1GPZA

The crystal structure of the zymogen catalytic domain of complement protease c1r
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
396
structure length
368
Chain Sequence
IKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQQIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGIAHDLRFVRLPVANPQACENSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Zymogen Catalytic Domain of Complement Protease C1R Reveals that a Disruptive Mechanical Stress is Required to Trigger Activation of the C1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords COMPLEMENT C1R COMPONENT
total genus 76
structure length 368
sequence length 396
chains with identical sequence B
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2001-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1gpzA04
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gpzA02
1S0RA 1G3BA 4XE4A 2HALA 4YOIA 2BHGA 1C5WB 3ATLA 2FOHA 5ETXA 3GDVA 1IQMA 1WU1A 1E36B 4QT8C 1TRNA 3LU9B 4ABEA 2WPMS 3PWBA 1EOJA 1GBJA 2FOMB 3BTHE 4H6SB 1XUKA 4FUHA 1INCA 4BAOB 5C5NA 5E0JA 1TMUH 1GVKB 1LHEH 2UWNA 3D65E 1DY9A 5C1XA 3KZJA 1FV9A 1Z92B 1GJ9B 3M5NA 4A1XA 3UIRA 3BTME 1PQAA 2BD3A 4ZMAH 4LOYH 3F68H 1Q2WA 4X1PU 1SS2A 1K1MA 1ZHRA 4XFQA 1DWDH 1K21H 2A1DB 1IQFA 4WJG2 1TGNA 3LONA 1AO5A 4D8NA 3GCTG 1QQ4A 1SGNE 3F9HA 3S9BA 3SV9A 2G55A 5AFZH 2G51A 4OS5A 3ZVCA 2A4GA 1TNHA 3E90B 1F5KU 1HAZB 2KAIB 1THSH 3M37A 2ZDNA 1PPQA 8GCHG 2GP9B 5H4IB 1MTNB 1CT4E 2H9HA 5EG4A 1LO6A 3GY5A 1EP5A 3HGNA 3GOVA 1GHAG 1RTFB 1OK1A 1TAWA 3K2UA 4WXVA 4K2YA 3SGBE 3TITA 1TBQH 2NU4E 3MU8A 4JMYA 2BD5A 3SHAH 1XKAC 3KQEA 1O5EH 1V2PT 2TGPZ 2ZTXA 1DLKB 1N6XA 1BQYA 1C1QA 3NWUA 4PROA 2NU0E 1EZXC 1LPKB 5LGOA 4I8KA 2H5DA 3RLYH 4ESTE 1L1GA 1MUEB 4I8JA 2FLBH 1EASA 3GY3A 3A87A 5EOKA 3CS0A 1LKBA 3IU3I 3T62A 1GG6B 2A5IA 1QBVH 4Q2KA 1G9IE 2ZA5A 3UOPA 1TPAE 1O2YA 3SU4A 3SV2H 1TFXA 1SGEE 2QV1A 4AFZA 1QGFA 5I0QB 2BY6X 1DANH 2CF8H 4LK4A 4KTCA 1G3EA 1TMBH 2FOFA 1C1MA 2GDEH 2D1JA 2EI8A 4AX9H 1ABJH 1XUJA 4ZXYH 1PPEE 2ZU1A 1S81A 1SOTA 5DG6A 4GHQA 1SG8B 3RMLH 4HTCH 1O39A 1ORFA 1YPMH 2VH0A 2BX3A 2HPPH 1WCZA 2QC2A 1XVMA 2JH0D 2PTNA 1P2NA 3M7UA 1GBHA 4ISOA 4H4FA 2ANMH 3RXHA 2XWAA 1XUIA 2F9BH 2H1UA 3IITA 1BA8B 1O3CA 1AE8H 1LHFH 2ESTE 1J16A 4X1RU 3LPRA 1LVBA 1SLUB 2QGRA 5DK1A 1VJ9U 1BTZA 5JB9S 1G2LA 1FQ3A 1J9CH 2P3FH 5A8ZA 1YPLH 1HLTH 1SFIA 2GZ9A 1C5OH 2F9UA 2QN5T 1MD8A 6ESTA 1ZYOA 2VVCA 3PTBA 5LPFA 3DFJA 1C1RA 4X2YA 2ZTZA 1THPB 3RDZA 1S82A 3VB7A 3A81A 3A8CA 1OJVA 1EUFA 3RXGA 5DPAA 1K1IA 3PYHA 2BQ7B 2SFAA 4MNVA 3RXCA 1GHXH 6GCHG 1ZZZA 1P2JA 4TY7A 3M5OA 1HYLA 1HJ8A 2OUAA 4YOGA 4NG9H 5EODA 3L3TA 1W11U 1G30B 2A5AA 1C2DA 4GHTA 4JZEH 4MDSA 1T8NA 3P70B 2FWWA 1BTXA 1MTNC 1HFIA 3TK5A 1UHBA 3IX0A 3A8DA 1CA0B 3MU0A 4JCNA 8LPRA 4M7GA 2H9EH 2RCEA 4AN7A 1ZMLA 1Y3YA 4Q7ZA 3DT0H 3V12A 3ZVGA 2M5TA 5SGAE 4KKDA 1ZSLA 1QB6A 1XUFA 2XCNA 1QRZA 1C4Y2 4A7IB 1GJAB 1OWHA 5CHAC 5F03A 1TQ0B 2O8TA 2BYAX 2IN2A 1D4PB 1P12E 1T8OA 2JRAA 1H9HE 1RIWB 1S84A 3SUEA 4B71A 2BOHB 1TALA 1ZRKA 1GBKA 1EKBB 2R9PA 5A09A 5F8ZA 3QLPH 3EJHA 4IBLH 2DE8A 3SU1A 1HUTH 1V2ST 2XC4A 3EAJA 4IMQA 3U98H 4GCHG 3RXVA 1LTOA 4OS4A 2QY0A 3RXPA 1ELTA 2O8WA 1G2MA 1YPEH 3RXLA 1SR5C 2BQWB 2XC5A 3NXPA 3BTFE 2BZMA 1YLCA 5GWZA 3FZDA 1SFQB 2PKAA 4CBNA 1SGIB 1HFHA 3UR9A 5L30H 1C1OA 1L4DA 5A8YA 4MQAA 1KIGH 1FMGA 2OBQA 3O8BA 1KLTA 3OYPA 4XDEA 3OSYA 3E0PB 1B7XB 4ZHLU 4ZKRU 3QDZB 1AN1E 3KL6A 3SJIA 1UVPA 2ANKH 1C1SA 1HAOH 1GBFA 4AG2A 1O3PB 5GCHF 1V2JT 1GCTB 2RG3A 2C8ZB 1A0JA 2XRCA 3BSQA 1SGFG 2BMGB 1GJ6A 1BTYA 1K2I1 2IZ4A 1P06A 3SJ8A 5AHGH 1HAVB 2R2WU 2Z9JA 1TRYA 2HNTE 1HAPH 1HIAA 3E91A 2PGQB 4NA7A 4TWYA 2UWPA 3GY4A 2ZDLA 4CBOA 1V2UT 1BZXE 1HAHH 5LH8A 1QRXA 3LGIA 1EJNA 3VPKA 1UTQA 6LPRA 1V3XA 2W3KA 1Y3UA 2ANWA 1LPGB 4Z6AH 3UUZA 1O2RA 5AF9H 2F3CE 1GL0E 4NZQA 3CS7A 3ATKA 3SHCH 3U9AH 2SGPE 3A7XA 1FONA 1PPGE 2J94A 3D62A 1QB1A 3A7YA 4YZUA 2QXIA 1ELAA 1ELDE 2ZCLP 2ZGHA 1YF4A 5T6FA 3QGNB 1Z8GA 1SC8U 1L1NA 3RMNH 4X2XA 2ZGBH 3A89A 1GBAA 2F83A 1BTHH 3S9AA 3LOXA 3SQEE 3TPIZ 3TVJB 4YM9A 3Q00A 4FUBA 1ZGIA 2FIRH 3A7WA 3Q76A 3EE0B 3SORA 2PKAB 1UTPA 4X1QU 3TK6A 2PUQH 4INLA 1DSTA 1C2EA 1OP0A 2STAE 2ZNKH 2P3UB 2FS9A 1YM0A 2Z7FE 2CV3A 2ZQ2A 1QBOA 5FCRA 4B2CA 3GICB 1DSUA 2ZU5A 1HAGE 1TOCB 2CG7A 3FZZA 2P95A 4YLQH 4R8TB 2ANYA 2J38A 2PLXA 3LKWA 1PYTD 2HVXA 3SJOA 1AWFH 2W80A 1O3BA 1RRKA 1RS0A 3UPEA 1N1LA 1P3CA 3ESTA 4MTBA 2BY7X 3A8BA 4BAQB 1HNEE 1THRH 1ZSJA 2FTLE 2CF9H 3ZZ3A 3PLKA 2TGDA 3BG8A 3GXEA 5JB8S 3NUMA 2IJOB 1B5GH 1DICA 5FBEA 3B9FH 1A7SA 1TPPA 1O2MA 1D9IA 1TGTA 1SRZA 1ELVA 3B8JA 3UREA 1H2QP 4CRBA 5E8EH 1EATA 3K9XB 1TA2A 5HMAA 1DITH 5PTPA 1A1RA 2PFEA 4U01A 5C1UA 1UOTP 4AB9A 2V8EA 4FUJA 1K22H 2XWJI 2V3HH 4X1NU 3T5OA 3ENSB 3A84A 1AVXA 1OK9A 1HCCA 2OBOA 1DT2A 3QX5H 4GSOA 1C1PA 1TNKA 3KHVA 3QK1A 4X8SH 2FYQA 2OD3B 5FX5A 1SGPE 2R2MB 2JGXA 3RXQA 3DA9B 2B5TB 1VGCB 1G3CA 2EEKA 1DX5M 2R0LA 2TBSA 4BTTB 3A8AA 5B6OA 1HAYB 3RXJA 1J14A 2EA3A 1EXFA 5T6DA 4CRAA 1O2GH 1C5MD 1KTSB 3EA8A 1VVDA 5A0AE 1ELGA 1V2WT 3GCNA 1FAXA 2XCFA 5HYTB 4A5WB 3P95A 4IN1A 1NN6A 1O3OA 1FN8A 4YNXA 4SGBE 2LPRA 