3IX0A

Crystal structure of human seminal plasma protein psp94
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
87
Chain Sequence
SCYFIPNEGKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of prostate secretory protein PSP94 shows an edge-to-edge association of two monomers to form a homodimer
pubmed doi rcsb
molecule tags Antitumor protein, apoptosis
molecule keywords Beta-microseminoprotein
total genus 13
structure length 87
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ix0A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ix0A02
4MUCA 5HYUB 1SS2A 4PZ5A 1GKNA 4AYMA 1E8BA 1G4GA 1C1ZA 5FO8C 1GPZA 2ERJA 1CKLA 2JRAA 1QGBA 2RKZA 4B2RA 2BZMA 5HZPB 3MQLA 3NFPI 4K12A 2B5ID 2JGWA 2WIIC 4JHSA 2UWNA 1O9AA 3ERBA 2IZ3A 1OJWA 4F4OC 4C16A 2W81A 3RJ3D 1TPGA 1OK3A 3OEDC 1UOTP 4YNXA 4KKDA 1QO6A 2V8EA 4B2SA 3GXEA 3OP8A 2CKUA 2EHFA 1U5MA 1H2QP 4AYIA 5HYTB 3ZD1A 2RKYA 2KMSA 4FXGG 1GKGA 1H04P 3OXUD 2A55A 1H03P 1PPQA 3M7PA 1ZJKA 3INBC 4A5WB 1VVDA 3L89M 4AYDA 1LY2A 1OK9A 3TVJA 1H2PP 1E88A 2YBYA 2CG7A 3IU3I 2RLPA 4WJG2 3KZJA 1E5GA 3O8EB 4LOTA 1MD8A 4CSYA 3T5OA 3IX0A 1HFHA 2RLQA 4ONTD 2W80A 1MD7A 1QUBA 3R62A 5HYPA 2XRBA 1OJVA 1SRZA 1Q3XA 1NWVA 1OK1A 1G4FA 2YRAA 2EC3A 4LOSA 1FBRA 3GOVA 4AYEA 2O39C 1OJYA 3ZRZA 2G7IA 5I0QB 3EJHA 2KRIA 2XRDA 2XWBF 4ZH1D 2IZ4A 3KXVA 2XWJI 1VVCA 2RL0A 1OK2A 4IGDA 2XQWC 3CALA 1Z92B 3ZD2A 2MCZA 1HFIA 2MCYA 1HCCA 1TPMA 2LOJA 2QY0A 2CG6A 4J38B 4DJZA 2JGXA 1GHQB 1ELVA 1TPNA 3SW0X 5JPMG
chains in the Genus database with same CATH superfamily
1Q7Y1 2NVYI 5HYUB 1ZB9A 3FKII 2PK7A 2E2HI 1K9M1 1ZB8A 1GKNA 3I551 2GU2A 2Y8SA 5D1OA 3S17I 2KI7B 1GPZA 1YIJ1 2DE5A 4CL1A 1I50I 3CI0J 1NJI2 2OZKA 3MQLA 1TWHI 2F4OA 2UWNA 4NBDA 2PMZA 3H0GI 2QREB 1VQ7Z 4BY1I 3CCJZ 4BBSI 3GTQI 1VQM1 3JAMb 2K3RA 3G71Z 3J81b 1TPGA 1OK3A 4RS4A 2V8KA 2X2ZA 2AYDA 4A3EI 4B2SA 3GXEA 1VLAA 3J80b 2EHFA 3ESWA 5T64A 1M1K2 3CPWY 5A2Qf 4AYIA 2QA41 1GKGA 1USPA 3VWOA 1X3WA 4XX2A 3S2HI 1H03P 3I56Z 3INBC 1PFTA 3HOVI 4AYDA 2JS4A 2JMOA 4A3LI 3CXCZ 2QEX1 3TVJA 1YJWZ 2CG7A 4E30A 3S1RI 3O8EB 2RBLA 2F4MA 3IX0A 3CCQ1 3S16I 5IT9f 2P3YA 4A3BI 4ONTD 3VMHA 