HIYA 2ZFPH 5PTPA 4NIWA 1UTOA 2ZDMA 1Z8GA 2ODQA 4P00A 2KAIA 3ZVEA 4IMZA 1ANCA 1RIWC 1YPGH 2ASUB 2EHFA 1HB0B 3BTDE 3UAIC 2ZHDA 1NN6A 3SUDA 1W7XH 1SHHB 2D2DA 3MTYA 2XBWA 3UNQA 2FOHA 1Z7KA 1NFXA 4FETA 1O3KA 4RT1A 4Y10E 1DUAA 4DVAU 4CHAC 2A4RA 3TH4H 1NT1A 4HG6A 2A4GA 2TGAA 5FAHA 1ZGIA 3D62A 1GHXH 3FGTA 1BTUA 1O3DA 2F9UA 1V2VT 2P3TB 4FUDA 3M5OA 4GVUA 4X2VA 4ZMAH 4A7IB 3UPEA 5DG6A 2UWOA 5E8EH 1KLTA 2FOAA 1AE5A 3FZZA 3LJOA 1HAIH 2JETB 1BTZA 3T27A 3RC4A 1BIOA 3TK9A 3WWBA 4X1SU 3K3TA 2ZGBH 4OS7A 4I8KA 2J98B 1G9IE 3MNBA 4OS1A 2WUCA 1AVWA 1TMTH 3UQVA 2QAAA 1RS0A 3GISB 2SGPE 4LXBH 2B5ID 1AUTC 3P8OA 1ZMJA 3ATWA 1GJBB 1J17T 1BMNH 1QBOA 2QC2A 2VIPA 2QXHA 3MMGA 4UE7H 2ZU2A 1G30B 2Y7XA 1SRZA 3N7EA 3DHKH 2O8TA 2QF4A 4BTUB 1HGTH 1OK3A 1OWJA 3SOSA 4FU7A 1NRQH 3F0OA 1HAHH 2ZHEH 5C67A 5A2MH 1OWIA 2W5EA 1OOKB 3SV9A 1H04P 5H4IB 2ZC9H 5BPEA 3GDUA 4YNXA 1QZ8A 1GBKA 2ZFQH 1TRNA 1QRXA 2J9NA 1L1GA 4XBBA 1HAZB 3QTOH 1NRSH 2OQ5A 4OGYA 3A7TA 4YOIA 1RJXB 5G4BA 5EQSA 1D4PB 2QF5A 2PHBA 1LVBA 1OWDA 4HFPB 1CT4E 2W6JD 5JBTA 3BTGE 4GLYA 3EYDA 2PP6A 2PKSB 3T25A 1NBME 3SQEE 2XNIA 3ODFA 1ID5H 1G3DA 1ZRBA 1YF4A 3LONA 4X6PA 1LCYA 3QGNB 3N7OA 2QXIA 1WTGH 1UCYH 1SBWA 4H6SB 3GYLB 4I86A 4FUFA 1ARBA 1C2EA 1ZHRA 1O37A 1W3CA 3VGCB 1PYTD 2VIWA 3SORA 2GCTB 3OX7U 3HKIB 2DE9A 5F53A 3CS0A 1EOJA 4ACAA 1AFEH 4FOUC 1P2KA 2BDIA 3DFLA 1DICA 1GVKB 1GI9B 2CXVA 4DCDA 1LQEA 3E1XB 3SHAH 2KCPA 1Y5BT 5EJLA 1Z92B 2BY5X 5DGJA 1T8OA 5HKKD 1C5PA 1W11U 1O5DH 1XXDA 4NZLA 3F3BA 2OC0A 4K8YA 2F4LA 1LHFH 4ONTD 2NU4E 3BG4C 1AWFH 2PKAB 4ISLA 3O8RA 1AIXH 3DA9B 3ZD2A 2VWOA 3URCA 5CHAC 1KDQA 1C5VA 1QJ7B 3SGBE 1P11E 2Z9KA 1W0JD 2UWLA 1SR5C 2ALPA 3RXJA 1IQEA 1LDTT 1QB6A 3I29A 3MWIU 1HCCA 1MKXH 1ABJH 1CA8B 2Y80A 4NIXA 1O3HA 3M61U 1S81A 4YLQH 1XUJA 1SGPE 2J95A 3FP8E 1Z8RA 2AHME 2XC0A 4UD9H 1MU6B 2WV4A 1O34A 4Q7XA 1MBQA 4ZCNA 2FYRA 2RDEA 3F9FA 2K8IA 3F2GA 1GMCF 1L0ZA 4DURA 4BAQB 5FPTA 1OWHA 4HGCA 4OM9A 1FAXA 3SNAA 4DT7B 2ZO3H 4NWKA 2G8TA 5TCCA 2Z3CA 2WSSD 2OTVA 4Q7ZA 4U30A 4UFDH 1OYTH 1VITG 2GZ8A 3TGJE 4K8BA 2W7SA 4KGAA 1E38B 3SU3A 2F83A 3STJA 1OS8A 4BAMB 3TITA 2HLCA 3M3TA 1UVSH 2BDHA 1MTNB 1P9SA 1SLUB 3GY8A 1ETTH 4FVBA 1COWD 2OLGA 3GS9A 1GJ8B 3T28A 2JRAA 1UTJA 4NWLA 1VKYA 2Q1JA 2V7QD 4WMEA 1F0UA 2ZEBA 5FO8C 2A5AA 3RXSA 3IU3I 1NZQH 2A4QA 1SGQE 1P2JA 2QCYA 1PPQA 3B9FH 1E88A 1KTSB 1D6RA 5C0UA 1QL7A 1AZ8A 2G51A 4OGXA 1ZHPA 5DP3A 4ZHMU 1QB1A 2CN0H 1N6XA 3TH3H 2FS9A 1UJ1A 3DSPA 3V13A 1MCTA 4JK5A 3SV6A 4INKA 2FOCA 3M3SA 5E0GA 5FX6A 2XWBF 1GI2A 4TPIZ 3T26A 1C9TA 3KQCA 4AGJA 5HZPB 1MTSA 5EQRA 2ZU5A 