4FVDA 4DW2U 1P10A 4Y79A 5HXFA 1TPNA 5A0CA 1K28D 2VNTA 1P2QA 1BRBE 4JZDH 2ILNA 2Z3DA 1A61H 3ZZCA 4H6TA 1GI4A 3R3GB 2EHFA 1IHSH 3TH3H 4WMFA 1TNIA 1H04P 1YGCH 4HGCA 1QL7A 4DURA 4X8VH 2NU2E 2Q6FA 3INBC 3RXUA 2GZ7A 3LJOA 1P9UA 1ZRBA 3AW1A 4ZUHA 3FAOA 1UK4A 3GYLB 1CHOG 2ZWLH 1DFPA 3FP7E 3K65B 1JXPA 1UTMA 2OTVA 2P16A 1TA6A 4IS5A 3RXSA 2H9TH 1CQQA 2GGVB 5DP9A 2BXTH 3EQ0H 3SQHE 4I8GA 5ESTE 4DCDA 5DO4H 3MNSA 1IQGA 1V2KT 3GY2A 1FY5A 4Y0ZE 1BJVA 1DXPA 1PJPA 3BTEE 4DIIH 1O30A 1BRAA 4NSYA 1BMAA 1NZQH 1AZ8A 2H2ZA 1V2MT 5GCHG 5GJ4B 1BMMH 4DIHH 3ODFA 1WBGB 3H7OA 1AKSA 3RXRA 1DWEH 5JYIA 2BDHA 1C1ZA 3L89M 1L1JA 2TIOA 2Z9IA 1OSSA 5EQRA 3A88A 3TH4H 3AAUA 4BXSA 1C5SA 3LH3A 3M35A 1LDTT 1OK2A 1B0FA 4MG3A 1CGJE 1M9UA 1BRUP 4YT6H 1W0ZU 4AGKA 3E6PH 2RKYA 4AFQA 3ZVDA 1C5PA 1ESBA 2OC1A 3KNXA 1LHCH 2FXRA 1PPFE 3NPSA 1AIXH 1SB1H 1RTKA 1E37B 2GCHF 2XNIA 4CRDA 1KXEA 3P8OA 5HZPB 4XBDA 2TPIZ 3GYMA 3HKIB 1GDNA 3SV7A 1J17T 2QYIA 3KIDU 8KME2 5TJXA 1O3FA 1K1NA 2B0FA 3I29A 3RXTA 4RSPA 2ZTYA 1V2RT 1SLWB 3BTGE 1GVLA 3SJKA 4U32A 3UTUH 2BD2A 1YPHE 3OP8A 1TE0A 5EU8A 1GGDC 3SOSA 1E35B 1GHBF 1SSXA 1ETTH 1XXDA 2FX6A 4F49A 3GISB 5AFYH 4FXGH 3PV4A 4U30A 2NWNA 3M7TA 4INHA 2WPJS 4PZ5A 2O8MA 1AD8H 2BXUH 3P8NA 2B7DH 1F0TA 4ISHH 1O5DH 4X0WU 1UVTH 1A46H 1ANBA 1GJ7B 4E7RG 1LHGH 2SGDE 2D8WA 3MNXA 1DOJA 3O8RA 3CP7A 4WY3A 1C2JA 1BRCE 3RJ3D 3STIA 1HJAB 1NFUA 4IN2A 2V35A 2JH5D 1O2QA 2QF0A 2C3SA 1IQIA 2BDBA 1AUJA 5FO8C 1C4U2 3PLBA 1GKNA 1PPZA 3MFJA 3SU5A 1C9PA 2RL0A 2HNTC 2UUFB 3H5CB 4Q7XA 4K69A 2D2DA 2BLWA 2SNVA 2PGBB 1SGRE 1W12U 1CT0E 1OWJA 3JZ1B 4Y7AA 5FAHA 4Y10E 1ARCA 4O3UA 4Y8YA 1O2XA 1O3NA 1TNGA 1MKWH 4UFDH 1T7CA 5FCKA 3M61U 3QWCH 1YBWA 1F7ZA 1ZTJA 2B5ID 2ERJA 1AVWA 1BJUA 1O2PA 1V2QT 1O2WA 1QJ7B 1DY8A 1GKGA 3OU0A 1YPJH 2O8UA 3PM3A 1GG6C 2ZDMA 3HK6B 2OC8A 1KYNA 1P09A 1W8BH 6GCHF 3VEQB 3BTWE 3VB4A 1FPCH 3O8DA 4ZAEA 4D9RA 3LGTA 4UFEH 1LQEA 1V2NT 3S7KB 1AE5A 2QF3A 2VIOA 4FU7A 3Q3KA 2GT7A 3GCHB 1YYY1 2XWBF 1QTFA 2ZIQH 1UTKA 3GCTF 4B2BA 4X1SU 1YCPK 1O2JA 3BTKE 1CGHA 1QCPA 1QFKH 2ZDVH 4FVBA 1SGDE 2Z3EA 1O2KA 4NIYA 4A1VA 3HATH 2ZFTA 4WH8A 4Y7BA 4GVUA 3BTTE 3LC5A 3M3SA 1H1BA 2UWLA 2WINI 7GCHF 1YCPH 1BMNH 4Q80A 3TJNA 1D3TB 3WY8A 3SZNA 2VU8E 4R0IA 3K6ZA 2BQ6B 2ODQA 1BHXF 2ZFPH 1EAUA 1EP6A 4FUFA 5EXMA 1ZHPA 2YOLA 3C1KA 5CHAB 1Z6EA 1GBLA 2A2XH 1ELFA 2FLRH 3MU5A 2G5NA 2QXJA 1WQSA 3DUXH 3HPTB 1WYKA 1W10U 1GGDB 2H5CA 3MU1A 2ZCHP 2ZPSA 2A4QA 3UY9A 3F6UH 3U8TH 4IC5A 1H9LB 3ZVEA 1FXYA 1FAKH 1QURH 1TPMA 3QTVH 1GDUA 3RMMH 3TJUA 1NS3A 1U5MA 1CHGA 4B76A 4YT7H 1Z8IB 1FNIA 3E1XB 3SBKA 3VXFH 1GI8B 4BTUB 1O2LA 4AORA 1P2IA 4XSKU 4Q7YA 4INKA 1TONA 2OC0A 1O3GA 2GT8A 1P0SH 1SHYA 4I31A 3SNBA 2Z3CA 2FO9A 1FUJA 1F5LA 3UNQA 1GMDG 3MO9A 5T6GA 2C90B 3STJA 2P93A 3MWIU 3SU3A 1O3HA 1GHWH 1O5FH 1RGQA 1BMLA 1UTJA 4CRGA 1GI3A 1AKSB 2ZPRA 1BBRK 3RXFA 1AFQC 2P8OC 5IDKA 2Y81A 1KXFA 3W95A 3GDSA 5L2ZH 1W0YH 5DP3A 2DE9A 1D3QB 1C5LH 3UWJH 2FPZA 4GUXA 1GL1A 4BAMB 4ZKOU 1HAIH 3T5FH 3R0FA 3F9FA 2CG6A 1GJDB 4JZIA 7LPRA 1D6WA 4D76A 2FS8A 3TNSA 5C3NA 1F0SA 3SUGA 1NWVA 1CHOF 1MQ6A 3UWIA 4D9QA 1KXCA 2AFQB 1PQ8A 9ESTA 5E0GA 5EPNA 5F8TA 2G8TA 1EPTB 4NSVA 1LCYA 4K8BA 1KDQB 5EXNA 2VGCC 4CHAB 3BTQE 2D26C 1YKTA 4UEHH 1GBCA 4ABFA 1CE5A 1BHXB 1TGCA 4I32A 2J92A 1O5GH 1OWEA 8ESTE 4I33A 5E2PA 3MH4A 5JBCS 3GY7A 3S0NA 1GMCG 2GDDA 2ZFSA 2GV7A 1TBRH 2OLGA 1W13U 1MMJN 3RC4A 4ASHA 1O3MA 3CENA 3I77A 1SQTA 3PTNA 4E05H 3TIUA 5BRRE 1L4ZA 2FMJA 2WYGA 1FN6A 3PMHB 1HFDA 3QO6A 1Y5UT 3OEDC 1P8VC 1J8AA 1O3AA 1VCPA 2VVVA 1O5AB 1NTPA 4AZ2B 4GPGA 1PPHE 1UJ1A 4X6MA 4VGCB 4B2RA 3NCLA 1VITF 2FYRA 1CA8B 1LKAA 4DVAU 2EI6A 2WPHS 2BDAA 1O2NA 1SLXB 2BB4A 2V0BA 1EB2A 3M3TA 3MI4A 4AYDA 4DT7B 2C93B 2WV5A 4I7YH 3NK8A 3ZRZA 3ITIA 1FPHH 1JOUB 2A2QH 1AUTC 1NRSH 3VXEH 3SO3A 4ZXXH 4A5TS 3ZVBA 4CR5A 2BLQA 2PHBA 1GBBA 1SL3A 1F0RA 2AGEX 2RLQA 2VVUA 2WYJA 3QZQA 2ZI2H 1FLEE 5CMXH 2EC9H 1TBZH 2STBE 3RXEA 1RJXB 1TPGA 4AYIA 3BEUA 2O8LA 1PFXC 3SW2B 4GLYA 2VIPA 2I6SA 2OXSA 1E0FD 1GJ5H 2FI4E 1HIAB 1OS8A 3URCA 1GCTC 1A4WH 4NIXA 4K1SA 3VGCB 5C20A 2GCTB 1V2TT 1P11E 1SQOA 2FODA 1F0UA 1LVYA 4B1TA 4FUDA 1V2VT 3ZYEA 1O2SA 1G4GA 5L2YH 3KQCA 3SNAA 1SGYE 1UMAH 3F1SB 1H03P 3ATIA 2SGQE 2Q1JA 1ZOMA 2G7IA 2NU3E 2B9LA 2BY5X 2FI5E 2ZC9H 3JZ2B 1C9TA 3E3TA 4IMZA 3PMAB 3MNBA 1GI1A 1KXAA 2G00A 2ZGXH 1P01A 3MO6A 4Y8ZA 1XXFA 1WTGH 4NZLA 2ZHFH 1O33A 2B8OH 2FM2A 2QIQA 2SGEE 2ZU3A 4NA9H 3RC5A 3A80A 1G36A 1YPHC 4A1TA 1TGSZ 1WTHD 2G5VA 5EQQA 3UR6A 5I46H 1T8MA 3QGJA 4AFUA 1ZMJA 2A4OA 4DY7B 1BBRE 1C1WH 5K0HA 2FOEA 3A7TA 1ZPCA 2WUCA 3DFLA 3LT3A 3RXOA 1NRNH 1LVOA 4MUCA 4WF8A 4MPWA 1OJYA 4BXWA 5EW2H 1NFYA 2Y7ZA 2BDYA 2GZ8A 3QTOH 4UD9H 2VWNA 3ZVFA 1CKLA 2BVSH 1G32B 1FBRA 1TYNA 1GMHG 4JZ1A 1YC0A 3LJJA 3MH6A 3ERBA 4LZ4B 2XBWA 4FXGG 5JDUB 1MKXH 1GI5A 1MTUA 3RXAA 4ZHAA 4MNWA 2AGIX 1FY4A 2ZG0H 1ZPZA 5TCCA 1UCYH 1F92A 1QY6A 3A7VA 4TPIZ 4Z0KA 3EGKH 1HAVA 3V13A 4NA8A 2KMSA 4RKJB 1TABE 4X2WA 4K3JA 4GCHF 5TCAA 2TRMA 3UQOA 1QGBA 3RM2H 1QA0A 2W3IA 1UVUH 2YBYA 1A0LA 3KXVA 1SMFE 1VJAU 1VZQH 1TNLA 2ULLA 3PWCA 4NWKA 1UVOA 1MAXA 1FY3A 2W5EA 1C5TA 2Y82A 7KMEH 1BTPA 1C5YB 2AS9A 3RXIA 