3GCFA 3CCE1 3R62A 2W03A 3GKQA 2E2JI 3OW2Y 1M1K1 1TFIA 2NVQI 1QYPA 5C4JI 1VQ71 5D1OB 5FLXf 2G2KA 1S72Z 4E32A 1Q811 3S1QI 2O39C 2G7IA 5I0QB 1KC81 2QRDB 2V8IA 1NP6A 3NH5A 3KXVA 3TE5B 5C3EI 2H85A 4IGDA 2XQWC 1TWCI 1VQO1 4A3JI 1VQ4Z 1RO0A 3ZD2A 2OTL1 1QVFZ 1TPMA 2LOJA 2QY0A 2CG6A 4DJZA 3CC4Z 2Y8TA 1GHQB 2VUMI 3OW2Z 5JPMG 4MH4A 3HOYI 3GTMS 3BG1B 4MUCA 1KD11 4Y52I 1Q861 1YHQ1 1K731 1C1ZA 1VQOZ 4E2ZA 3CCV1 5FO8C 1YJ91 1RLHA 2I3CA 1CKLA 3IFUA 1RLYA 1K8A1 1WZNA 3CCJ1 2BZMA 1W2BY 3NFPI 1AA6A 4K12A 2B5ID 1WIIA 2HU9A 1KD12 3G711 2IZ3A 2QKDA 2JIPA 5IT9b 2NVTI 3M4OI 1YI2Z 1VQNZ 1P9NA 1WCMI 1ZH1A 4NBAA 1UOTP 4MD7A 2OTJ1 2V45A 3NDIA 2CKUA 4A3KI 1VQ81 1U5MA 1YUKA 3GTLI 5HYTB 3ZD1A 2V3VA 4BBRI 2KMSA 3CME1 3HOZI 3OXUD 2E9HA 2A55A 3RZOI 3CC41 3I55Z 1PPQA 2DE6A 3G6E1 2V8JA 3KIHA 4HH4A 4RVHA 4MXUA 2DE7A 3PO2I 4DQYB 1JWHC 5A2Qb 2OTJZ 1YJNZ 1VQ8Z 1Q7Y2 2M48A 2VPYA 2YBYA 3MONA 4RVGA 2E7ZA 3HKZA 3CCMZ 2R6MA 1HFHA 2EGTA 2JA6I 2J6AA 1NJI1 2W80A 3CCSZ 2B63I 2XRBA 1OJVA 3VMIA 1M902 2RHBA 1NWVA 1OK1A 3D2LA 2ZAEB 2YU9I 1VQ61 3LUSA 2OOXB 4AYEA 3HOXI 4NFRA 3CCLZ 1SFOI 2W04A 3WSXA 3EJHA 4BXXI 3FQMA 4MD8A 2IZ4A 2QEXZ 4TNUA 2R7ZI 3M3YI 2VPXA 1VQ91 3CALA 1K9M2 2MCZA 4EWCA 2MCYA 2JA5I 1USPB 1Q812 1QVGY 2Y8RA 2BJOA 1TPNA 3SW0X 1L1OC 2JNYA 3I07A 3K3TA 4NBHA 5FLXb 1JJ2Y 2JIQA 4E2YA 1Q822 4RVFA 5FLMI 1TWAI 2LIYA 4AYMA 1E8BA 1VQL1 2VF1A 4Y7NI 3MZLB 1Y1VI 3CC2Z 3CMAZ 3WSYA 1Z03A 3IR7A 4HGZA 4E33A 3GTPI 4BY7I 3CCR1 2ERJA 1X3ZA 1QGBA 1YI21 1Y1WI 3CCL1 3CCEZ 3KIFA 4NBEA 3F3FC 1QF8A 1S721 4PO7A 1O9AA 3ERBA 3CCS1 4A3DI 3NJAA 2JA7I 2Y0SA 5C4XI 2Q4ZA 3VB9A 1Y8CA 1M901 2VPZA 5T67A 2W81A 4APLA 3CC21 5D1PA 2I2LA 1LQLA 2IV2X 4DK1A 1KC82 3CD6Z 4NBFA 2NVXI 2GTHA 2OOYB 1VQP1 2JUBA 2V8EA 1VQ5Z 3S2DI 1YJW1 5T6BA 3JAMf 3HOWI 2GTIA 2ZYCA 1QXFA 2M6NA 3BG0B 3CCVZ 1Q862 3S1MI 3IF8A 2R92I 2RKYA 4FXGG 1H04P 3EEDA 3CQZI 2AKLA 1S7MA 5IP9I 1N2FA 1YHQZ 2YADA 4A3CI 4E2XA 1W2BZ 1VQ41 3Q87A 1VQ51 1N8R1 1LY2A 1OK9A 3NH8A 4YIZA 4NBGA 1H2PP 2JIMA 1Z01A 1K83I 3IU3I 2RLPA 4MONA 4N7EA 1E5GA 3PO3I 1DL6A 4LOTA 2RIQA 5IP7I 3GTKI 1Y1VS 2O53A 3FGTA 1MD8A 3D9XA 2RLQA 1N8R2 3I4MI 5DN4A 1Q821 1NUIA 1QUBA 