3HGNA 2J98A 4X6OA 2BD9A 2OBOA 1L4DA 1KY9A 2QGRA 1F5LA 1KXAA 1SKYE 3RU4T 1E79D 2FIRH 4Y7BA 1U5MA 3ZVAA 1GCTC 2JH6D 4B74A 3UREA 1QIXB 1UTNA 2ZU1A 3M7QA 4ZHLU 2GVFA 1G32B 2BD4A 1O3CA 3SNCA 1BZXE 3PLPA 3BTHE 1L2EA 4D76A 4OS2A 1NRRH 1W14U 3SUFA 1TE0A 5E0JA 1YLCA 3SJIA 2QIQA 3MU4A 1QO6A 1OHHD 1YPKH 4JYUH 2LOJA 4C16A 3LGYA 1PJPA 3U69H 4ABBA 1W10U 1TNGA 5KGOA 1P2MA 1SSXA 3DUXH 2ZPSA 3KCGH 1K28D 1KSNA 1W0KD 1XKBC 3KQEA 3L3TA 3FP6E 3M5NA 2F3CE 2B9LA 2Y5HA 2YOLA 1AWHB 3Q77A 1TMUH 2BQ7B 1IQLA 2GV7A 3AAUA 2ESTE 2FOMB 2ODYB 1DXWA 1EQ9A 5KEDA 1MABB 2OD3B 2OC7A 2PTNA 3DSOA 3RU4E 1DE7H 3CNRA 1QA7A 4NSVA 3ZRZA 2SGAA 4AGKA 2WIIC 1TRYA 1TPAE 1MH0A 1ZGVA 1GBAA 1DS2E 2F9OA 1SS2A 1TNKA 3A82A 4YESB 3C27B 3ZV9A 2H6MA 1TALA 2BDAA 1EFRD 3LT3A 1GI7B 4A1VA 3ODDA 1IHSH 5HYTB 1CT2E 2MCYA 4HTCH 4K5ZA 1A2CH 2GCHG 3FP7E 4NGAH 3A7XA 4AX9H 1NFWA 4H6TA 1O3OA 1SPJA 1IQJA 3INBC 2H9EH 1C5SA 3ATKA 4B73A 3ZZDA 1LTOA 1T4UH 4P02A 1CE5A 1PQ5A 4LK4A 2ZDKA 8GCHG 2OINA 1RTFB 3M35A 3SNEA 1NWVA 3SZEA 4JZ1A 1TGNA 3UOPA 4BAHB 4AYEA 5L2YH 1B0FA 2EQNA 1O3AA 1LO6A 1F5RA 3RXDA 1GL0E 2J38A 4YTAA 2A4OA 3LH1A 2PW8H 3ATLA 1UTMA 1GHQB 5F8XA 1UMAH 2WYGA 1CO7E 3PV2A 1K21H 2FLRH 3SV8A 2BY8X 3E0PB 4JYTA 5T6GA 4B71A 2SNVA 5GDSH 1U6QA 1TYNA 1UK4A 2PKSC 4XRNA 1SGNE 3RXVA 1SQRA 5DSFA 1DWEH 1WBGB 3MU5A 1ELFA 4K1TA 4RKJB 2BLQA 5EODA 1H9HE 2ZQ2A 3U8OH 1KXDA 1SQAA 2FEQH 3VGCC 2GCTC 2C93B 1DSUA 3NPSA 1LY2A 4FXGH 4GPGA 2G00A 4J38B 7KMEH 2BD8A 1GHBF 2KR7A 3HK3B 1XUHA 1C2IA 4YZUA 2CHAB 4MTBA 1WUNH 1V3XA 3RXRA 3S0NA 2PR3A 2IOTA 3NK8A 1FAKH 1TBQH 1TOCB 2ZDLA 1ZZZA 5DP5A 1G37A 4XSKU 2AGGX 1A0HB 1ZSLA 3RXHA 3TJUA 3PWCA 4Q2KA 4NZQA 2GDDA 2PTCE 3KQ5A 3OXUD 3SJ8A 2Z3EA 2UUKB 2I2LA 1RTLA 1V2UT 1NS3A 1XKAC 3LOXA 3EAJA 3SYJA 4AZ2B 4WXIA 1AMHA 3GCNA 1V2OT 2FOFA 3L33A 2WINI 2JH0D 1PYTC 2XXLA 2OP9A 2ZDVH 4D7GA 3LDXH 1PQAA 2WUBA 2FWWA 1L1NA 4Q63A 3G01A 5IYTA 4ACBA 6GCHF 1KIGH 1S5SA 1O9AA 3VB6A 1GMDG 5GIBA 3KHVA 3P8NA 2TGTA 3OE7D 1BUIA 1M9UA 3PLBA 3UR9A 2P8OC 5C2ZA 4X1QU 1WYKA 5GCHG 3SO3A 3N7DA 4E06H 2Y81A 1E36B 1CBWB 4K60A 2RA3A 3T2NA 2YBYA 4HI3A 1OPHB 2ZQ1A 1BBRK 3S7KB 1SGFA 4Y79A 1TAWA 2GD4B 3K2UA 1SLXB 1SGIB 1SQTA 5EW2H 1MUEB 2BDYA 3IG6B 1BT7A 2OXSA 3AW0A 5ABWA 1LPGB 5E2PA 4ABAA 1CGJE 4A5WB 4MG3A 5FPYA 5L6NH 1S6FA 1KYNA 1YBWA 2CGAA 5F8TA 1EUFA 1MTNC 4ZKSU 2XC4A 4UFFH 1HRTH 1EPTB 1NTPA 1O2LA 3KQDA 3Q76A 1ZPZA 1AY6H 1TFXA 1FONA 2DUCA 4FUIA 5HXFA 3GOVB 1SQOA 1CGHA 2WV5A 2KM0A 1HCGA 1HXFH 1GVZA 3RLYH 2BY9X 3QWCH 1O5BB 1EZXC 3DFJA 3P6ZB 4B2SA 1V2ST 4GCHG 1OJWA 1MKXK 3NWUA 1O3MA 3EA7A 4XBCA 1ANEA 