2A5KA 2A7HA 1VR1H 4I8LA 1DDJA 2WIIC 4A6LA 1SGQE 2GMTB 1TWXB 1OYTH 3M7QA 1GWAA 2V6NA 3OX7U 1S6FA 1TPSA 1Y3WA 1O5CB 1UTOA 1C1VH 2RA0A 1C1UH 5DGJA 2KRIA 4DG4A 2OCVB 1O2IA 2ZU4A 3TJVA 2ZPQA 1W14U 4B2AA 1Z1JA 2Z9LA 3S9CA 3MQLA 2FDAA 1JWTA 1FY8E 1S83A 4ABJA 1AGJA 1D3DB 1XM1A 1Q3XA 4KELA 2A0QB 3H7TA 1DWCH 2VWMA 3URDA 3SU0A 2TGAA 4F4OC 4CRCA 1TX8A 4OS6A 1TNJA 3ATMA 2WPLS 4VGCC 2W7SA 2DUCA 2ZHEH 2GTBA 2P94A 1QL9A 3K6YA 4MLFB 1P2OA 1QA7A 3GY6A 1C2LA 2P3TB 1EAWA 1J15A 4OGXA 3UQVA 3T26A 2A32A 1H8IH 3E8LA 1QRWA 4UFFH 1WOFA 1KDQA 2UWOA 1W3CA 1FIWA 2UUYA 4ZROA 4JK6A 1F5RA 2CKUA 3O8EB 3LGUA 2JETB 1Z7KA 1GBEA 4TY6A 4D7FA 3TH2H 3SGAE 3EDXB 4FU9A 3RU4E 3ZYDA 1SGCA 4Y11E 5T3HA 2HNTF 5JPMG 2F9VA 1C5UA 3VFEA 3EA9A 1JMOH 1TMTH 4YO9A 1GHVH 8GCHF 1GVZA 2OC7A 2BDIA 2PUXB 1SLVB 1NRRH 2RLPA 2XC0A 3ELAH 2A45B 1ACBE 1UTLM 1TQ7B 1Z1IA 3M5LA 1C5VA 4B75A 1GMDF 2BD9A 4ZHMU 1BDAA 3V3MA 2XRDA 1EAIA 3LDXH 1RIWC 2O9QA 1LHDH 3U8RH 1HB0B 4DGJA 1MTWA 1C2MA 3TU7H 1NM6A 2CJIA 1EOLA 3BIUH 1N6YA 2ZU2A 2PR3A 2IZ3A 2VIDA 2VWOA 1D3PB 5FX6A 4Y71A 2LNCA 3C27B 2HWLB 2Z94A 7ESTE 1MZAA 1OOKB 4IGDA 1HGTH 3FP6E 2Y5GA 1E88A 2OINA 2ZFQH 3MHWU 3RUOA 3UNRA 5HYPA 2ALVA 2ZCKP 5GXPA 1AMHA 5EPYA 2G4TA 3TLOA 3A7ZA 2UUKB 2ZGCA 2FOGA 1GJBB 3M7PA 2C8WB 4ABAA 1AWHB 5JBBS 5FXLA 1ARBA 1LVMA 3QN7A 4X8UH 1HCGA 3KQDA 1G3DA 2J4IA 1K1PA 1OWDA 4X6NA 3HK3B 4ONTD 1ETRH 4OS7A 1PPCE 1MKXK 1E8BA 2J34A 2PWXA 3MMGA 4TYDA 2K1QA 2NU1E 3AASA 1Z71A 3Q3XA 4RKOB 1QR3E 5JBTA 1EZQA 1CA0C 2GCHG 3E16B 1A2CH 1GBDA 1ABIH 4JYVH 1IOEA 4JYUH 3V7TA 1P03A 1AVGH 1NU7B 4AYEA 1JIRA 3RC6A 1G37A 2XWBI 1LPZB 3LIWA 4FUGA 1UCYE 1AI8H 1MU6B 4ABIA 2TGTA 2BVRH 3G01A 4KP0A 2C4FH 4KTUA 1MBMA 3ZVAA 3U1JB 1ETSH 4OS2A 3SNDA 3E0NB 2ZFFH 4BAHB 1UO6A 1KXBA 4NIVA 3RXMA 2JETC 9LPRA 1CGIE 1V2LT 1GHZA 2A4RA 1E38B 1FZZA 3ZV9A 5A0BA 2QAAA 4UONA 2CN0H 1NROH 3OY6U 4THNH 1ANCA 1JIMA 3GY8A 1C5ZB 5C2ZA 1IQKA 1IQLA 2LOJA 3GDUA 5DKMA 1NESE 3T2NA 1MCTA 2XBYA 1OK3A 1SBWA 3EYDA 4C16A 3FP8E 2FTMA 4LOTA 3M3VA 3BF6H 2YRAA 5L6NH 1GI0A 3BTDE 2Z9GA 2YNAA 1VGCC 2YNBA 1O32A 2ZHWH 2VJ1A 2VWLA 1P05A 2ZHDA 1AY6H 4Y6DA 1VITH 1HV7A 5K7RA 4KTSA 3LH1A 2QXGA 1ZSKA 1AFQB 2P8OB 2XBXA 2R3UA 3ATWA 4I8HA 5BPEA 3A85A 2SGFE 2OQ5A 5HM9A 2J9NA 1A0HB 4FUIA 2ALPA 3L33A 1ANDA 4ABDA 1FIZA 3RU4D 2GD4B 3S7HB 2GMTC 4DOQA 2PV9B 2Z9KA 1HXEH 4O3TA 4MVNA 1NO9H 1T32A 3AW0A 3BIVH 1GDQA 3NKKA 4K60A 1ZLRA 1DLEA 5DP7A 3A86A 1AFEH 3QZRA 5E2OA 2Y5HA 4BAKB 2J95A 4ABHA 1C1TA 3MOCA 5A2MH 2PTCE 1SI5H 4NIWA 3P92A 1BIOA 5C67A 1MCVA 4CHAC 2HPQH 2AIPA 1EPTC 1TPOA 4UDWH 2A55A 1ZJDA 1O2OA 2OP9A 1JRTA 1DXWA 1V2OT 2RDLA 1O3JA 3ZD1A 2WUBA 1BTWA 3MO3A 1GHQB 1NT1A 7GCHG 1OYQA 1RFNA 5FPSA 5GIBA 2XW9A 1IQEA 1P57B 1MAYA 2ZKSA 1OP2A 5EQSA 2ZF0H 5EXLA 2QA9E 3TJOA 4NGAH 4K1TA 1IQHA 1WSSH 1O5BB 4X6OA 4X6PA 5AVDA 1O3LA 1GMHF 2VIWA 1AU8A 4HFPB 4AB8A 3PMJA 5GDSH 1GI7B 1DS2E 1UVSH 1W2KH 2Y6TA 3TK9A 1KXDA 4J2YB 3SI3H 3PO1C 1GHYH 4E7NA 3GCOA 2GX4A 2GV6A 2FP7B 5G4BA 1T4VH 2FOBA 2AGGX 3SU2A 3Q77A 4FUEA 4DJZA 2BOKA 2VIVA 1QIXB 1N8OB 2BD8A 1BITA 1ELEE 1WUNH 1MZDA 1C5NH 3SUFA 1XUHA 4KGAA 3T29A 3ZZ4A 3T28A 3VB5A 2G52A 2Q6GA 3N7OA 1H4WA 2ODPA 4ABBA 1Z8RA 1FDPA 3R62A 4O03A 1ELBA 2Y7XA 2F9NA 5DP8A 4O97A 1O36A 3RU4T 2SGAA 3UOUA 5EW1H 1PQ5A 3KEEA 2VINA 1LMWB 2C8YB 2Q6DA 4JHSA 1GBTA 1ESAA 3BEFB 2CGAA 1T4UH 4NCYA 4ZH1D 1TGBA 4TWWA 4CH8B 2ZGJA 1BUIA 1P9SA 2VIQA 4WXIA 1EJAA 1HRTH 3RMOH 4ZKSU 1IQJA 4O9VA 3UNSA 1ZMNA 4CREA 3FANA 3P17H 1T31A 1O2VA 4IC6A 1P3EA 1P02A 1EX3A 1YCPM 2BZ6H 1ZHMA 4OS1A 4BANB 1DE7H 3MH5A 1QNJA 4YESB 3ZZ8A 5LPRA 1RXPA 1DPOA 3MYWA 3ODDA 1DWBH 2ZECA 1O35A 1QJ1B 3AVZA 3MH7A 1N8OC 2FOAA 3U69H 1HJAC 1CT2E 1MU8B 2BDGA 3D23A 1XUGA 1T8LA 4H42U 3W94A 1C5XB 2OQUA 4A92A 1XX9A 1G4FA 2AYWA 2G81E 3PMBB 2BX4A 2WPIS 2XRBA 1AB9C 1GMCF 3SN8A 3KQBA 3ZZAA 2FX4A 2A31A 1FY1A 1D6RA 1QUBA 3DHKH 2BDCA 2IOTA 2VH6A 3V0XA 4LZ1H 3KF2A 1EJMA 1VITG 5DP5A 5CE1A 2AEIH 1OJWA 1C4V2 4AG1A 3SV6A 2W7UA 1OPHB 2XYAA 4WH6A 1GBIA 2BVXH 2EC3A 5ABWA 1ESTA 1XKBC 1MTSA 2ZZUH 6CHAC 4AFSA 1OKXA 3A83A 2UUJB 2FEQH 3KN2A 3ZZ5A 5JBAS 1O3EA 2BZAA 3PO1B 1XVOA 1NFXA 4XBBA 1PYTC 3OXUD 2J2UA 3EA7A 1C5RA 1ZTKA 1E5GA 1HAXB 3RXKA 1TB6H 3RXDA 4CH2B 1QQUA 4WMDA 1UHBB 2ZP0H 3SGQE 1PPBH 2CHAB 3BN9A 1NPMA 1ID5H 2I6QA 5FHTA 2G4UA 3F9EA 4LXBH 4GAWA 1C2FA 4AYYB 4JK5A 2H6MA 3MTYA 1ELCA 3SI4H 2WPKS 2EI7A 4YOJA 1SGTA 2BY8X 1KLIH 3TVJA 1H2PP 4ABGA 1OWKA 1OXGA 2GCTC 1DM4B 1GI2A 1BB0B 5DJ7A 1Z8JB 1O2UA 1Y3XA 3ZZBA 1QL8A 1C5QA 1Q31A 1GHAF 3SU6A 4MPXA 3ZZ7A 5A8XA 1O2HA 3SV8A 2FOCA 4TPYA 1HJ9A 1EQ9A 4MPUA 1SQAA 1A5GH 1O3IA 1AQ7A 2CMYA 2JGWA 1V6DA 5HGGA 4AGJA 1JBUH 1SPJA 1BTUA 1E34B 1C2KA 3CALA 3ZV8A 3OY5U 2BD7A 3MU4A 2VB0A 4JYTA 2XTTB 4AOQA 3O8CA 4AYMA 1XMNB 3UFAA 3LGVA 1UCYK 1WV7H 4BOHA 1FJSA 4J1YA 2AMDA 1AB9B 4HZHA 4X8TH 2QCYA 5HM2A 1GJCB 1MTVA 4AYVB 3A82A 1K1JA 1S5SA 4FU8A 4RN6A 1EZSC 5I25A 1W7GH 3SNEA 2PW8H 1Y5BT 3QUMP 5F6MA 1NC6A 1EB1H 2Z6BD 2F9OA 2ZDAH 5ESBA 1O9AA 2F9PA 2PKSB 3T27A 1TX6A 4J38B 2XQWC 1CBWB 1ZPBA 2BLOA 4ZH8A 1FI8A 3KGPA 1S0QA 2WV4A 5F8XA 3SW0X 4B2SA 1KSNA 2MCZA 1C2IA 1TX7A 1EAXA 1Z6JH 1K9OE 1IAUA 1GHBG 6CHAB 