5HYPA 1VQ6Z 4QTTA 1SRZA 4MRIA 3CC7Z 2YRAA 2EC3A 2JR6A 4X6AI 1OJYA 2WB1A 4NH1C 2KRIA 3S15I 2RL0A 1YJ9Z 1OK2A 1YUAA 1X0TA 1KRLA 2QR1B 1HFIA 1RNIA 2JIRA 1RO2A 1HCCA 3G6EZ 1YJN1 2QA4Z 3T4NB 4AYBA 4NBBA 2JGXA 1ELVA 1KQSZ 1I3QI 1RQFA 1QVFY 3NDJA 2JIOA 1FDIA 3G4SZ 3PO3S 4BWCA 3QWUA 2QLVB 3J80f 1SS2A 4PZ5A 3U50C 4A3FI 1G4GA 4RVDA 1FDOA 2VPWA 3D6WA 2PM9A 2JRAA 2QRCB 1WJ2A 3VTNA 1VQ9Z 2RKZA 4B2RA 5C44I 4A3II 5HZPB 1K8A2 2JGWA 2WIIC 4JHSA 1Z02A 3S14I 1OJWA 4E2WA 1K732 3VMGA 5LL6f 3CD61 1R9TI 4F4OC 2RPRA 3CCQZ 3GTOI 4C16A 1WW9A 1RO4A 2E2II 3S1NI 4MSLA 3RJ3D 4A93I 4NB9A 3GTGI 3CPWZ 3F3PC 3OEDC 1SIWA 3MZKB 3TDHB 4A3MI 2HF1A 1VQK1 4YNXA 4KKDA 1QO6A 3OP8A 3CXCY 3G4S1 4NBCA 1H2QP 5CM2M 1YIJZ 3FGRA 5AN9F 2R93I 3P5JB 1JJ2Z 3RZDI 2KPIA 2Q51A 3M7PA 1ZJKA 1YITZ 2OTLZ 4A5WB 4MD9A 1VVDA 3L89M 1YIT1 3I561 1E88A 1VQPZ 4QTUA 3HOUI 4WJG2 3KZJA 2JA8I 4NB8A 1ML8A 1VQN1 2K5RA 4CSYA 3CCUZ 3T5OA 4NOZA 3I4NI 1VQMZ 4S1TA 4E31A 1MD7A 2VUGA 3CC71 1VQKZ 3GTMI 3ZLEA 2O4HA 2WAQA 1Q3XA 4HGYA 1KQSY 3FQQA 1QVGZ 1G4FA 4A3GI 4LOSA 1TWFI 1FBRA 3J81f 3GOVA 2RT9A 3ZRZA 3NFZA 3CCU1 2NAPA 3CCM1 2XRDA 2XWBF 3GTJI 4ZH1D 2LFUA 2XWJI 1I6HI 1TWGI 2P28A 1VVCA 3NH4A 3EERA 3F6KA 4RV9A 1Z92B 3CCRZ 1VQLZ 2LEXA 5DN5A 3CMA1 3H3VJ 4J38B 3J7A4 1Q16A 3ZLDA 4DGLA 3K7AI 3CMEZ
chains in the Genus database with same CATH topology
1Q7Y1 2NVYI 5HYUB 1ZB9A 3FKII 2PK7A 2E2HI 1K9M1 1ZB8A 1GKNA 3I551 2GU2A 5D1OA 3S17I 2KI7B 1GPZA 1YIJ1 2DE5A 4CL1A 1I50I 1NJI2 2OZKA 3MQLA 1TWHI 2F4OA 2UWNA 4NBDA 2PMZA 3H0GI 2QREB 1VQ7Z 4BY1I 3CCJZ 4BBSI 3GTQI 1VQM1 3JAMb 2K3RA 3G71Z 3J81b 1TPGA 1OK3A 4RS4A 2V8KA 4A3EI 4B2SA 3GXEA 1VLAA 3J80b 2EHFA 3ESWA 5T64A 1M1K2 3CPWY 5A2Qf 4AYIA 2QA41 1GKGA 1USPA 1X3WA 4XX2A 3S2HI 1H03P 3I56Z 3INBC 1PFTA 3HOVI 4AYDA 2JS4A 2JMOA 4A3LI 3CXCZ 2QEX1 3TVJA 1YJWZ 2CG7A 4E30A 3S1RI 3O8EB 2RBLA 2F4MA 3IX0A 3CCQ1 3S16I 5IT9f 2P3YA 4A3BI 4ONTD 3VMHA 3GCFA 3CCE1 3R62A 2W03A 3GKQA 2E2JI 3OW2Y 1M1K1 1TFIA 2NVQI 1QYPA 5C4JI 1VQ71 5D1OB 5FLXf 2G2KA 1S72Z 4E32A 1Q811 3S1QI 2O39C 2G7IA 5I0QB 1KC81 2QRDB 2V8IA 1NP6A 3NH5A 3TE5B 3KXVA 5C3EI 2H85A 4IGDA 2XQWC 1TWCI 1VQO1 4A3JI 1VQ4Z 