3GY6A 3DCLA 4D9RA 1HV7A 1LVYA 1O2IA 1DWBH 1T4VH 2QY0B 3ZVBA 4AORA 4DIHH 5GXPA 1KLIH 1XUIA 1HFIA 2JJ1D 3ZZ5A 3KXVA 3UTUH 1UCYE 6ESTA 1BTYA 2FOBA 3FO8D 3F6UH 1GI1A 4X8VH 3GCHB 3Q3KA 2P16A 3A7YA 2VVCA 1BITA 1EOLA 1OXGA 2OQUA 1GHAF 4AFZA 3V3MA 3T29A 4FUCA 4UONA 3M7PA 3HGPA 4AB8A 3SU0A 2PUQH 2ZF0H 4Z1MD 1GBDA 3SQHE 1QUBA 2RDLA 5LPFA 2BTCE 3UNSA 1V2JT 1PFXC 4THNH 3OEED 1HFDA 2A7JA 3W1EA 1BMFD 2GZ9A 3Q3YA 2WYJA 1P09A 3SU5A 1DY8A 3D65E 1VITF 1SVPA 2KCAA 3OYPA 3ZZ6A 1VVDA 1NBMD 2H2ZA 1AI8H 3PV5A 1QJ1B 2VU8E 1WSSH 1G3CA 1WQSA 3ZYEA 1V2MT 1FY4A 1OKXA 3MQKC 4DW2U 4ZAEA 3A8DA 1T8NA 1C1TA 1SOTA 1X7AC 1P02A 1QA0A 2ZCLP 4I32A 1A5HA 1EAIA 1LHCH 3I78A 1CHOG 4H4FA 1S6LA 4DY7B 1C2HA 1UOTP 2CV3A 2XC5A 2AEIH 1C5UA 1HJAB 1PPGE 2Z6BD 4MPUA 3M36A 3PTNA 1HFHA 3T5OA 1BTHH 1K1NA 2QF0A 2ZHWH 1AKSB 5GNDA 3KYFA 4CRFA 4AFUA 3A83A 1W2KH 2PGQB 1Y3VA 4XDEA 3EE7A 1T8LA 2VIQA 4BNRA 2G4TA 3MO9A 3HPTB 4MNXA 1PPHE 4ZXYH 2KZ4A 3LC5A 3P17H 1VJ9U 4I8LA 4X8TH 2ZA5A 1EB2A 1DITH 1V6DA 4GSOA 1OK1A 2JGWA 3MU1A 9ESTA 5JB9S 1O2TA 4CRAA 3QTVH 3A8AA 1P10A 2PSXA 4CRDA 5C0TA 1VVCA 1O2NA 1FY3A 4CSYA 2ZGHA 1RD3B 3MFJA 4IC6A 4UFGH 1P57B 1EP5A 2GT7A 3RLWH 3QN7A 2ZG0H 1SB1H 1RRKA 3ZZ9A 4I33A 1IQKA 1RFNA 1V2RT 1EATA 2A2QH 6LPRA 3KL6A 1SGYE 4DG4A 3AW1A 1OX1A 2H1UA 1WU1A 5DP8A 1UHBB 1C1QA 3BEUA 3ZZ7A 4TPYA 5HYPA 4X1PU 1YYY1 2ZU3A 1BRBE 2PV9B 3UFAA 1C5NH 3U9AH 2VVVA 3MYWA 4CREA 1JRSA 2ZDAH 3F1SB 1GHWH 1GBFA 1O3NA 3CENA 5LH8A 1T7CA 1BA8B 2SGDE 2BZAA 1ANBA 1IQHA 2BXTH 5B6LA 2AH4X 1ESTA 2JGXA 1Q2WA 3T5FH 2J94A 2HLDD 3TK6A 1S0RA 1HJ9A 1LPKB 2GMTB 2VWMA 2R3UA 4RKOB 3RXUA 1P3EA 2EI8A 2FI4E 2NU0E 1SGDE 3S9CA 4X2XA 1GI6A 2R3YA 4FUGA 2WPKS 1GWAA 2XCFA 3GY7A 1CGIE 2QYIA 2EI7A 2WPHS 1HAYB 2TIOA 1LKAA 1DUEA 3RJ3D 5GPIB 1CKLA 4F55A 2AIPA 2CHAC 1ELAA 1FNIA 1C5ZB 2NU1E 2ZTZA 2J2UA 1ELDE 2TPIZ 3M37A 5L30H 1O2RA 1W0ZU 1DSTA 3F9EA 4AYMA 2NU2E 2FODA 4LZ1H 2G7IA 3EDXB 1HIAB 1BBRH 1SHYA 1LPZB 1ZR0A 5F03A 1YPMH 2QXJA 1KXEA 1CQQA 4GHTA 4U01A 2Y8RA 1XVMA 4OS5A 3PMHB 4FXGG 2VNTA 2Y82A 3KGPA 1C9PA 1Y3UA 2ZGXH 2JKHA 1QL9A 2V3MA 5JPMH 1HNEE 2ZFRH 3ENSB 3RXBA 2Q6FA 5J4QA 2FTLE 4AB9A 5EXMA 1MCVA 4Y0ZE 4ABJA 1EJMA 1C1WH 5HMAA 5FCKA 4Y0YE 3SGAE 1V2PT 2VWNA 3E6PH 2R9PA 3TGIE 2GT8A 1GJ9B 4JMYA 2A45B 5LPRA 4CH8B 4NIVA 2O39C 4RN6A 3OTJE 4YXWD 1GJAB 1O3LA 2EA3A 2XBVA 3KQBA 4UFEH 5C3NA 1A0JA 5DN6D 1A4WH 3OEHD 2VGCB 1Z71A 4HZHA 1BHXF 1SFQB 1TRMA 2ZCKP 1CBWC 3NUMA 3K6YA 3RXQA 3OU0A 1FBRA 4YT7H 2M5TA 4DJZA 2VIVA 1GMHF 4ABDA 5F6MA 2OUAA 1UTQA 3PLKA 3B23B 1VCWA 3RMMH 2G55A 2BY6X 3MNCA 1VGCB 2W26A 1O30A 1HAVA 