1QBNA 3ZZDA 1KTTB 3RP2A 3AAVA 3BEIB 1YPGH 4Y8XA 1S6HA 2P59A 3M5MA 5EGMA 1ZR0A 3U8OH 3SNCA 2A7JA 1MQ5A 1IHTH 4DJZB 2Y80A 4NWLA 2MCYA 1NRPH 4B73A 5HYUB 3FFGA 2BD4A 3BG4B 4LOSA 4BNRA 1QO6A 1QHRB 2FI3E 4OGYA 1W7XH 1P2MA 1TOMH 1TLDA 5HYOA 1OP8A 1RD3B 1A3BH 4MPVA 3I78A 1U6QA 2XXLA 4K12A 1ZGVA 2GVFA 2PSYA 1C1NA 5JPMH 3ZZ9A 3T25A 2W26A 2QY0B 3TNTA 2ZFRH 3LGWA 3TGKE 1PQ7A 1A5HA 2RKZA 1SHHB 3GCHC 1NRQH 1DUAA 3P8FA 1KLJH 1GJ4H 2PSXA 4JZFH 3U1IB 1NFWA 1OX1A 1GPZA 3IG6B 3ZZ6A 3TGJE 4K1EA 1SGFA 1O3KA 1YPKH 2ZQ1A 1MD7A 1DUEA 1C2GA 4Y0YE 1UK2A 1F2SE 1LY2A 1BBRH 1IQNA 1H8DH 1Y59T 2ASUB 2IPHA 1CSOE 1HDTH 1CVWH 3M36A 1C2HA 4IW4E 4YLUA 5LPEA 3NFPI 1CU1A 1O31A 1O38A 1A5IA 1UK3A 1YLDA 1HXFH 5FBIA 2BLVA 3Q3YA 3SJ9A 2W81A 1O34A 1O0DH 3LC3A 3BV9B 1B0EA 1GI6A 1Y3VA 4X2VA 3F9GA 5DP4A 2C8XB 1NU9A 3PROA 2CHAC 3D49H 1Y5AT 2BTCE 4HI3A 2AIQA 1OWIA 1EZUC 4YTAA 1BT7A 5C1YA 5DP6A 1DVAH 3P8GA 2THFB 1K1OA 1L0ZA 5FPYA 3S69A 1ANEA 1MBQA 4SGAE 1O37A 4ISLA 4Y76A 2R3YA 2AMPA 2XBVA 3B23B 5C5OA 4BTIB 4E06H 3SUDA 2ZHQH 1HPGA 1CBWC 1K1LA 3VB3A 1S85A 5FPTA 2ODYB 3TGIE 2HRVA 1MKWK 3NZIA 1QJ6B 4NFFA 2FZZA 4K5ZA 3DD2H 2JKHA 1SVPA 1O2ZA 1X7AC 1P04A 4XOJA 1VCWA 1RTLA 1NY22 1GI9B 5J4QA 1O3DA 5GPIB 2AH4X 1WAYB 1VVCA 1HBTH 1EPTA 3PLPA 4XBCA 4ZKNU 1KY9A 1O2TA 4CR9A 5J4SA 1TIOA 1AHTH 2ZDKA 3KCGH 3PB1E 1L2EA 1QB9A 5IYTA 2HGTH 1BCUH 1UTNA 2ZO3H 2HOBA 4D7GA 4UFGH 1GBMA 2FESH 3RM0H 1CO7E 4K8YA 2ZEBA 4CRFA 5E0HA 4MNXA 1BOQA 2JH6D 3ZD2A 1H9IE 2HLCA 4B74A 3VB6A 2AMQA 3LGYA 3RLWH 1ZJKA 2Y5FA 2GKVE 1GJ8B 1GCDA 1YP9A 2O39C 1WQVH 4ISNA 2BM2A 3IWMA 2VGCB 2BY9X 3GOVB 3P6ZB 1AZZA 4MNYA 3MNCA 1SOZA 1JRSA 2CXVA 3OTJE 1A3EH 2F91A 3HKJB 2RA3A 2KAIA 2R0KA 4WMEA 2PKSC 1TRMA 3HGPA 3FVFB 4WVPE 3RXBA 4U2WA 1MH0A 2SNWA 4WWYA 1VCQA 3L6PA 1ZTLA 1LQDB 1Y8TA 2A7CA 2V3OH 2QXHA 3BG4C 4FUCA 3VGCC 1P2KA 4CSYA 4UE7H 4NFEA 4ISIH 2AERH
chains in the Genus database with same CATH superfamily
1S0RA 1G3BA 4XE4A 2HALA 4YOIA 2BHGA 1C5WB 3ATLA 2FOHA 5ETXA 3GDVA 1IQMA 1WU1A 1E36B 4QT8C 1TRNA 3LU9B 4ABEA 2WPMS 3PWBA 1EOJA 1GBJA 2FOMB 3BTHE 4H6SB 1XUKA 2VBCA 4FUHA 1YWUA 1INCA 4BAOB 5C5NA 5E0JA 1TMUH 1GVKB 1LHEH 2UWNA 3D65E 1DY9A 5C1XA 3KZJA 5GNDA 1FV9A 1Z92B 1GJ9B 3M5NA 4A1XA 3UIRA 3BTME 1PQAA 2BD3A 4ZMAH 4LOYH 3F68H 1Q2WA 4X1PU 1SS2A 1K1MA 1ZHRA 4XFQA 1DWDH 1K21H 2A1DB 1IQFA 4WJG2 1TGNA 3LONA 1AO5A 4D8NA 3GCTG 1QQ4A 3SYJA 1SGNE 3F9HA 3S9BA 3SV9A 2G55A 5AFZH 2G51A 4OS5A 3ZVCA 2A4GA 1TNHA 3E90B 1F5KU 1HAZB 2KAIB 1THSH 3M37A 2ZDNA 1PPQA 8GCHG 2GP9B 5H4IB 1MTNB 1CT4E 2H9HA 5EG4A 1EFRD 1LO6A 2WZQA 3GY5A 1EP5A 3HGNA 3GOVA 1GHAG 1RTFB 1OK1A 1TAWA 3K2UA 4WXVA 4K2YA 3SGBE 3TITA 1TBQH 2NU4E 3MU8A 4JMYA 2BD5A 3SHAH 1XKAC 3KQEA 1O5EH 1V2PT 2TGPZ 2ZTXA 1DLKB 1N6XA 1BQYA 1C1QA 2WPDD 3NWUA 4PROA 2NU0E 1EZXC 1LPKB 5LGOA 4I8KA 2H5DA 3RLYH 3F2HA 4ESTE 1L1GA 1MUEB 4I8JA 1WXRA 2FLBH 1EASA 3GY3A 3A87A 5EOKA 3CS0A 4YXWD 1LKBA 3IU3I 3T62A 1GG6B 2A5IA 1QBVH 4Q2KA 1G9IE 2ZA5A 3UOPA 1TPAE 1O2YA 3SU4A 3SV2H 1TFXA 1SGEE 2QV1A 4AFZA 2HLDD 1QGFA 5I0QB 2BY6X 1DANH 2CF8H 4LK4A 4KTCA 1G3EA 1TMBH 2FOFA 1C1MA 2GDEH 2D1JA 2EI8A 5CHBA 1ABJH 1XUJA 4ZXYH 4AX9H 1PPEE 2ZU1A 1S81A 1SOTA 5DG6A 4GHQA 1SG8B 3RMLH 4HTCH 1O39A 1ORFA 1YPMH 2VH0A 2BX3A 2HPPH 1WCZA 2QC2A 1XVMA 1SQRA 2JH0D 2PTNA 1P2NA 1E79D 3PRDA 3M7UA 1GBHA 4ISOA 4H4FA 2ANMH 3RXHA 2XWAA 1XUIA 2F9BH 2H1UA 3IITA 1BA8B 1O3CA 1AE8H 1LHFH 2ESTE 1J16A 4X1RU 3LPRA 1LVBA 1SLUB 2QGRA 5DK1A 2KM0A 1VJ9U 1BTZA 5JB9S 1G2LA 1FQ3A 1J9CH 2P3FH 5A8ZA 1YPLH 1HLTH 1SFIA 2GZ9A 1C5OH 2F9UA 2QN5T 1MD8A 6ESTA 1ZYOA 2VVCA 3PTBA 5LPFA 3DFJA 1C1RA 4X2YA 2ZTZA 1THPB 1H8HD 3RDZA 1S82A 3VB7A 4Z1MD 3A81A 3A8CA 1OJVA 1EUFA 3OE7D 3RXGA 5DPAA 2ZYCA 1K1IA 3PYHA 2BQ7B 2SFAA 4MNVA 3RXCA 1GHXH 6GCHG 1ZZZA 1P2JA 4TY7A 3M5OA 1HYLA 1HJ8A 2CK3D 2OUAA 4YOGA 5KECA 4NG9H 5EODA 2KZ4A 3L3TA 1W11U 1G30B 2A5AA 1C2DA 4GHTA 4JZEH 4MDSA 1T8NA 3P70B 2FWWA 1BTXA 1MTNC 1HFIA 3TK5A 1UHBA 3IX0A 4Q63A 3A8DA 1CA0B 3MU0A 4JCNA 8LPRA 4M7GA 2H9EH 4ACBA 2RCEA 4AN7A 1ZMLA 1Y3YA 4Q7ZA 3DT0H 5F53A 3V12A 3ZVGA 2M5TA 5SGAE 4KKDA 1ZSLA 1QB6A 1XUFA 2F4LA 2XCNA 1QRZA 1C4Y2 4A7IB 1GJAB 1OWHA 5CHAC 5F03A 1TQ0B 2O8TA 2BYAX 4B6EA 2IN2A 1D4PB 1P12E 1T8OA 2JRAA 1H9HE 1RIWB 1S84A 3SUEA 4B71A 2BOHB 1TALA 1ZRKA 1GBKA 1EKBB 2R9PA 5A09A 5F8ZA 3QLPH 3EJHA 2KCOA 4IBLH 2DE8A 3SU1A 1HUTH 1V2ST 2XC4A 3EAJA 2K0QA 5CDFE 4IMQA 3U98H 4GCHG 3RXVA 1LTOA 4OS4A 2QY0A 3RXPA 1ELTA 2O8WA 1G2MA 1YPEH 3RXLA 1SR5C 2BQWB 2XC5A 3NXPA 3GS9A 3BTFE 2BZMA 1YLCA 5GWZA 3FZDA 1SFQB 2PKAA 4CBNA 1SGIB 1HFHA 3UR9A 5L30H 1C1OA 1L4DA 5A8YA 4MQAA 1KIGH 1FMGA 2OBQA 3O8BA 1KLTA 3OYPA 2J98A 4ACAA 4XDEA 3OSYA 3E0PB 1B7XB 3F2GA 4ZHLU 4ZKRU 3QDZB 1AN1E 3KL6A 3SJIA 1UVPA 2ANKH 1C1SA 1HAOH 1GBFA 2PP6A 4AG2A 1FX0B 1O3PB 5GCHF 1V2JT 1GCTB 2RG3A 2C8ZB 1A0JA 2XRCA 3FKSD 3BSQA 1SGFG 2BMGB 1GJ6A 1BTYA 1K2I1 2IZ4A 1P06A 3SJ8A 5AHGH 1HAVB 2R2WU 2Z9JA 1TRYA 2HNTE 1HAPH 1HIAA 2RDEA 3E91A 5KEDA 2PGQB 4NA7A 4TWYA 2UWPA 3GY4A 2ZDLA 4CBOA 1V2UT 1BZXE 1HAHH 5LH8A 1QRXA 3LGIA 1EJNA 3VPKA 1UTQA 6LPRA 1V3XA 2W3KA 1Y3UA 2ANWA 1LPGB 4Z6AH 3UUZA 1O2RA 5AF9H 2F3CE 1GL0E 4NZQA 3CS7A 3ATKA 