1RO0A 3ZD2A 2OTL1 1QVFZ 1TPMA 2LOJA 2QY0A 2CG6A 4DJZA 3CC4Z 1GHQB 2VUMI 3OW2Z 4MH4A 5JPMG 3HOYI 3GTMS 3BG1B 4MUCA 1KD11 4Y52I 1Q861 1YHQ1 1K731 1C1ZA 1VQOZ 4E2ZA 3CCV1 5FO8C 1YJ91 2I3CA 1CKLA 3IFUA 1RLYA 1K8A1 3CCJ1 2BZMA 1W2BY 3NFPI 4K12A 2B5ID 1WIIA 2HU9A 1KD12 3G711 2IZ3A 2QKDA 5IT9b 2NVTI 3M4OI 1YI2Z 1VQNZ 1P9NA 1WCMI 1ZH1A 4NBAA 1UOTP 4MD7A 2OTJ1 3NDIA 2CKUA 4A3KI 1VQ81 1U5MA 1YUKA 3GTLI 5HYTB 3ZD1A 4BBRI 3HOZI 2KMSA 3CME1 3OXUD 2E9HA 2A55A 3RZOI 3CC41 3I55Z 1PPQA 2DE6A 3G6E1 2V8JA 3KIHA 4HH4A 4RVHA 4MXUA 2DE7A 3PO2I 4DQYB 1JWHC 5A2Qb 2OTJZ 1YJNZ 1VQ8Z 1Q7Y2 2M48A 2YBYA 3MONA 4RVGA 3HKZA 3CCMZ 2R6MA 1HFHA 2EGTA 2JA6I 2J6AA 1NJI1 2W80A 3CCSZ 2B63I 2XRBA 1OJVA 3VMIA 1M902 2RHBA 1NWVA 1OK1A 2ZAEB 2YU9I 1VQ61 3LUSA 2OOXB 4AYEA 3HOXI 4NFRA 3CCLZ 1SFOI 2W04A 3EJHA 3FQMA 4MD8A 2IZ4A 2QEXZ 4TNUA 2R7ZI 3M3YI 1VQ91 3CALA 1K9M2 2MCZA 4EWCA 2MCYA 2JA5I 1USPB 1Q812 1QVGY 2BJOA 1TPNA 3SW0X 1L1OC 3I07A 4NBHA 2JNYA 5FLXb 1JJ2Y 4E2YA 1Q822 4RVFA 5FLMI 1TWAI 2LIYA 4AYMA 1E8BA 1VQL1 2VF1A 4Y7NI 3MZLB 1Y1VI 3CC2Z 3CMAZ 3GTPI 1Z03A 4HGZA 4BY7I 4E33A 4BXXI 3CCR1 2ERJA 1X3ZA 1QGBA 1YI21 1Y1WI 3CCL1 3CCEZ 3KIFA 4NBEA 3F3FC 1QF8A 1S721 1O9AA 3ERBA 3CCS1 4A3DI 2JA7I 2Y0SA 5C4XI 2Q4ZA 3VB9A 1M901 5T67A 2W81A 3CC21 5D1PA 1LQLA 4DK1A 1KC82 3CD6Z 4NBFA 2NVXI 2GTHA 2OOYB 1VQP1 2JUBA 2V8EA 1VQ5Z 3S2DI 1YJW1 5T6BA 3JAMf 3HOWI 2GTIA 2M6NA 3BG0B 3CCVZ 1Q862 3S1MI 3IF8A 2R92I 2RKYA 4FXGG 1H04P 3EEDA 3CQZI 2AKLA 1S7MA 5IP9I 1N2FA 1YHQZ 2YADA 4A3CI 4E2XA 1W2BZ 1VQ41 3Q87A 1VQ51 1N8R1 1LY2A 1OK9A 3NH8A 4NBGA 1H2PP 1Z01A 1K83I 3IU3I 2RLPA 4MONA 1E5GA 3PO3I 1DL6A 4LOTA 2RIQA 5IP7I 3GTKI 1Y1VS 2O53A 1MD8A 3D9XA 2RLQA 1N8R2 3I4MI 1Q821 1NUIA 1QUBA 5HYPA 1VQ6Z 4QTTA 1SRZA 4MRIA 3CC7Z 2YRAA 2EC3A 2JR6A 4X6AI 1OJYA 2WB1A 4NH1C 2KRIA 3S15I 2RL0A 1YJ9Z 1OK2A 1YUAA 1X0TA 1KRLA 2QR1B 1HFIA 1RNIA 1RO2A 1HCCA 3G6EZ 1YJN1 2QA4Z 3T4NB 4AYBA 4NBBA 2JGXA 1ELVA 1KQSZ 1I3QI 1RQFA 1QVFY 3NDJA 3G4SZ 3PO3S 3QWUA 2QLVB 3J80f 1SS2A 4PZ5A 3U50C 4A3FI 1G4GA 4RVDA 3D6WA 2PM9A 2JRAA 2QRCB 3VTNA 1VQ9Z 2RKZA 4B2RA 5C44I 4A3II 5HZPB 1K8A2 2JGWA 2WIIC 4JHSA 1Z02A 3S14I 1OJWA 4E2WA 