3BN9A 3RU4D 3SHCH 1P01A 3AK5A 1DWDH 4NA9H 2WV9A 2XRDA 1IQIA 1F0SA 1EPTC 4R8TB 4O3TA 1UVUH 1V2LT 1VR1H 1OJVA 4JYVH 2IJD1 3SU6A 3ZZ8A 1MTUA 1C1SA 1MQ5A 2XOKD 1YP9A 1YLNA 1KXBA 1QY6A 3VWOA 2TBSA 1K1IA 3EA8A 3QZQA 1WXRA 3O8CA 4AYDA 1BTWA 1FDPA 2WPMS 2A7HA 1C2KA 1BJUA 4K2YA 2BDGA 5CMXH 4ASUD 5A8ZA 4XD7D 5K7RA 7GCHG 1S82A 1AKSA 3CI0J 4IS5A 2KCOA 1O2XA 2A7CA 1F0RA 2YNBA 1P2NA 3RMNH 2A32A 2ZGJA 3SU4A 1C5MD 1K1PA 1GJ5H 1SG8B 1FIWA 3BF6H 3QX5H 5I46H 1THPB 1H8DH 4X1RU 3RXKA 1DT2A 1QRWA 3ZZCA 3SJ9A 3UY9A 5FHTA 1DDJA 2OBQA 2AYWA 3EE0B 7ESTE 2BOKA 2XWAA 1O2WA 2D1JA 1Y3YA 3GCHC 4UEHH 3EGKH 3TK5A 3ZZAA 3DT0H 1UTKA 4ABEA 3BTFE 2F9BH 1Q3XA 2AS9A 2CMYA 2Z9IA 5KECA 1FQ3A 3JZ1B 2I6QA 8ESTE 1O36A 4U2WA 1UW7A 1GMDF 5LPEA 2ZI2H 2J97A 1C1PA 1GDNA 2ZNKH 3MH6A 1SGCA 1HDTH 2BXUH 5DPAA 1EB1H 4TY6A 3FFGA 1FPCH 1THSH 2F43B 3B8JA 3A86A 3P92A 4SGBE 2Y5FA 3ATIA 4I8HA 2GJGA 1FIZA 4YOJA 1NROH 1QCPA 4AC9A 1O2GH 3RM0H 2BX4A 3RXAA 1P05A 2V3OH 5EOKA 1OP2A 4U32A 4MQAA 1C5LH 1GJ6A 1UHBA 4A92A 5IK2D 3SNBA 1MKWK 2B8OH 2P3UB 5DP4A 2UUFB 2P3FH 1G4FA 1FPHH 2JJ2D 1HYLA 4LOSA 1H1BA 3O8DA 1W13U 1QNJA 1J9CH 1O35A 3K9XB 1HJAC 1O2OA 2J92A 3U28C 1IAUA 5GJ4B 2J5UA 4Z0KA 3WY8A 2C90B 2FDAA 2HPPH 1TONA 1CA0B 1Z1IA 3UB0A 1S6HA 1DY9A 4A5TS 1P03A 1L4ZA 4FVDA 3NZIA 1BTXA 4WWYA 2XNDD 1BQYA 2C8YB 2NWNA 1D9IA 1ZSJA 3BTME 3HKJB 3F0PA 3R3GB 3W94A 5DKMA 3RMLH 1DPOA 3A7WA 1AN1E 1IHTH 1Z6JH 3LIWA 3ZVFA 1FJSA 3SI3H 5F8ZA 2JETC 1A0LA 1SGTA 5B6OA 2BDBA 1E1QD 3CALA 4WH6A 3KEEA 1DVAH 2BOHB 1C1NA 5A0CA 3QDZB 4NFFA 3A8CA 3LPRA 5BRRE 3TGKE 2ILNA 1AQ7A 3TJVA 2Q6DA 4IN1A 1NU9A 2C4FH 2EY4C 2GKVE 1VCPA 2EC3A 3H7TA 4B1TA 4J1YA 5JBAS 1C5YB 1WCZA 3F9HA 1TMBH 2PKAA 2BYAX 3H7OA 1SFIA 1XVOA 2BD3A 3P8GA 3RP2A 3E8LA 4BWCA 3ZZ4A 1CHOF 5AFYH 5C5OA 2GX4A 1GJ4H 3A81A 4MLFB 1OSSA 2K1QA 4KELA 4CR9A 2VWLA 1C5RA 1AHTH 2STBE 3FGRA 2WHXA 3RXGA 4OS6A 4XOJA 1P2IA 1ELTA 1ESBA 2GMTC 2SGQE 1ABIH 1GBEA 2A2XH 1C5TA 1FX0B 4JZFH 3ZZ3A 2OC1A 3SV7A 1O39A 4WF8A 1MAYA 1BRUP 3OP8A 1GJDB 2Y6TA 1TX6A 5A0AE 1JOUB 5ETXA 1ETSH 1LQDB 2CF9H 1C1ZA 3FVFB 1C5WB 1HXEH 1W0YH 2XBYA 2BD5A 3E91A 2D8WA 2VJ1A 3K65B 1MZAA 2HNTC 4X2WA 3STIA 4MPWA 3A85A 5ESBA 4BOHA 4ZKOU 4YLUA 1G2MA 3ITIA 5A8YA 4KKDA 2IJOB 4X8UH 2JDID 2Q6GA 1A5IA 2PSYA 1Z8IB 1E8BA 2BM2A 1C2JA 4IN2A 1VCQA 2J34A 1T31A 1ZJKA 1P2QA 2ZTXA 4Y6DA 3VEQB 1P2OA 3MO3A 2CK3D 5CDFE 3PYHA 5JBCS 1NPMA 2W3KA 2QXGA 3SUEA 3O8EB 3UR6A 1GMCG 4CR5A 3GXEA 2BQ6B 2QF3A 5AFZH 3IITA 3BIUH 4AFQA 3GDSA 1C1MA 3QO6A 2HWLB 1H8ED 4AYYB 1YGCH 2RCEA 4XFQA 1KTTB 3RXTA 1Z1JA 1O3PB 1O2HA 1LHEH 2P93A 4MPXA 