2L6OA 3SHCH 2SGPE 3U9AH 3A7XA 1FONA 1PPGE 2J94A 3D62A 1QB1A 3A7YA 2WSSD 2QXIA 4TSFD 4YZUA 1ELAA 1ELDE 2ZCLP 4TT3D 2ZGHA 1YF4A 5T6FA 3QGNB 1Z8GA 1SC8U 1L1NA 3RMNH 3OTPA 2ZGBH 3A89A 2QF5A 4X2XA 1GBAA 2F83A 1BTHH 3S9AA 3LOXA 3SQEE 3TPIZ 3TVJB 4YM9A 3Q00A 4FUBA 1ZGIA 2FIRH 3A7WA 3Q76A 3EE0B 3SORA 2PKAB 1UTPA 4X1QU 3TK6A 2PUQH 4INLA 1DSTA 1C2EA 1OP0A 2STAE 2ZNKH 2P3UB 2FS9A 1YM0A 2Z7FE 2CV3A 2ZQ2A 1QBOA 2XNDD 5FCRA 3GICB 4B2CA 1DSUA 2ZU5A 1HAGE 1TOCB 2CG7A 1COWD 3FZZA 2P95A 4YLQH 4R8TB 2ANYA 2J38A 2PLXA 3U28C 3LKWA 1PYTD 2HVXA 3SJOA 1AWFH 2XOKD 2W80A 1O3BA 1RRKA 1RS0A 3UPEA 1N1LA 1P3CA 3ESTA 4MTBA 2BY7X 3A8BA 4BAQB 1HNEE 1THRH 1ZSJA 2FTLE 2CF9H 3ZZ3A 3PLKA 2TGDA 3BG8A 3GXEA 5JB8S 3NUMA 2IJOB 1B5GH 1DICA 5FBEA 3W1EA 3B9FH 1A7SA 1TPPA 1O2MA 1D9IA 1TGTA 1SRZA 1ELVA 3B8JA 3UREA 1H2QP 4CRBA 5E8EH 1EATA 3K9XB 1TA2A 5HMAA 1DITH 5PTPA 1A1RA 2PFEA 4U01A 5C1UA 1UOTP 4AB9A 2V8EA 4FUJA 1K22H 2XWJI 2V3HH 4X1NU 3T5OA 3ENSB 3A84A 1AVXA 1OK9A 1HCCA 2OBOA 1DT2A 3QX5H 4GSOA 1C1PA 1TNKA 3KHVA 3QK1A 4X8SH 2FYQA 2OD3B 5FX5A 5DN5A 1SGPE 2R2MB 2JGXA 3RXQA 3DA9B 2B5TB 1VGCB 1G3CA 2EEKA 1DX5M 2R0LA 2TBSA 4BTTB 3A8AA 5B6OA 1HAYB 3RXJA 1J14A 2EA3A 1EXFA 5T6DA 4CRAA 1O2GH 1C5MD 1KTSB 3EA8A 1VVDA 5A0AE 1ELGA 1V2WT 3GCNA 1FAXA 2XCFA 5HYTB 4A5WB 3P95A 4IN1A 1NN6A 1O3OA 1FN8A 4YNXA 4SGBE 2LPRA 4FVDA 4DW2U 1P10A 4Y79A 5HXFA 1TPNA 5A0CA 1K28D 2VNTA 1P2QA 1BRBE 4JZDH 3VWOA 2ILNA 2Z3DA 1A61H 3ZZCA 4H6TA 4DT4A 1GI4A 3R3GB 2EHFA 1IHSH 3TH3H 4WMFA 1TNIA 1H04P 1YGCH 4HGCA 1QL7A 4DURA 4X8VH 2NU2E 2Q6FA 3INBC 3RXUA 2GZ7A 3LJOA 1P9UA 1ZRBA 2IJD1 3AW1A 4ZUHA 3FAOA 1UK4A 3GYLB 1CHOG 3F6KA 2ZWLH 1DFPA 4FETA 3FP7E 3K65B 1JXPA 1UTMA 2OTVA 2P16A 1TA6A 4IS5A 3RXSA 2H9TH 1CQQA 2GGVB 5DP9A 2BXTH 3EQ0H 3SQHE 4I8GA 5ESTE 4DCDA 5DO4H 3MNSA 1IQGA 1V2KT 3GY2A 1FY5A 3WWFA 4Y0ZE 1BJVA 1DXPA 1PJPA 3VG8A 3BTEE 4DIIH 1O30A 1BRAA 4NSYA 1BMAA 1NZQH 1AZ8A 2H2ZA 1V2MT 5GCHG 5GJ4B 1BMMH 4DIHH 3ODFA 1WBGB 3H7OA 1AKSA 3RXRA 1DWEH 5JYIA 2BDHA 1C1ZA 3L89M 1L1JA 2TIOA 3F2FA 2Z9IA 1OSSA 5EQRA 3A88A 3TH4H 3AAUA 4BXSA 1C5SA 3LH3A 3M35A 1LDTT 1OK2A 1B0FA 4MG3A 1CGJE 1M9UA 1BRUP 4YT6H 1W0ZU 4AGKA 3E6PH 2RKYA 4AFQA 3ZVDA 3KYGA 1C5PA 1ESBA 2OC1A 3KNXA 1LHCH 2FXRA 1PPFE 3NPSA 1AIXH 1SB1H 1RTKA 2OK5A 1E37B 2GCHF 2XNIA 4CRDA 1KXEA 3P8OA 5HZPB 4XBDA 2TPIZ 3GYMA 3HKIB 1GDNA 3SV7A 1J17T 2QYIA 3KIDU 3CNRA 8KME2 1NBME 5TJXA 5C17A 1O3FA 1K1NA 2B0FA 3I29A 3RXTA 4RSPA 2ZTYA 1V2RT 1SLWB 3BTGE 1GVLA 3SJKA 4U32A 3UTUH 2BD2A 3K3TA 3OP8A 1YPHE 1TE0A 5EU8A 1GGDC 3SOSA 1E35B 1GHBF 1SSXA 1ETTH 1XXDA 2FX6A 4F49A 3GISB 5AFYH 4FXGH 3PV4A 4U30A 2NWNA 3M7TA 4INHA 2WPJS 4PZ5A 2O8MA 1AD8H 2BXUH 3P8NA 2B7DH 1F0TA 4ISHH 1O5DH 4X0WU 1UVTH 5IK2D 1A46H 1ANBA 1GJ7B 4E7RG 1LHGH 2SGDE 2D8WA 3MNXA 1DOJA 3O8RA 1OHHD 4XD7D 3CP7A 4WY3A 1C2JA 1BRCE 3RJ3D 3STIA 1HJAB 1NFUA 4IN2A 2V35A 2JH5D 1O2QA 2QF0A 2C3SA 1IQIA 2BDBA 1AUJA 5FO8C 1C4U2 3PLBA 1GKNA 1PPZA 3MFJA 2I2LA 3SU5A 1C9PA 2RL0A 2HNTC 2UUFB 3H5CB 2YMSC 4Q7XA 4K69A 2D2DA 2BLWA 2SNVA 2PGBB 1SGRE 1UW7A 1W12U 1CT0E 1OWJA 2IPQX 3JZ1B 4Y7AA 5FAHA 4Y10E 1ARCA 4O3UA 4Y8YA 1O2XA 1O3NA 1TNGA 1MKWH 4UFDH 1T7CA 5FCKA 3M61U 3QWCH 1YBWA 1F7ZA 1ZTJA 2B5ID 3WSYA 2ERJA 1AVWA 1BJUA 1O2PA 1V2QT 1O2WA 1QJ7B 1DY8A 1GKGA 2JIZD 3OU0A 1YPJH 1VKYA 2O8UA 3PM3A 1GG6C 2ZDMA 3HK6B 2OC8A 1KYNA 1P09A 1W8BH 6GCHF 3VEQB 3BTWE 3VB4A 1FPCH 3O8DA 4ZAEA 4D9RA 3LGTA 4UFEH 1LQEA 1V2NT 3S7KB 1AE5A 2M2AA 2QF3A 2VIOA 4FU7A 3Q3KA 2GT7A 3GCHB 1YYY1 2XWBF 1QTFA 2ZIQH 1UTKA 3GCTF 4B2BA 4X1SU 1YCPK 1O2JA 3BTKE 1CGHA 4RT1A 1QCPA 1QFKH 2ZDVH 4FVBA 1SGDE 2Z3EA 1O2KA 4NIYA 4A1VA 3HATH 2ZFTA 4WH8A 4Y7BA 4GVUA 3BTTE 3LC5A 3M3SA 1H1BA 2UWLA 2WINI 7GCHF 1YCPH 1BMNH 4Q80A 3TJNA 1D3TB 3WY8A 3SZNA 2VU8E 4R0IA 3WSXA 2BQ6B 3K6ZA 2ODQA 1BHXF 2ZFPH 1EAUA 1EP6A 4FUFA 5EXMA 1ZHPA 2YOLA 3C1KA 5CHAB 1Z6EA 1GBLA 5DSFA 2A2XH 1ELFA 2FLRH 3MU5A 3FGRA 2G5NA 2QXJA 1WQSA 3DUXH 3HPTB 1WYKA 1W10U 1GGDB 2H5CA 3MU1A 2ZCHP 2ZPSA 2A4QA 3UY9A 3F6UH 3U8TH 4IC5A 1H9LB 3ZVEA 1FXYA 1FAKH 2L74A 1QURH 1TPMA 3QTVH 1GDUA 3RMMH 3TJUA 1NS3A 1U5MA 1CHGA 4B76A 4YT7H 3DCLA 1YY3A 1FNIA 1Z8IB 3E1XB 4RI0A 3SBKA 3VXFH 1GI8B 2YMSD 1O2LA 4AORA 1P2IA 4XSKU 4BTUB 4Q7YA 4INKA 1TONA 2OC0A 1O3GA 2GT8A 1P0SH 1SHYA 4I31A 3SNBA 2Z3CA 2FO9A 1FUJA 1F5LA 3UNQA 1GMDG 3MO9A 5T6GA 2C90B 3STJA 2P93A 3MWIU 3SU3A 4B6FA 1O3HA 1GHWH 1O5FH 1RGQA 1BMLA 1UTJA 4CRGA 1GI3A 1AKSB 2ZPRA 1BBRK 2YMSB 3RXFA 1AFQC 2P8OC 5IDKA 2Y81A 3EE7A 1KXFA 3W95A 3GDSA 5L2ZH 1W0YH 5DP3A 2DE9A 1D3QB 1C5LH 3UWJH 2FPZA 4GUXA 1GL1A 4BAMB 4ZKOU 1HAIH 3T5FH 3R0FA 3F9FA 2CG6A 1GJDB 4JZIA 7LPRA 1D6WA 4D76A 2FS8A 3TNSA 5C3NA 1F0SA 3SUGA 1NWVA 1CHOF 1MQ6A 4YIZA 3UWIA 1KXCA 2AFQB 4D9QA 1PQ8A 9ESTA 5E0GA 5EPNA 5F8TA 2G8TA 1EPTB 4NSVA 1LCYA 4K8BA 1KDQB 5EXNA 2VGCC 4CHAB 3BTQE 5EIYA 2D26C 1YKTA 4UEHH 1GBCA 4ABFA 1CE5A 2JDID 1BHXB 1TGCA 4I32A 2J92A 1O5GH 1OWEA 8ESTE 4I33A 5E2PA 3CI0J 3MH4A 5JBCS 3GY7A 3S0NA 1GMCG 1YLNA 2GDDA 2ZFSA 2GV7A 1TBRH 2OLGA 1W13U 1MMJN 3RC4A 4ASHA 1O3MA 3CENA 3KQ5A 3I77A 1SQTA 3PTNA 4E05H 3TIUA 5BRRE 1L4ZA 2FMJA 2WYGA 1FN6A 3PMHB 3WW7A 2EY4C 1HFDA 3QO6A 