1K732 3VMGA 5LL6f 3CD61 1R9TI 4F4OC 2RPRA 3CCQZ 3GTOI 4C16A 1WW9A 1RO4A 2E2II 3S1NI 4A93I 3RJ3D 4NB9A 3GTGI 3CPWZ 3F3PC 3OEDC 3MZKB 3TDHB 4A3MI 1VQK1 2HF1A 4YNXA 4KKDA 1QO6A 3OP8A 3CXCY 3G4S1 4NBCA 1H2QP 5CM2M 1YIJZ 5AN9F 2R93I 3P5JB 1JJ2Z 3RZDI 2KPIA 2Q51A 3M7PA 1ZJKA 1YITZ 2OTLZ 4A5WB 4MD9A 1VVDA 3L89M 1YIT1 3I561 1E88A 1VQPZ 4QTUA 3HOUI 4WJG2 3KZJA 2JA8I 4NB8A 1ML8A 1VQN1 2K5RA 4CSYA 3CCUZ 3T5OA 4NOZA 3I4NI 1VQMZ 4S1TA 4E31A 1MD7A 2VUGA 3CC71 1VQKZ 3GTMI 2O4HA 2WAQA 1Q3XA 4HGYA 1KQSY 3FQQA 1QVGZ 1G4FA 4A3GI 4LOSA 1TWFI 1FBRA 3J81f 3GOVA 2RT9A 3ZRZA 3NFZA 3CCU1 3CCM1 2XRDA 2XWBF 3GTJI 4ZH1D 2LFUA 2XWJI 1I6HI 1TWGI 2P28A 1VVCA 3NH4A 3EERA 4RV9A 1Z92B 3CCRZ 1VQLZ 3CMA1 3H3VJ 4J38B 3J7A4 4DGLA 3K7AI 3CMEZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MUC A;  5HYU B;  1SS2 A;  4PZ5 A;  1GKN A;  4AYM A;  1E8B A;  1G4G A;  1C1Z A;  5FO8 C;  1GPZ A;  2ERJ A;  1CKL A;  2JRA A;  1QGB A;  2RKZ A;  4B2R A;  2BZM A;  5HZP B;  3MQL A;  3NFP I;  4K12 A;  2B5I D;  2JGW A;  2WII C;  4JHS A;  2UWN A;  1O9A A;  3ERB A;  2IZ3 A;  1OJW A;  4F4O C;  4C16 A;  2W81 A;  3RJ3 D;  1TPG A;  1OK3 A;  3OED C;  1UOT P;  4YNX A;  4KKD A;  1QO6 A;  2V8E A;  4B2S A;  3GXE A;  3OP8 A;  2CKU A;  2EHF A;  1U5M A;  1H2Q P;  4AYI A;  5HYT B;  3ZD1 A;  2RKY A;  2KMS A;  4FXG G;  1GKG A;  1H04 P;  3OXU D;  2A55 A;  1H03 P;  1PPQ A;  3M7P A;  1ZJK A;  3INB C;  4A5W B;  1VVD A;  3L89 M;  4AYD A;  1LY2 A;  1OK9 A;  3TVJ A;  1H2P P;  1E88 A;  2YBY A;  2CG7 A;  3IU3 I;  2RLP A;  4WJG 2;  3KZJ A;  1E5G A;  3O8E B;  4LOT A;  1MD8 A;  4CSY A;  3T5O A;  3IX0 A;  1HFH A;  2RLQ A;  4ONT D;  2W80 A;  1MD7 A;  1QUB A;  3R62 A;  5HYP A;  2XRB A;  1OJV A;  1SRZ A;  1Q3X A;  1NWV A;  1OK1 A;  1G4F A;  2YRA A;  2EC3 A;  4LOS A;  1FBR A;  3GOV A;  4AYE A;  2O39 C;  1OJY A;  3ZRZ A;  2G7I A;  5I0Q B;  3EJH A;  2KRI A;  2XRD A;  2XWB F;  4ZH1 D;  2IZ4 A;  3KXV A;  2XWJ I;  1VVC A;  2RL0 A;  1OK2 A;  4IGD A;  2XQW C;  3CAL A;  1Z92 B;  3ZD2 A;  2MCZ A;  1HFI A;  2MCY A;  1HCC A;  1TPM A;  2LOJ A;  2QY0 A;  2CG6 A;  4J38 B;  4DJZ A;  2JGX A;  1GHQ B;  1ELV A;  1TPN A;  3SW0 X;  5JPM G; 