3SBKA 2PFEA 2SFAA 4ZROA 2H9TH 2VGCC 1MQ6A 3A7VA 5L2ZH 1YPHE 1ZTKA 1D3DB 4CRCA 5JPMG 1SGEE 1GGDB 3PB1E 3RXCA 2ODPA 2LNCA 3VXFH 1YPJH 2LPRA 4J2YB 4XE4A 1BMMH 1QQUA 2ZIQH 4MDSA 3F2FA 4YIZA 4AG2A 1IQMA 2P59A 3CS7A 1VGCC 1FY5A 4Y8XA 1GI4A 4Y71A 5EJZA 5K0HA 5HIZA 2VH6A 3E3TA 1GJCB 4MNVA 3P8FA 4X6MA 1TNHA 1OYQA 1WAYB 2WPLS 4INHA 3LGTA 1Q31A 1ELVA 3UWJH 1W8BH 3FANA 4WY3A 2O8LA 1XMNB 4O3UA 5DP6A 1G3EA 1FUJA 2ANWA 1C2DA 3U1JB 2ZFTA 4AFSA 3E90B 1ZTJA 5HYOA 1OP8A 3O8BA 4CBOA 1ELEE 4NFEA 3ZVDA 3BTWE 5EXLA 2GV6A 2G81E 2F91A 5DN4A 1GKGA 2HVYB 4RSPA 3TIUA 3FAOA 2IPHA 1CU1A 3M7TA 4YO9A 5EU8A 2PGBB 2XCNA 3R0FA 4WMDA 3PTBA 3ZZBA 5CE1A 2IZ3A 1GBIA 1MKWH 2C3SA 1LVOA 1YCPM 2RLQA 4XBDA 2FI5E 1GBCA 1INCA 4PROA 3U8RH 1SC8U 2FYQA 2ZFSA 3M5MA 3E16B 4MNYA 2B7DH 2OC8A 1YPLH 1JMOH 2MCZA 1KLJH 1UVTH 4R0IA 1C1VH 5FL7D 3WWFA 5JYIA 3D23A 3VPKA 5AF9H 3VB7A 3GY5A 2W6ID 3F68H 4BAKB 5FCRA 5IDKA 4RT0A 2C8XB 4PO7A 2XYAA 3HATH 2OK5A 1V2QT 1KXCA 2ALVA 4B75A 3PV4A 2BD2A 1BBRE 5DJ7A 1GBLA 1C2LA 1H2PP 1H4WA 1J8AA 4NA8A 5T1VA 1OWKA 1QQ4A 1B5GH 1ZPBA 4NG9H 4VGCB 4DOQA 1GDUA 4Q7YA 5EW1H 1O5GH 3WSYA 1CHGA 1DOJA 3RXIA 4Y76A 3FKSD 3LU9B 1QURH 3QK1A 4ISNA 4FUJA 3MU0A 1O3BA 1C4Y2 6CHAB 2FOGA 1BMAA 1FXYA 1ORFA 4K3JA 2JIZD 1EAXA 3PMAB 4B2CA 4LZ4B 2LP6A 2HOBA 1BOQA 1BRAA 1EAWA 4TT3D 1AVGH 2STAE 1O5AB 3SU2A 4AYIA 2Y8TA 4D7FA 2XW9A 1CA0C 2BLOA 2ZP0H 2R2WU 5T6DA 1MTWA 1UTPA 1TPGA 4K1SA 2TGPZ 1BDAA 8KME2 2IZ4A 2A5KA 2BB4A 2THFB 1TABE 1WTHD 1DXPA 1A3BH 1TGSZ 1GBJA 2X2ZA 2ZCHP 1TPSA 1P3CA 2NU3E 3LH3A 1E35B 1TQ0B 1A1RA 1O2MA 2PWXA 1P8VC 3GYMA 1SGRE 1WQVH 3V7TA 1S85A 1LHGH 3ZVCA 2O8WA 3QZRA 2YMSB 3MOCA 1MAXA 3SW2B 1QFKH 1ZLRA 3PM3A 1G2LA 4F48B 1C1RA 4I8JA 1SI5H 3GCOA 3OFND 3DSGA 1S83A 1GBMA 1GHZA 3NJAA 3K6ZA 5C17A 5DK1A 5C20A 2RL0A 1J16A 1Y5UT 1XUGA 2OCVB 4K1EA 5ESTE 1ZYOA 4ZXXH 9LPRA 1PPBH 1C2FA 2ZDNA 2G52A 2V35A 1QHRB 2FX6A 5EXNA 2SGEE 3ZVGA 2ANYA 1AFQB 1C5OH 1KMHB 2EI6A 2HVXA 1TWXB 4NCYA 3ZV8A 2F9VA 3L6PA 3ELAH 2FESH 3C1KA 1QJ6B 5C1XA 2CG7A 4Y7AA 3RUOA 1JRTA 2RKZA 1ESAA 2TGDA 3FOAA 3KZJA 1SL3A 3CP7A 4KTCA 1MMJN 2RKYA 1YPHC 2EC9H 2PLXA 4RI0A 3RXEA 2P94A 3NCLA 1GHBG 4B76A 1ZTLA 1TX8A 1BTPA 3QLPH 1D3PB 3W95A 1O2YA 1ZPCA 2L74A 2RG3A 2GP9B 1LVMA 3MNXA 1ZMLA 1DLEA 3SUGA 5HGGA 7LPRA 2YNAA 1LMWB 4O97A 2BVRH 1GBTA 2IPQX 1RXPA 1JWTA 2R0LA 1OWEA 2A1DB 5EJ1A 4NA7A 1MD8A 3RXLA 4B2AA 1VZQH 2RLPA 1H2QP 2ZGCA 2KRIA 2QV1A 2O8MA 1B7XB 1TBZH 2KX4A 2D26C 2KMSA 3GY3A 1FMGA 4KTUA 1EZSC 1TLDA 2GTBA 2H5DA 4X8SH 1UK2A 5DN5A 2YRAA 1FY1A 2W7UA 3PWBA 2GCHF 1EPTA 3L89M 1TX7A 1JXPA 1NESE 1RGQA 