1Y5UT 3ZLDA 3OEDC 1P8VC 1J8AA 1O3AA 1VCPA 3NRLA 2VVVA 1O5AB 2QE7D 1NTPA 4AZ2B 4GPGA 1PPHE 1UJ1A 4X6MA 4VGCB 4B2RA 3NCLA 1VITF 2FYRA 1CA8B 1LKAA 4DVAU 2EI6A 2WPHS 2BDAA 1O2NA 1SLXB 2BB4A 2V0BA 1EB2A 3M3TA 3MI4A 4AYDA 4DT7B 2C93B 2WV5A 4I7YH 3NK8A 3ZRZA 3ITIA 1FPHH 1JOUB 2A2QH 1AUTC 1NRSH 3VXEH 3SO3A 4ZXXH 4A5TS 3ZVBA 4OM9A 4CR5A 2BLQA 2PHBA 1GBBA 1SL3A 1F0RA 2AGEX 2RLQA 2VVUA 2WYJA 3QZQA 2ZI2H 1FLEE 5CMXH 2EC9H 1TBZH 2STBE 2QF4A 1RJXB 3RXEA 1TPGA 4AYIA 1S6LA 3BEUA 2O8LA 1PFXC 3SW2B 4GLYA 2VIPA 3DSPA 2I6SA 2OXSA 1E0FD 1KMHB 1GJ5H 2FI4E 1HIAB 1OS8A 3URCA 1GCTC 1A4WH 4NIXA 4K1SA 3VGCB 5C20A 2GCTB 1V2TT 1P11E 1SQOA 2FODA 1F0UA 1LVYA 2Y8SA 4B1TA 4FUDA 1V2VT 3ZYEA 1O2SA 1G4GA 5L2YH 3KQCA 3SNAA 1SGYE 1UMAH 3F1SB 1H03P 4HG6A 3ATIA 2SGQE 2Q1JA 1ZOMA 2G7IA 2NU3E 2B9LA 2BY5X 2FI5E 2ZC9H 3JZ2B 1C9TA 3E3TA 4IMZA 3PMAB 3MNBA 1GI1A 1KXAA 2G00A 2ZGXH 1P01A 3MO6A 3FO8D 4Y8ZA 1XXFA 1WTGH 4NZLA 2ZHFH 1O33A 2B8OH 2FM2A 2QIQA 4AC9A 2SGEE 2ZU3A 4NA9H 3RC5A 3A80A 1G36A 1YPHC 4A1TA 1TGSZ 1WTHD 2J97A 2G5VA 5EQQA 3UR6A 5I46H 1T8MA 3QGJA 4AFUA 2KFWA 1ZMJA 2A4OA 4DY7B 1BBRE 3SZEA 1C1WH 5K0HA 2FOEA 3A7TA 1ZPCA 2WUCA 3DFLA 3LT3A 3RXOA 1NRNH 1LVOA 4MUCA 4WF8A 4MPWA 1OJYA 5HKKD 4BXWA 5EW2H 1NFYA 2Y7ZA 2BDYA 2GZ8A 3QTOH 4UD9H 2VWNA 3ZVFA 1CKLA 2BVSH 1G32B 1FBRA 1TYNA 1GMHG 4JZ1A 1YC0A 3OFND 3LJJA 3MH6A 3ERBA 4LZ4B 2XBWA 3F0PA 4FXGG 5JDUB 1MKXH 1GI5A 1MTUA 3RXAA 4ZHAA 4MNWA 1K0HA 2AGIX 1FY4A 2ZG0H 1ZPZA 5TCCA 1UCYH 4I86A 1F92A 1QY6A 3A7VA 4TPIZ 4Z0KA 3EGKH 1HAVA 3V13A 4NA8A 2KMSA 4RKJB 1TABE 4X2WA 4K3JA 4GCHF 5TCAA 2TRMA 3UQOA 1QGBA 3RM2H 3PV2A 1QA0A 2W3IA 1UVUH 2YBYA 1A0LA 3KXVA 1SMFE 1VJAU 1VZQH 1TNLA 2ULLA 3PWCA 4NWKA 1UVOA 1MAXA 1FY3A 2W5EA 1C5TA 2Y82A 7KMEH 1BTPA 1C5YB 2AS9A 3RXIA 2A5KA 2A7HA 1VR1H 4I8LA 1DDJA 2WIIC 2J98B 4A6LA 1SGQE 2GMTB 1TWXB 1OYTH 3M7QA 1GWAA 2V6NA 3OX7U 1S6FA 1TPSA 1Y3WA 1O5CB 1UTOA 1C1VH 2RA0A 1C1UH 4MSLA 3DSOA 5DGJA 3NJAA 2KRIA 3KYFA 2LELA 2F43B 4DG4A 1SKYE 2OCVB 1O2IA 2ZU4A 3TJVA 2ZPQA 1W14U 4B2AA 1Z1JA 2Z9LA 3S9CA 3MQLA 2FDAA 1JWTA 1FY8E 1S83A 4ABJA 1AGJA 1D3DB 1XM1A 1Q3XA 4KELA 2A0QB 3H7TA 1DWCH 2VWMA 3URDA 3SU0A 2TGAA 4F4OC 4CRCA 1TX8A 4OS6A 1TNJA 3ATMA 2WPLS 2LP6A 4VGCC 2W7SA 2DUCA 2ZHEH 2GTBA 2P94A 1QL9A 3K6YA 4MLFB 1P2OA 1QA7A 3FOAA 3GY6A 1C2LA 2P3TB 1EAWA 1J15A 4OGXA 5HIYA 3T26A 3UQVA 2A32A 1H8IH 3E8LA 1QRWA 4UFFH 1WOFA 1KDQA 2UWOA 1W3CA 1FIWA 2UUYA 3N99A 4ZROA 4JK6A 1F5RA 1W0KD 2CKUA 3O8EB 3LGUA 2JETB 1Z7KA 1GBEA 4TY6A 4D7FA 3TH2H 3SGAE 3EDXB 4FU9A 3RU4E 3ZYDA 1SGCA 4Y11E 5T3HA 2HNTF 5JPMG 2F9VA 1C5UA 3VFEA 3EA9A 1JMOH 1TMTH 4YO9A 1GHVH 8GCHF 1GVZA 2BDIA 2OC7A 2PUXB 4Q4LA 1SLVB 1NRRH 2RLPA 2XC0A 3ELAH 2A45B 1ACBE 1UTLM 1TQ7B 1Z1IA 3M5LA 1C5VA 4B75A 1GMDF 2BD9A 4ZHMU 1BDAA 3V3MA 2XRDA 1EAIA 3LDXH 1RIWC 2O9QA 1LHDH 4F48B 3U8RH 1HB0B 4DGJA 1MTWA 1C2MA 3TU7H 1NM6A 2CJIA 1EOLA 3BIUH 1N6YA 2ZU2A 2PR3A 2IZ3A 2VIDA 2VWOA 4ZCNA 1D3PB 4P00A 5FX6A 4Y71A 2LNCA 3C27B 2HWLB 2Z94A 7ESTE 1MZAA 1OOKB 4IGDA 1HGTH 3FP6E 2Y5GA 1E88A 2OINA 2ZFQH 3MHWU 3RUOA 3UNRA 5HYPA 2ALVA 2ZCKP 5GXPA 1AMHA 1MABB 5EPYA 2G4TA 3TLOA 3A7ZA 2UUKB 2ZGCA 2FOGA 1GJBB 3M7PA 2C8WB 4ABAA 1AWHB 5JBBS 5FXLA 1ARBA 1LVMA 3QN7A 4X8UH 1HCGA 3KQDA 1G3DA 2J4IA 1K1PA 1OWDA 4X6NA 3HK3B 4ONTD 1ETRH 4OS7A 1PPCE 1MKXK 1E8BA 2J34A 2PWXA 3MMGA 4TYDA 2K1QA 2NU1E 3AASA 1Z71A 4RT0A 3Q3XA 4RKOB 1QR3E 5JBTA 5C94A 1EZQA 1CA0C 2GCHG 3E16B 1A2CH 1GBDA 1ABIH 3OEHD 4JYVH 1IOEA 4JYUH 3V7TA 1P03A 1AVGH 1NU7B 4AYEA 1JIRA 3RC6A 1G37A 2XWBI 1LPZB 3LIWA 4FUGA 1UCYE 1AI8H 1MU6B 4ABIA 2TGTA 2BVRH 3G01A 4KP0A 2C4FH 4KTUA 1MBMA 3ZVAA 3U1JB 1ETSH 4OS2A 3SNDA 3E0NB 2ZFFH 4BAHB 1UO6A 1KXBA 4NIVA 3RXMA 2JETC 9LPRA 1CGIE 1V2LT 1GHZA 2A4RA 1E38B 1FZZA 3ZV9A 5A0BA 2QAAA 4P02A 4UONA 2CN0H 1NROH 3OY6U 4THNH 1ANCA 1JIMA 3GY8A 1C5ZB 5C2ZA 1IQKA 1IQLA 2LOJA 3GDUA 5DKMA 2KCAA 1NESE 5DN4A 2V7QD 3T2NA 1MCTA 2XBYA 1OK3A 1SBWA 3EYDA 4C16A 3FP8E 3PRBA 2FTMA 3N7EA 4LOTA 3M3VA 3BF6H 2YRAA 5L6NH 1GI0A 3BTDE 2Z9GA 2YNAA 1VGCC 2YNBA 1O32A 2ZHWH 2VJ1A 2VWLA 1P05A 2ZHDA 1AY6H 4Y6DA 1VITH 1HV7A 5K7RA 4KTSA 3UB0A 3LH1A 2QXGA 1ZSKA 1AFQB 2P8OB 2XBXA 2R3UA 3ATWA 4I8HA 5BPEA 3A85A 2SGFE 2OQ5A 5HM9A 2J9NA 1A0HB 4FUIA 2ALPA 3L33A 1ANDA 4ABDA 1FIZA 3RU4D 4PO7A 2GD4B 3S7HB 2GMTC 4DOQA 2PV9B 2Z9KA 1HXEH 4O3TA 4MVNA 1NO9H 1T32A 3AW0A 3BIVH 1GDQA 2JJ2D 3NKKA 4K60A 1ZLRA 1DLEA 5DP7A 2RFKC 3A86A 1AFEH 3QZRA 5E2OA 2Y5HA 4BAKB 2J95A 3FN8A 4ABHA 1C1TA 3MOCA 5A2MH 2PTCE 1SI5H 4NIWA 3P92A 1BIOA 5C67A 1MCVA 4CHAC 2HPQH 2AIPA 1EPTC 1TPOA 4UDWH 2A55A 1ZJDA 1O2OA 2OP9A 1JRTA 1DXWA 1V2OT 2RDLA 1O3JA 3ZD1A 2WUBA 1BTWA 3MO3A 1GHQB 1NT1A 7GCHG 1OYQA 1RFNA 5FPSA 5GIBA 2XW9A 1IQEA 1P57B 1MAYA 2ZKSA 1OP2A 5EQSA 2ZF0H 5EXLA 2QA9E 3TJOA 4NGAH 4K1TA 1IQHA 1WSSH 1O5BB 4X6OA 4X6PA 5AVDA 1O3LA 1GMHF 2VIWA 1AU8A 4HFPB 3OEED 4AB8A 3PMJA 5GDSH 1GI7B 1DS2E 1UVSH 1W2KH 2Y6TA 5DN6D 3TK9A 1KXDA 4J2YB 3SI3H 3PO1C 1GHYH 4E7NA 3MQKC 3GCOA 2GX4A 2GV6A 2FP7B 5G4BA 1T4VH 2FOBA 2AGGX 3SU2A 3Q77A 4FUEA 4DJZA 2BOKA 2VIVA 1QIXB 1N8OB 2BD8A 1BITA 1ELEE 1WUNH 1MZDA 1C5NH 3SUFA 1XUHA 4KGAA 3T29A 3ZZ4A 3T28A 3VB5A 2G52A 