#chains in the Genus database with same CATH topology
 1Q7Y 1;  2NVY I;  5HYU B;  1ZB9 A;  3FKI I;  2PK7 A;  2E2H I;  1K9M 1;  1ZB8 A;  1GKN A;  3I55 1;  2GU2 A;  2Y8S A;  5D1O A;  3S17 I;  2KI7 B;  1GPZ A;  1YIJ 1;  2DE5 A;  4CL1 A;  1I50 I;  3CI0 J;  1NJI 2;  2OZK A;  3MQL A;  1TWH I;  2F4O A;  2UWN A;  4NBD A;  2PMZ A;  3H0G I;  2QRE B;  1VQ7 Z;  4BY1 I;  3CCJ Z;  4BBS I;  3GTQ I;  1VQM 1;  3JAM b;  2K3R A;  3G71 Z;  3J81 b;  1TPG A;  1OK3 A;  4RS4 A;  2V8K A;  2X2Z A;  2AYD A;  4A3E I;  4B2S A;  3GXE A;  1VLA A;  3J80 b;  2EHF A;  3ESW A;  5T64 A;  1M1K 2;  3CPW Y;  5A2Q f;  4AYI A;  2QA4 1;  1GKG A;  1USP A;  3VWO A;  1X3W A;  4XX2 A;  3S2H I;  1H03 P;  3I56 Z;  3INB C;  1PFT A;  3HOV I;  4AYD A;  2JS4 A;  2JMO A;  4A3L I;  3CXC Z;  2QEX 1;  3TVJ A;  1YJW Z;  2CG7 A;  4E30 A;  3S1R I;  3O8E B;  2RBL A;  2F4M A;  3IX0 A;  3CCQ 1;  3S16 I;  5IT9 f;  2P3Y A;  4A3B I;  4ONT D;  3VMH A;  3GCF A;  3CCE 1;  3R62 A;  2W03 A;  3GKQ A;  2E2J I;  3OW2 Y;  1M1K 1;  1TFI A;  2NVQ I;  1QYP A;  5C4J I;  1VQ7 1;  5D1O B;  5FLX f;  2G2K A;  1S72 Z;  4E32 A;  1Q81 1;  3S1Q I;  2O39 C;  2G7I A;  5I0Q B;  1KC8 1;  2QRD B;  2V8I A;  1NP6 A;  3NH5 A;  3KXV A;  3TE5 B;  5C3E I;  2H85 A;  4IGD A;  2XQW C;  1TWC I;  1VQO 1;  4A3J I;  1VQ4 Z;  1RO0 A;  3ZD2 A;  2OTL 1;  1QVF Z;  1TPM A;  2LOJ A;  2QY0 A;  2CG6 A;  4DJZ A;  3CC4 Z;  2Y8T A;  1GHQ B;  2VUM I;  3OW2 Z;  5JPM G;  4MH4 A;  3HOY I;  3GTM S;  3BG1 B;  4MUC A;  1KD1 1;  4Y52 I;  1Q86 1;  1YHQ 1;  1K73 1;  1C1Z A;  1VQO Z;  4E2Z A;  3CCV 1;  5FO8 C;  1YJ9 1;  1RLH A;  2I3C A;  1CKL A;  3IFU A;  1RLY A;  1K8A 1;  1WZN A;  3CCJ 1;  2BZM A;  1W2B Y;  3NFP I;  1AA6 A;  4K12 A;  2B5I D;  1WII A;  2HU9 A;  1KD1 2;  3G71 1;  2IZ3 A;  2QKD A;  2JIP A;  5IT9 b;  2NVT I;  3M4O I;  1YI2 Z;  1VQN Z;  1P9N A;  1WCM I;  1ZH1 A;  4NBA A;  1UOT P;  4MD7 A;  2OTJ 1;  2V45 A;  3NDI A;  2CKU A;  4A3K I;  1VQ8 1;  1U5M A;  1YUK A;  3GTL I;  5HYT B;  3ZD1 A;  2V3V A;  4BBR I;  2KMS A;  3CME 1;  3HOZ I;  3OXU D;  2E9H A;  2A55 A;  3RZO I;  3CC4 1;  3I55 Z;  1PPQ A;  2DE6 A;  