5A09A 2SNWA 2AIQA 5DP7A 4SGAE 3Q3XA 3HK6B 4ABGA 6GCHG 1ZMNA 1F0TA 2A0QB 5FPSA 3GOVA 1N8OB 1O2KA 1SMFE 3S7HB 4TSFD 4BXSA 4KP0A 1O3IA 2Z9JA 8GCHF 4TYDA 1MBMA 3SJOA 1TGBA 1V2WT 2ZPRA 3OEDC 1SOZA 1CT0E 5C1YA 2QY0A 4D9QA 1IQGA 1O3JA 1YCPH 3RC6A 3MU8A 3VG8A 1Y3WA 1GGDC 2ZHQH 3S9AA 3ERBA 3QUMP 2R2MB 1UK3A 2HRVA 3H09A 1GBHA 1AE8H 1IQNA 1DWCH 1IQFA 1ACBE 3ZIAD 1YPEH 3M3VA 3IWMA 1AB9B 3A88A 4H42U 4BTIB 2UUYA 3OTPA 4ZKRU 2ANKH 2BQWB 2DE8A 3SGQE 3BTQE 3P95A 4BANB 1O2SA 5E0HA 3LGUA 1GVLA 4CBNA 4M9FA 3UOUA 4MUCA 1AUJA 3U1IB 5EG4A 5EPNA 3GCTG 1A3EH 2F9PA 4E7NA 2Y7ZA 1ANDA 3TNTA 1TBRH 1YLDA 1S84A 4B2RA 1QBVH 1N1LA 3PRBA 5E2OA 3RXMA 1GI5A 4ASHA 3RMOH 5TCAA 1THRH 4ISOA 2FTMA 1ETRH 4ZH8A 1P06A 2HNTE 2G4UA 1TPNA 2I6SA 1NFYA 1O2JA 4FUHA 5C5NA 4MVNA 2J4IA 1FLEE 3F2HA 3KN2A 4FUBA 1K1MA 1A7SA 1TA2A 1GHAG 1TGTA 3AAVA 4JZEH 1BRCE 1T8MA 1MD7A 4GAWA 3S9BA 1VJAU 2H9HA 5J4SA 3PRDA 2P8OB 4I7YH 3M7UA 1K1OA 2FX4A 1AU8A 5HM2A 1G4GA 2GZ7A 2R0KA 3RXOA 1DM4B 1GHVH 1SLVB 3R62A 1Y5AT 3LGVA 1FZZA 1NRNH 4I31A 1GDQA 5T6FA 3BTTE 2UWNA 1AD8H 1N6YA 1ARCA 4MSLA 2V6NA 3BV9B 1W12U 3TJNA 3SZNA 1AVXA 2FMJA 2CKUA 4TWYA 4X2YA 3MHWU 3TPIZ 3D49H 4GUXA 1HBTH 1IOEA 3GDVA 2QA9E 4A1TA 1P9UA 2BLWA 3S69A 2BLVA 5EPYA 1DFPA 3PO1B 4VGCC 3H5CB 3MH4A 2M2AA 1XM1A 1TPOA 5A8XA 3VB4A 5GCHF 1GKNA 4F4OC 4KTSA 1HLTH 3N99A 2B0FA 2CG6A 1XUFA 4IGDA 1A46H 4D8NA 4ESTE 3VFEA 6CHAC 3PROA 2VINA 1SGFG 1NFUA 3WSXA 1FN6A 2PUXB 3KNXA 3AVZA 2V8EA 1O31A 1JIMA 1FI8A 2VBCA 1TQ7B 1J15A 1TPPA 1O2VA 1QGFA 1GG6B 4CRGA 4FU9A 2ERJA 1TGCA 2ZTYA 2ZZUH 5JBBS 3SU1A 1JIRA 2AGEX 1QR3E 2LELA 5GWZA 4DIIH 1AO5A 4NIYA 3GY2A 3IX0A 1Z8JB 3AASA 5JDUB 1O2UA 1PPEE 3U8TH 5HYUB 1TNIA 1EX3A 2K0QA 1RLHA 1LKBA 3TVJB 1NC6A 3OAAD 1YKTA 4LOYH
chains in the Genus database with same CATH topology
4GCHF 4IMQA 1EZQA 4K69A 1TNJA 1E34B 1NO9H 3NXPA 3A80A 1H8IH 2CJIA 2XWJI 3Q00A 4ABFA 2FO9A 1C2MA 1NU7B 1EASA 4MPVA 1DX5M 4Y8ZA 4JCNA 2W81A 3SN8A 1O2ZA 5FXLA 2A31A 1W7GH 2FZZA 3RM2H 3LJJA 4YM9A 1MZDA 1Y3XA 4CRBA 3LGIA 4JHSA 2FP7B 1GCDA 1DLKB 1BB0B 1HIAA 1AFQC 2ZFFH 1RIWB 3TNSA 2Z9LA 1O5EH 3ATMA 2HPQH 1O2QA 1V2TT 4BXWA 3TH2H 5FBIA 2A5IA 1OJYA 2Z3DA 1BCUH 1F92A 3UQOA 3NFPI 4BAOB 1JBUH 2AMQA 4DGJA 3SNDA 1D3TB 4CHAB 3MNSA 1BJVA 3ZD1A 2FI3E 3U98H 5DO4H 1C1OA 2FPZA 1GI8B 3MH5A 3VXEH 1HJ8A 1PQ7A 1O3GA 4OS4A 1L1JA 4IC5A 4X6NA 2WPIS 4Y11E 3A89A 4Q80A 2VIOA 4JK6A 2BVSH 4ZUHA 4A1XA 1C1UH 5A0BA 3V0XA 2BZ6H 2XWBI 1P04A 1GBBA 1UO6A 2JH5D 2UUJB 1NY22 2AERH 1LHDH 4ISIH 1Y8TA 1ELGA 1OK9A 3MH7A 3MQLA 3EQ0H 1C5XB 1CSOE 3T62A 3LKWA 4ABHA 4YOGA 3A8BA 