2Q6GA 3F3BA 3N7OA 1H4WA 2ODPA 5EJZA 4ABBA 1Z8RA 1FDPA 3R62A 4O03A 1ELBA 2Y7XA 2F9NA 5DP8A 4O97A 1O36A 3PV5A 3RU4T 2SGAA 3UOUA 5EW1H 1PQ5A 3KEEA 2VINA 1LMWB 2C8YB 2Q6DA 4JHSA 1GBTA 1ESAA 3BEFB 2CGAA 1T4UH 4NCYA 4ZH1D 1TGBA 4TWWA 4CH8B 2ZGJA 1BUIA 1P9SA 2VIQA 4WXIA 1EJAA 1HRTH 3RMOH 4ZKSU 1IQJA 4O9VA 3UNSA 1ZMNA 4CREA 3FANA 3P17H 1T31A 1O2VA 4IC6A 1YCPM 1P3EA 1P02A 1EX3A 2BZ6H 1ZHMA 4OS1A 1E1QD 4BANB 1DE7H 3MH5A 1QNJA 4YESB 3ZZ8A 5LPRA 1RXPA 1DPOA 3MYWA 3ODDA 1DWBH 2ZECA 1O35A 1QJ1B 3AVZA 3MH7A 1N8OC 2FOAA 3U69H 1HJAC 1CT2E 1MU8B 2BDGA 3D23A 3N7DA 1XUGA 4N7EA 1T8LA 4H42U 3W94A 1C5XB 2OQUA 4A92A 1XX9A 1G4FA 2AYWA 2G81E 3PMBB 2BX4A 2WPIS 2XRBA 1AB9C 1GMCF 3SN8A 3KQBA 3ZZAA 2FX4A 2A31A 4F55A 1FY1A 1D6RA 3ZLEA 1QUBA 2X2ZA 3DHKH 2BDCA 2IOTA 2VH6A 3V0XA 4LZ1H 3KF2A 1EJMA 1VITG 5DP5A 5CE1A 2EQNA 2AEIH 1OJWA 1C4V2 4AG1A 3SV6A 2W7UA 1OPHB 3F0OA 3DSGA 2XYAA 4WH6A 1GBIA 2BVXH 2EC3A 5ABWA 1ESTA 1XKBC 1MTSA 2ZZUH 6CHAC 4AFSA 1OKXA 3A83A 2UUJB 3UAIC 2FEQH 3KN2A 3ZZ5A 1RLHA 5C0TA 5JBAS 1O3EA 2BZAA 3PO1B 1XVOA 1NFXA 2KX4A 4XBBA 1PYTC 3OXUD 2J2UA 3EA7A 1C5RA 1ZTKA 1E5GA 1HAXB 3RXKA 1TB6H 3RXDA 4CH2B 1QQUA 4WMDA 1UHBB 2ZP0H 3SGQE 1PPBH 2CHAB 3BN9A 1NPMA 1ID5H 2I6QA 5FHTA 2G4UA 3F9EA 4LXBH 4GAWA 1C2FA 4AYYB 4JK5A 2H6MA 3MTYA 1ELCA 2KCPA 3SI4H 2WPKS 2EI7A 4YOJA 1SGTA 2BY8X 1KLIH 3TVJA 1H2PP 4ABGA 1OWKA 1OXGA 1BMFD 2GCTC 2JJ1D 1DM4B 1GI2A 1BB0B 5DJ7A 1Z8JB 1O2UA 1Y3XA 3WWBA 3ZZBA 1QL8A 1C5QA 1Q31A 1GHAF 3SU6A 4MPXA 3ZZ7A 5A8XA 1O2HA 5FL7D 3SV8A 2FOCA 4TPYA 1HJ9A 1EQ9A 4MPUA 1SQAA 1A5GH 1O3IA 1AQ7A 2CMYA 4M9FA 2JGWA 1V6DA 5HGGA 4AGJA 1JBUH 3FGTA 1SPJA 1BTUA 1E34B 1C2KA 3CALA 3ZV8A 2KR7A 3OY5U 2BD7A 3MU4A 2VB0A 5C0UA 4JYTA 5B6LA 2XTTB 4AOQA 3O8CA 4AYMA 1XMNB 3UFAA 3LGVA 1UCYK 2Y8RA 1WV7H 4BOHA 1FJSA 4J1YA 2AMDA 1AB9B 4HZHA 4X8TH 4BWCA 2QCYA 5HM2A 1GJCB 1MTVA 4AYVB 3A82A 1K1JA 1S5SA 4FU8A 4RN6A 1EZSC 5I25A 1W7GH 3SNEA 2PW8H 1Y5BT 3QUMP 5F6MA 1NC6A 1EB1H 2Z6BD 2F9OA 2ZDAH 5ESBA 1O9AA 2F9PA 2PKSB 3T27A 1TX6A 4J38B 2XQWC 5KGOA 1CBWB 1ZPBA 2BLOA 4ZH8A 1FI8A 3KGPA 1S0QA 2WV4A 5F8XA 3SW0X 4B2SA 1KSNA 2MCZA 1C2IA 1TX7A 1EAXA 1Z6JH 1K9OE 1IAUA 1GHBG 6CHAB 1QBNA 3ZZDA 1KTTB 3RP2A 3AAVA 3BEIB 1YPGH 4Y8XA 1S6HA 2P59A 3M5MA 5EGMA 1ZR0A 3U8OH 3SNCA 2A7JA 1MQ5A 1IHTH 4DJZB 2Y80A 4NWLA 2MCYA 1NRPH 4B73A 5HYUB 3FFGA 2BD4A 3BG4B 4LOSA 4BNRA 1QO6A 1QHRB 2FI3E 4OGYA 1W7XH 1P2MA 1TOMH 1TLDA 5HYOA 1OP8A 1RD3B 1A3BH 4MPVA 3I78A 1U6QA 2XXLA 4K12A 1ZGVA 2GVFA 2PSYA 1C1NA 2W6ID 5JPMH 3ZZ9A 3T25A 2W26A 2QY0B 3TNTA 2ZFRH 3LGWA 3TGKE 1PQ7A 1A5HA 2RKZA 1SHHB 1E1RD 3GCHC 1NRQH 1DUAA 3P8FA 1KLJH 1GJ4H 2PSXA 4JZFH 3U1IB 2K8IA 1NFWA 1OX1A 1GPZA 3IG6B 3ZZ6A 3TGJE 4K1EA 1SGFA 1O3KA 1YPKH 2ZQ1A 1MD7A 1DUEA 1C2GA 4Y0YE 1UK2A 1F2SE 1LY2A 1BBRH 1IQNA 1H8DH 1Y59T 2ASUB 2IPHA 2KCYA 1CSOE 1HDTH 1CVWH 3M36A 1C2HA 4IW4E 4YLUA 5LPEA 3NFPI 1CU1A 1O31A 1O38A 1A5IA 1UK3A 2J5UA 1YLDA 1HXFH 5FBIA 2BLVA 3Q3YA 3SJ9A 3AK5A 2W81A 1O34A 5T1VA 1O0DH 3LC3A 3BV9B 1B0EA 1GI6A 1Y3VA 4X2VA 5EJ1A 3F9GA 1QZ8A 5DP4A 2C8XB 1NU9A 3PROA 2CHAC 3D49H 1Y5AT 4APLA 2BTCE 4HI3A 2AIQA 2AHME 1OWIA 1EZUC 4YTAA 1BT7A 5C1YA 2WV9A 5DP6A 1DVAH 3P8GA 2THFB 1K1OA 1L0ZA 5FPYA 3S69A 1ANEA 1MBQA 4SGAE 3ZIAD 4XRNA 1O37A 4ISLA 4Y76A 3H09A 2R3YA 2AMPA 2XBVA 3B23B 5C5OA 4BTIB 4E06H 3SUDA 2ZHQH 1HPGA 1CBWC 1K1LA 3VB3A 1S85A 5FPTA 2ODYB 3TGIE 2HRVA 1MKWK 3NZIA 1QJ6B 4NFFA 2FZZA 4K5ZA 3DD2H 2JKHA 1SVPA 1O2ZA 1X7AC 5EJLA 1P04A 4XOJA 1VCWA 1RTLA 1NY22 1GI9B 5J4QA 1O3DA 5GPIB 2AH4X 1WAYB 5HIZA 1VVCA 1HBTH 1EPTA 3PLPA 4XBCA 4ZKNU 1KY9A 1O2TA 4CR9A 1NBMD 4ASUD 5J4SA 1H8ED 1AHTH 1TIOA 2WHXA 2ZDKA 3KCGH 3PB1E 2Y8TA 1L2EA 1QB9A 5IYTA 2HGTH 1BCUH 1UTNA 2ZO3H 2HOBA 4D7GA 4UFGH 1GBMA 2FESH 3RM0H 1CO7E 4K8YA 2ZEBA 4CRFA 5E0HA 4MNXA 1BOQA 3ZD2A 1H9IE 2GJGA 2JH6D 4FOUC 2HLCA 3OAAD 4B74A 3VB6A 2AMQA 3LGYA 3RLWH 1ZJKA 2Y5FA 2GKVE 1WDIA 1GJ8B 1GCDA 2V3MA 1YP9A 2O39C 1WQVH 4ISNA 2BM2A 3IWMA 2VGCB 2BY9X 3GOVB 3P6ZB 1AZZA 4MNYA 3MNCA 1SOZA 1JRSA 2CXVA 3OTJE 1A3EH 2F91A 3HKJB 2RA3A 2KAIA 1W0JD 2R0KA 4WMEA 2W6JD 2PKSC 1TRMA 3HGPA 3FVFB 4WVPE 3RXBA 4U2WA 1MH0A 2SNWA 4WWYA 2HVYB 1VCQA 3L6PA 1ZTLA 1LQDB 1Y8TA 2A7CA 2V3OH 2QXHA 3BG4C 4FUCA 3VGCC 1P2KA 4CSYA 4UE7H 4NFEA 4ISIH 2AERH
chains in the Genus database with same CATH topology
1S0RA 1G3BA 4XE4A 2HALA 4YOIA 2BHGA 1C5WB 3ATLA 2FOHA 5ETXA 3GDVA 1IQMA 1WU1A 1E36B 4QT8C 1TRNA 3LU9B 4ABEA 2WPMS 3PWBA 1EOJA 1GBJA 2FOMB 3BTHE 4H6SB 1XUKA 4FUHA 1INCA 4BAOB 5C5NA 5E0JA 1TMUH 1GVKB 1LHEH 2UWNA 3D65E 1DY9A 5C1XA 3KZJA 1FV9A 1Z92B 1GJ9B 3M5NA 4A1XA 3UIRA 3BTME 1PQAA 2BD3A 4ZMAH 4LOYH 3F68H 1Q2WA 4X1PU 1SS2A 1K1MA 1ZHRA 4XFQA 1DWDH 1K21H 2A1DB 1IQFA 4WJG2 1TGNA 3LONA 1AO5A 4D8NA 3GCTG 1QQ4A 1SGNE 3F9HA 3S9BA 3SV9A 2G55A 5AFZH 2G51A 4OS5A 3ZVCA 2A4GA 1TNHA 3E90B 1F5KU 1HAZB 2KAIB 1THSH 3M37A 2ZDNA 1PPQA 8GCHG 2GP9B 5H4IB 1MTNB 1CT4E 2H9HA 5EG4A 1LO6A 3GY5A 1EP5A 3HGNA 3GOVA 1GHAG 1RTFB 1OK1A 1TAWA 3K2UA 4WXVA 4K2YA 3SGBE 3TITA 1TBQH 2NU4E 3MU8A 4JMYA 2BD5A 3SHAH 1XKAC 3KQEA 1O5EH 1V2PT 2TGPZ 2ZTXA 1DLKB 1N6XA 1BQYA 1C1QA 3NWUA 4PROA 2NU0E 1EZXC 1LPKB 5LGOA 