3G6E 1;  2V8J A;  3KIH A;  4HH4 A;  4RVH A;  4MXU A;  2DE7 A;  3PO2 I;  4DQY B;  1JWH C;  5A2Q b;  2OTJ Z;  1YJN Z;  1VQ8 Z;  1Q7Y 2;  2M48 A;  2VPY A;  2YBY A;  3MON A;  4RVG A;  2E7Z A;  3HKZ A;  3CCM Z;  2R6M A;  1HFH A;  2EGT A;  2JA6 I;  2J6A A;  1NJI 1;  2W80 A;  3CCS Z;  2B63 I;  2XRB A;  1OJV A;  3VMI A;  1M90 2;  2RHB A;  1NWV A;  1OK1 A;  3D2L A;  2ZAE B;  2YU9 I;  1VQ6 1;  3LUS A;  2OOX B;  4AYE A;  3HOX I;  4NFR A;  3CCL Z;  1SFO I;  2W04 A;  3WSX A;  3EJH A;  4BXX I;  3FQM A;  4MD8 A;  2IZ4 A;  2QEX Z;  4TNU A;  2R7Z I;  3M3Y I;  2VPX A;  1VQ9 1;  3CAL A;  1K9M 2;  2MCZ A;  4EWC A;  2MCY A;  2JA5 I;  1USP B;  1Q81 2;  1QVG Y;  2Y8R A;  2BJO A;  1TPN A;  3SW0 X;  1L1O C;  2JNY A;  3I07 A;  3K3T A;  4NBH A;  5FLX b;  1JJ2 Y;  2JIQ A;  4E2Y A;  1Q82 2;  4RVF A;  5FLM I;  1TWA I;  2LIY A;  4AYM A;  1E8B A;  1VQL 1;  2VF1 A;  4Y7N I;  3MZL B;  1Y1V I;  3CC2 Z;  3CMA Z;  3WSY A;  1Z03 A;  3IR7 A;  4HGZ A;  4E33 A;  3GTP I;  4BY7 I;  3CCR 1;  2ERJ A;  1X3Z A;  1QGB A;  1YI2 1;  1Y1W I;  3CCL 1;  3CCE Z;  3KIF A;  4NBE A;  3F3F C;  1QF8 A;  1S72 1;  4PO7 A;  1O9A A;  3ERB A;  3CCS 1;  4A3D I;  3NJA A;  2JA7 I;  2Y0S A;  5C4X I;  2Q4Z A;  3VB9 A;  1Y8C A;  1M90 1;  2VPZ A;  5T67 A;  2W81 A;  4APL A;  3CC2 1;  5D1P A;  2I2L A;  1LQL A;  2IV2 X;  4DK1 A;  1KC8 2;  3CD6 Z;  4NBF A;  2NVX I;  2GTH A;  2OOY B;  1VQP 1;  2JUB A;  2V8E A;  1VQ5 Z;  3S2D I;  1YJW 1;  5T6B A;  3JAM f;  3HOW I;  2GTI A;  2ZYC A;  1QXF A;  2M6N A;  3BG0 B;  3CCV Z;  1Q86 2;  3S1M I;  3IF8 A;  2R92 I;  2RKY A;  4FXG G;  1H04 P;  3EED A;  3CQZ I;  2AKL A;  1S7M A;  5IP9 I;  1N2F A;  1YHQ Z;  2YAD A;  4A3C I;  4E2X A;  1W2B Z;  1VQ4 1;  3Q87 A;  1VQ5 1;  1N8R 1;  1LY2 A;  1OK9 A;  3NH8 A;  4YIZ A;  4NBG A;  1H2P P;  2JIM A;  1Z01 A;  1K83 I;  3IU3 I;  2RLP A;  4MON A;  4N7E A;  1E5G A;  3PO3 I;  1DL6 A;  4LOT A;  2RIQ A;  5IP7 I;  3GTK I;  1Y1V S;  2O53 A;  3FGT A;  1MD8 A;  3D9X A;  2RLQ A;  1N8R 2;  3I4M I;  5DN4 A;  1Q82 1;  1NUI A;  1QUB A;  5HYP A;  1VQ6 Z;  4QTT A;  1SRZ A;  4MRI A;  3CC7 Z;  2YRA A;  2EC3 A;  2JR6 A;  4X6A I;  1OJY