1A5GH 1C4U2 1KXFA 2F9NA 2H5CA 1N8OC 2KAIB 1B0EA 2HGTH 4I8GA 3URDA 4E05H 2ULLA 4F49A 3LGWA 5JB8S 1QBNA 2BD7A 5SGAE 1G36A 2XQWC 1PPFE 1EJNA 1GMHG 4X0WU 1GPZA 3VB5A 1QGBA 2FXRA 1EJAA 1O33A 4B2BA 2V0BA 1F7ZA 1V2KT 1H9LB 1C5QA 2XRBA 2C8WB 3BG8A 3OY5U 2TRMA 2O8UA 3A87A 1ZSKA 4WMFA 1HAPH 3KF2A 3MI4A 4E7RG 2Z7FE 3P70B 1O3EA 2ZU4A 4MNWA 1OP0A 2IN2A 1GI0A 2CF8H 1K1LA 5I0QB 1EZUC 1AB9C 1BHXB 4ZKNU 4A6LA 3BSQA 4WVPE 1XXFA 1AGJA 2G5VA 4M7GA 2WPJS 4FU8A 5HM9A 1FY8E 2HNTF 4NSYA 1O38A 1AZZA 1UVPA 3SI4H 2AFQB 1ELBA 3JZ2B 3MO6A 1F2SE 3TU7H 3VB3A 4AG1A 3E0NB 3BTEE 1HUTH 1ZHMA 1K22H 8LPRA 2BHGA 2UWPA 5AHGH 2XRCA 1GJ7B 2VH0A 3GICB 4IW4E 2XBXA 1C2GA 3SW0X 3BG4B 4WXVA 1O3FA 1K1JA 1PPCE 2FS8A 1FN8A 1EP6A 3OSYA 3OY6U 1UTLM 1TA6A 1WOFA 1GL1A 1CVWH 3UUZA 1GHYH 1YM0A 4JZIA 5CHAB 2AGIX 1T32A 1MU8B 2RA0A 1HAXB 3RDZA 1UCYK 1A61H 4O03A 2V3HH 1Z6EA 1O0DH 3BEFB 5FX5A 1GI3A 1YCPK 5LGOA 2QN5T 2XTTB 4Z6AH 3TVJA 1ZJDA 3EA9A 1VITH 2EEKA 3BTKE 1PPZA 3EJHA 2GDEH 1V2NT 2SGFE 5FBEA 1E37B 1PQ8A 2ZKSA 3UNRA 4QT8C 2FLBH 2GGVB 3M5LA 3V12A 1QRZA 3BIVH 2BZMA 3GY4A 1ZRKA 2ZWLH 3A7ZA 1O5FH 3PMJA 3RXFA 4K12A 1H03P 2P95A 1WV7H 3TLOA 1EXFA 1EAUA 4ZHAA 1HAGE 1TPMA 1MTVA 2W3IA 1J14A 3QGJA 2FM2A 3PO1C 4YT6H 5DP9A 3DD2H 4INLA 1D6WA 5EQQA 1G3BA 1EKBB 1P0SH 1TIOA 4CH2B 3SJKA 2VB0A 1O5CB 5C1UA 2Y5GA 2ZPQA 1TNLA 1O32A 4FUEA 3FZDA 1FV9A 1BMLA 3A84A 4WJG2 3GCTF 1NM6A 3LC3A 2HALA 4WH8A 1TB6H 2FOEA 1P12E 2VIDA 1HAOH 1S0QA 5EGMA 1XX9A 1C4V2 4AN7A 2B5TB 3ZYDA 1GG6C 2G5NA 1DANH 4ISHH 1KDQB 2AMDA 4X1NU 1F5KU 2C8ZB 4BTTB 1ZOMA 1K2I1 4LOTA 1NRPH 2BX3A 1K9OE 2Z94A 1SLWB 1XUKA 1TOMH 1UVOA 2BMGB 4ABIA 5T3HA 1H9IE 4PZ5A 3RXPA 2A55A 4TWWA 1RTKA 2BDCA 7GCHF 4DJZB 4AYVB 3F9GA 1Y59T 3RC5A 2BY7X 1QTFA 1OK2A 1QB9A 4IBLH 2ZHFH 2Z9GA 1QL8A 3BEIB 4ZH1D 2AMPA 3ESTA 2VVUA 1E0FD 1GCTB 3PMBB 3UWIA 3TJOA 1YC0A 1O2PA 5TJXA 1HAVB 3SV2H 4O9VA 3KIDU 4TY7A 2ANMH 3NKKA 1HPGA 2BVXH 4UDWH 3UIRA 1E5GA 3I77A 1D3QB 4AOQA 5I25A 4Y8YA 2ZECA 4GHQA 1ELCA 5AVDA 2O9QA 2W80A 4JZDH 2ZFPH 5PTPA 4NIWA 1UTOA 2ZDMA 1Z8GA 2ODQA 2KAIA 3ZVEA 4IMZA 1ANCA 1RIWC 1YPGH 2ASUB 2EHFA 1HB0B 3BTDE 2ZHDA 1NN6A 3SUDA 1W7XH 1SHHB 2D2DA 3MTYA 2XBWA 3UNQA 2FOHA 1Z7KA 1NFXA 1O3KA 4Y10E 1DUAA 4DVAU 4CHAC 2A4RA 3TH4H 1NT1A 2A4GA 2TGAA 5FAHA 1ZGIA 3D62A 1GHXH 1BTUA 1O3DA 2F9UA 1V2VT 2P3TB 4FUDA 3M5OA 4GVUA 4X2VA 4ZMAH 4A7IB 3UPEA 5DG6A 2UWOA 5E8EH 1KLTA 2FOAA 1AE5A 3FZZA 3LJOA 1HAIH 2JETB 1BTZA 3T27A 3RC4A 1BIOA 3TK9A 4X1SU 2ZGBH 4OS7A 4I8KA 1G9IE 3MNBA 4OS1A 2WUCA 1AVWA 1TMTH 3UQVA 2QAAA 1RS0A 3GISB 2SGPE 4LXBH 2B5ID 1AUTC 3P8OA 1ZMJA 