4I8KA 2H5DA 3RLYH 4ESTE 1L1GA 1MUEB 4I8JA 2FLBH 1EASA 3GY3A 3A87A 5EOKA 3CS0A 1LKBA 3IU3I 3T62A 1GG6B 2A5IA 1QBVH 4Q2KA 1G9IE 2ZA5A 3UOPA 1TPAE 1O2YA 3SU4A 3SV2H 1TFXA 1SGEE 2QV1A 4AFZA 1QGFA 5I0QB 2BY6X 1DANH 2CF8H 4LK4A 4KTCA 1G3EA 1TMBH 2FOFA 1C1MA 2GDEH 2D1JA 2EI8A 4AX9H 1ABJH 1XUJA 4ZXYH 1PPEE 2ZU1A 1S81A 1SOTA 5DG6A 4GHQA 1SG8B 3RMLH 4HTCH 1O39A 1ORFA 1YPMH 2VH0A 2BX3A 2HPPH 1WCZA 2QC2A 1XVMA 2JH0D 2PTNA 1P2NA 3M7UA 1GBHA 4ISOA 4H4FA 2ANMH 3RXHA 2XWAA 1XUIA 2F9BH 2H1UA 3IITA 1BA8B 1O3CA 1AE8H 1LHFH 2ESTE 1J16A 4X1RU 3LPRA 1LVBA 1SLUB 2QGRA 5DK1A 1VJ9U 1BTZA 5JB9S 1G2LA 1FQ3A 1J9CH 2P3FH 5A8ZA 1YPLH 1HLTH 1SFIA 2GZ9A 1C5OH 2F9UA 2QN5T 1MD8A 6ESTA 1ZYOA 2VVCA 3PTBA 5LPFA 3DFJA 1C1RA 4X2YA 2ZTZA 1THPB 3RDZA 1S82A 3VB7A 3A81A 3A8CA 1OJVA 1EUFA 3RXGA 5DPAA 1K1IA 3PYHA 2BQ7B 2SFAA 4MNVA 3RXCA 1GHXH 6GCHG 1ZZZA 1P2JA 4TY7A 3M5OA 1HYLA 1HJ8A 2OUAA 4YOGA 4NG9H 5EODA 3L3TA 1W11U 1G30B 2A5AA 1C2DA 4GHTA 4JZEH 4MDSA 1T8NA 3P70B 2FWWA 1BTXA 1MTNC 1HFIA 3TK5A 1UHBA 3IX0A 3A8DA 1CA0B 3MU0A 4JCNA 8LPRA 4M7GA 2H9EH 2RCEA 4AN7A 1ZMLA 1Y3YA 4Q7ZA 3DT0H 3V12A 3ZVGA 2M5TA 5SGAE 4KKDA 1ZSLA 1QB6A 1XUFA 2XCNA 1QRZA 1C4Y2 4A7IB 1GJAB 1OWHA 5CHAC 5F03A 1TQ0B 2O8TA 2BYAX 2IN2A 1D4PB 1P12E 1T8OA 2JRAA 1H9HE 1RIWB 1S84A 3SUEA 4B71A 2BOHB 1TALA 1ZRKA 1GBKA 1EKBB 2R9PA 5A09A 5F8ZA 3QLPH 3EJHA 4IBLH 2DE8A 3SU1A 1HUTH 1V2ST 2XC4A 3EAJA 4IMQA 3U98H 4GCHG 3RXVA 1LTOA 4OS4A 2QY0A 3RXPA 1ELTA 2O8WA 1G2MA 1YPEH 3RXLA 1SR5C 2BQWB 2XC5A 3NXPA 3BTFE 2BZMA 1YLCA 5GWZA 3FZDA 1SFQB 2PKAA 4CBNA 1SGIB 1HFHA 3UR9A 5L30H 1C1OA 1L4DA 5A8YA 4MQAA 1KIGH 1FMGA 2OBQA 3O8BA 1KLTA 3OYPA 4XDEA 3OSYA 3E0PB 1B7XB 4ZHLU 4ZKRU 3QDZB 1AN1E 3KL6A 3SJIA 1UVPA 2ANKH 1C1SA 1HAOH 1GBFA 4AG2A 1O3PB 5GCHF 1V2JT 1GCTB 2RG3A 2C8ZB 1A0JA 2XRCA 3BSQA 1SGFG 2BMGB 1GJ6A 1BTYA 1K2I1 2IZ4A 1P06A 3SJ8A 5AHGH 1HAVB 2R2WU 2Z9JA 1TRYA 2HNTE 1HAPH 1HIAA 3E91A 2PGQB 4NA7A 4TWYA 2UWPA 3GY4A 2ZDLA 4CBOA 1V2UT 1BZXE 1HAHH 5LH8A 1QRXA 3LGIA 1EJNA 3VPKA 1UTQA 6LPRA 1V3XA 2W3KA 1Y3UA 2ANWA 1LPGB 4Z6AH 3UUZA 1O2RA 5AF9H 2F3CE 1GL0E 4NZQA 3CS7A 3ATKA 3SHCH 3U9AH 2SGPE 3A7XA 1FONA 1PPGE 2J94A 3D62A 1QB1A 3A7YA 4YZUA 2QXIA 1ELAA 1ELDE 2ZCLP 2ZGHA 1YF4A 5T6FA 3QGNB 1Z8GA 1SC8U 1L1NA 3RMNH 4X2XA 2ZGBH 3A89A 1GBAA 2F83A 1BTHH 3S9AA 3LOXA 3SQEE 3TPIZ 3TVJB 4YM9A 3Q00A 4FUBA 1ZGIA 2FIRH 3A7WA 3Q76A 3EE0B 3SORA 2PKAB 1UTPA 4X1QU 3TK6A 2PUQH 4INLA 1DSTA 1C2EA 1OP0A 2STAE 2ZNKH 2P3UB 2FS9A 1YM0A 2Z7FE 2CV3A 2ZQ2A 1QBOA 5FCRA 4B2CA 3GICB 1DSUA 2ZU5A 1HAGE 1TOCB 2CG7A 3FZZA 2P95A 4YLQH 4R8TB 2ANYA 2J38A 2PLXA 3LKWA 1PYTD 2HVXA 3SJOA 1AWFH 2W80A 1O3BA 1RRKA 1RS0A 3UPEA 1N1LA 1P3CA 3ESTA 4MTBA 2BY7X 3A8BA 4BAQB 1HNEE 1THRH 1ZSJA 2FTLE 2CF9H 3ZZ3A 3PLKA 2TGDA 3BG8A 3GXEA 5JB8S 3NUMA 2IJOB 1B5GH 1DICA 5FBEA 3B9FH 1A7SA 1TPPA 1O2MA 1D9IA 1TGTA 1SRZA 1ELVA 3B8JA 3UREA 1H2QP 4CRBA 5E8EH 1EATA 3K9XB 1TA2A 5HMAA 1DITH 5PTPA 1A1RA 2PFEA 4U01A 5C1UA 1UOTP 4AB9A 2V8EA 4FUJA 1K22H 2XWJI 2V3HH 4X1NU 3T5OA 3ENSB 3A84A 1AVXA 1OK9A 1HCCA 2OBOA 1DT2A 3QX5H 4GSOA 1C1PA 1TNKA 3KHVA 3QK1A 4X8SH 2FYQA 2OD3B 5FX5A 1SGPE 2R2MB 2JGXA 3RXQA 3DA9B 2B5TB 1VGCB 1G3CA 2EEKA 1DX5M 2R0LA 2TBSA 4BTTB 3A8AA 5B6OA 1HAYB 3RXJA 1J14A 2EA3A 1EXFA 5T6DA 4CRAA 1O2GH 1C5MD 1KTSB 3EA8A 1VVDA 5A0AE 1ELGA 1V2WT 3GCNA 1FAXA 2XCFA 5HYTB 4A5WB 3P95A 4IN1A 1NN6A 1O3OA 1FN8A 4YNXA 4SGBE 2LPRA 4FVDA 4DW2U 1P10A 4Y79A 5HXFA 1TPNA 5A0CA 1K28D 2VNTA 1P2QA 1BRBE 4JZDH 2ILNA 2Z3DA 1A61H 3ZZCA 4H6TA 1GI4A 3R3GB 2EHFA 1IHSH 3TH3H 4WMFA 1TNIA 1H04P 1YGCH 4HGCA 1QL7A 4DURA 4X8VH 2NU2E 2Q6FA 3INBC 3RXUA 2GZ7A 3LJOA 1P9UA 1ZRBA 3AW1A 4ZUHA 3FAOA 1UK4A 3GYLB 1CHOG 2ZWLH 1DFPA 3FP7E 3K65B 1JXPA 1UTMA 2OTVA 2P16A 1TA6A 4IS5A 3RXSA 2H9TH 1CQQA 2GGVB 5DP9A 2BXTH 3EQ0H 3SQHE 4I8GA 5ESTE 4DCDA 5DO4H 3MNSA 1IQGA 1V2KT 3GY2A 1FY5A 4Y0ZE 1BJVA 1DXPA 1PJPA 3BTEE 4DIIH 1O30A 1BRAA 4NSYA 1BMAA 1NZQH 1AZ8A 2H2ZA 1V2MT 5GCHG 5GJ4B 1BMMH 4DIHH 3ODFA 1WBGB 3H7OA 1AKSA 3RXRA 1DWEH 5JYIA 2BDHA 1C1ZA 3L89M 1L1JA 2TIOA 2Z9IA 1OSSA 5EQRA 3A88A 3TH4H 3AAUA 4BXSA 1C5SA 3LH3A 3M35A 1LDTT 1OK2A 1B0FA 4MG3A 1CGJE 1M9UA 1BRUP 4YT6H 1W0ZU 4AGKA 3E6PH 2RKYA 4AFQA 3ZVDA 1C5PA 1ESBA 2OC1A 3KNXA 1LHCH 2FXRA 1PPFE 3NPSA 1AIXH 1SB1H 1RTKA 1E37B 2GCHF 2XNIA 4CRDA 1KXEA 3P8OA 5HZPB 4XBDA 2TPIZ 3GYMA 3HKIB 1GDNA 3SV7A 1J17T 2QYIA 3KIDU 8KME2 5TJXA 1O3FA 1K1NA 2B0FA 3I29A 3RXTA 4RSPA 2ZTYA 1V2RT 1SLWB 3BTGE 1GVLA 3SJKA 4U32A 3UTUH 2BD2A 1YPHE 3OP8A 1TE0A 5EU8A 1GGDC 3SOSA 1E35B 1GHBF 1SSXA 1ETTH 1XXDA 2FX6A 4F49A 3GISB 5AFYH 4FXGH 3PV4A 4U30A 2NWNA 3M7TA 4INHA 2WPJS 4PZ5A 2O8MA 1AD8H 2BXUH 3P8NA 2B7DH 1F0TA 4ISHH 1O5DH 4X0WU 1UVTH 1A46H 1ANBA 1GJ7B 4E7RG 1LHGH 2SGDE 2D8WA 3MNXA 1DOJA 3O8RA 3CP7A 4WY3A 1C2JA 1BRCE 3RJ3D 3STIA 1HJAB 1NFUA 4IN2A 2V35A 2JH5D 1O2QA 2QF0A 2C3SA 1IQIA 2BDBA 1AUJA 5FO8C 1C4U2 3PLBA 1GKNA 1PPZA 3MFJA 3SU5A 1C9PA 2RL0A 2HNTC 2UUFB 3H5CB 4Q7XA 4K69A 2D2DA 2BLWA 2SNVA 2PGBB 1SGRE 1W12U 1CT0E 1OWJA 3JZ1B 4Y7AA 5FAHA 4Y10E 1ARCA 4O3UA 4Y8YA 1O2XA 1O3NA 1TNGA 1MKWH 4UFDH 1T7CA 5FCKA 3M61U 3QWCH 1YBWA 1F7ZA 1ZTJA 2B5ID 2ERJA 1AVWA 1BJUA