3ATWA 1GJBB 1J17T 1BMNH 1QBOA 2QC2A 2VIPA 2QXHA 3MMGA 4UE7H 2ZU2A 1G30B 2Y7XA 1SRZA 3DHKH 2O8TA 4BTUB 1HGTH 1OK3A 1OWJA 3SOSA 4FU7A 1NRQH 1HAHH 2ZHEH 5C67A 5A2MH 1OWIA 2W5EA 1OOKB 3SV9A 1H04P 5H4IB 2ZC9H 5BPEA 3GDUA 4YNXA 1GBKA 2ZFQH 1TRNA 1QRXA 2J9NA 1L1GA 4XBBA 1HAZB 3QTOH 1NRSH 2OQ5A 4OGYA 3A7TA 4YOIA 1RJXB 5G4BA 5EQSA 1D4PB 2PHBA 1LVBA 1OWDA 4HFPB 1CT4E 5JBTA 3BTGE 4GLYA 3EYDA 2PKSB 3T25A 3SQEE 2XNIA 3ODFA 1ID5H 1G3DA 1ZRBA 1YF4A 3LONA 4X6PA 1LCYA 3QGNB 3N7OA 2QXIA 1WTGH 1UCYH 1SBWA 4H6SB 3GYLB 4FUFA 1ARBA 1C2EA 1ZHRA 1O37A 1W3CA 3VGCB 1PYTD 2VIWA 3SORA 2GCTB 3OX7U 3HKIB 2DE9A 3CS0A 1EOJA 1AFEH 1P2KA 2BDIA 3DFLA 1DICA 1GVKB 1GI9B 2CXVA 4DCDA 1LQEA 3E1XB 3SHAH 1Y5BT 1Z92B 2BY5X 5DGJA 1T8OA 1C5PA 1W11U 1O5DH 1XXDA 4NZLA 2OC0A 4K8YA 1LHFH 4ONTD 2NU4E 3BG4C 1AWFH 2PKAB 4ISLA 3O8RA 1AIXH 3DA9B 3ZD2A 2VWOA 3URCA 5CHAC 1KDQA 1C5VA 1QJ7B 3SGBE 1P11E 2Z9KA 2UWLA 1SR5C 2ALPA 3RXJA 1IQEA 1LDTT 1QB6A 3I29A 3MWIU 1HCCA 1MKXH 1ABJH 1CA8B 2Y80A 4NIXA 1O3HA 3M61U 1S81A 4YLQH 1XUJA 1SGPE 2J95A 3FP8E 1Z8RA 2XC0A 4UD9H 1MU6B 2WV4A 1O34A 4Q7XA 1MBQA 2FYRA 3F9FA 1GMCF 1L0ZA 4DURA 4BAQB 5FPTA 1OWHA 4HGCA 1FAXA 3SNAA 4DT7B 2ZO3H 4NWKA 2G8TA 5TCCA 2Z3CA 2OTVA 4Q7ZA 4U30A 4UFDH 1OYTH 1VITG 2GZ8A 3TGJE 4K8BA 2W7SA 4KGAA 1E38B 3SU3A 2F83A 3STJA 1OS8A 4BAMB 3TITA 2HLCA 3M3TA 1UVSH 2BDHA 1MTNB 1P9SA 1SLUB 3GY8A 1ETTH 4FVBA 2OLGA 1GJ8B 3T28A 2JRAA 1UTJA 4NWLA 2Q1JA 4WMEA 1F0UA 2ZEBA 5FO8C 2A5AA 3RXSA 3IU3I 1NZQH 2A4QA 1SGQE 1P2JA 2QCYA 1PPQA 3B9FH 1E88A 1KTSB 1D6RA 1QL7A 1AZ8A 2G51A 4OGXA 1ZHPA 5DP3A 4ZHMU 1QB1A 2CN0H 1N6XA 3TH3H 2FS9A 1UJ1A 3V13A 1MCTA 4JK5A 3SV6A 4INKA 2FOCA 3M3SA 5E0GA 5FX6A 2XWBF 1GI2A 4TPIZ 3T26A 1C9TA 3KQCA 4AGJA 5HZPB 1MTSA 5EQRA 2ZU5A 3HGNA 4X6OA 2BD9A 2OBOA 1L4DA 1KY9A 2QGRA 1F5LA 1KXAA 3RU4T 2FIRH 4Y7BA 1U5MA 3ZVAA 1GCTC 2JH6D 4B74A 3UREA 1QIXB 1UTNA 2ZU1A 3M7QA 4ZHLU 2GVFA 1G32B 2BD4A 1O3CA 3SNCA 1BZXE 3PLPA 3BTHE 1L2EA 4D76A 4OS2A 1NRRH 1W14U 3SUFA 1TE0A 5E0JA 1YLCA 3SJIA 2QIQA 3MU4A 1QO6A 1YPKH 4JYUH 2LOJA 4C16A 3LGYA 1PJPA 3U69H 4ABBA 1W10U 1TNGA 1P2MA 1SSXA 3DUXH 2ZPSA 3KCGH 1K28D 1KSNA 1XKBC 3KQEA 3L3TA 3FP6E 3M5NA 2F3CE 2B9LA 2Y5HA 2YOLA 1AWHB 3Q77A 1TMUH 2BQ7B 1IQLA 2GV7A 3AAUA 2ESTE 2FOMB 2ODYB 1DXWA 1EQ9A 2OD3B 2OC7A 2PTNA 3RU4E 1DE7H 1QA7A 4NSVA 3ZRZA 2SGAA 4AGKA 2WIIC 1TRYA 1TPAE 1MH0A 1ZGVA 1GBAA 1DS2E 2F9OA 1SS2A 1TNKA 3A82A 4YESB 3C27B 3ZV9A 2H6MA 1TALA 2BDAA 3LT3A 1GI7B 4A1VA 3ODDA 1IHSH 5HYTB 1CT2E 2MCYA 4HTCH 4K5ZA 1A2CH 2GCHG 3FP7E 4NGAH 3A7XA 4AX9H 1NFWA 4H6TA 1O3OA 1SPJA 1IQJA 3INBC