A;  2WB1 A;  4NH1 C;  2KRI A;  3S15 I;  2RL0 A;  1YJ9 Z;  1OK2 A;  1YUA A;  1X0T A;  1KRL A;  2QR1 B;  1HFI A;  1RNI A;  2JIR A;  1RO2 A;  1HCC A;  3G6E Z;  1YJN 1;  2QA4 Z;  3T4N B;  4AYB A;  4NBB A;  2JGX A;  1ELV A;  1KQS Z;  1I3Q I;  1RQF A;  1QVF Y;  3NDJ A;  2JIO A;  1FDI A;  3G4S Z;  3PO3 S;  4BWC A;  3QWU A;  2QLV B;  3J80 f;  1SS2 A;  4PZ5 A;  3U50 C;  4A3F I;  1G4G A;  4RVD A;  1FDO A;  2VPW A;  3D6W A;  2PM9 A;  2JRA A;  2QRC B;  1WJ2 A;  3VTN A;  1VQ9 Z;  2RKZ A;  4B2R A;  5C44 I;  4A3I I;  5HZP B;  1K8A 2;  2JGW A;  2WII C;  4JHS A;  1Z02 A;  3S14 I;  1OJW A;  4E2W A;  1K73 2;  3VMG A;  5LL6 f;  3CD6 1;  1R9T I;  4F4O C;  2RPR A;  3CCQ Z;  3GTO I;  4C16 A;  1WW9 A;  1RO4 A;  2E2I I;  3S1N I;  4MSL A;  3RJ3 D;  4A93 I;  4NB9 A;  3GTG I;  3CPW Z;  3F3P C;  3OED C;  1SIW A;  3MZK B;  3TDH B;  4A3M I;  2HF1 A;  1VQK 1;  4YNX A;  4KKD A;  1QO6 A;  3OP8 A;  3CXC Y;  3G4S 1;  4NBC A;  1H2Q P;  5CM2 M;  1YIJ Z;  3FGR A;  5AN9 F;  2R93 I;  3P5J B;  1JJ2 Z;  3RZD I;  2KPI A;  2Q51 A;  3M7P A;  1ZJK A;  1YIT Z;  2OTL Z;  4A5W B;  4MD9 A;  1VVD A;  3L89 M;  1YIT 1;  3I56 1;  1E88 A;  1VQP Z;  4QTU A;  3HOU I;  4WJG 2;  3KZJ A;  2JA8 I;  4NB8 A;  1ML8 A;  1VQN 1;  2K5R A;  4CSY A;  3CCU Z;  3T5O A;  4NOZ A;  3I4N I;  1VQM Z;  4S1T A;  4E31 A;  1MD7 A;  2VUG A;  3CC7 1;  1VQK Z;  3GTM I;  3ZLE A;  2O4H A;  2WAQ A;  1Q3X A;  4HGY A;  1KQS Y;  3FQQ A;  1QVG Z;  1G4F A;  4A3G I;  4LOS A;  1TWF I;  1FBR A;  3J81 f;  3GOV A;  2RT9 A;  3ZRZ A;  3NFZ A;  3CCU 1;  2NAP A;  3CCM 1;  2XRD A;  2XWB F;  3GTJ I;  4ZH1 D;  2LFU A;  2XWJ I;  1I6H I;  1TWG I;  2P28 A;  1VVC A;  3NH4 A;  3EER A;  3F6K A;  4RV9 A;  1Z92 B;  3CCR Z;  1VQL Z;  2LEX A;  5DN5 A;  3CMA 1;  3H3V J;  4J38 B;  3J7A 4;  1Q16 A;  3ZLD A;  4DGL A;  3K7A I;  3CME Z; 
#chains in the Genus database with same CATH homology
 1Q7Y 1;  2NVY I;  5HYU B;  1ZB9 A;  3FKI I;  2PK7 A;  2E2H I;  1K9M 1;  1ZB8 A;  1GKN A;  3I55 1;  2GU2 A;  5D1O A;  3S17 I;  2KI7 B;  1GPZ A;  1YIJ 1;  2DE5 A;  4CL1 A;  1I50 I;  1NJI 2;  2OZK A;  3MQL A;  1TWH I;  2F4O A;  2UWN A;  4NBD A;  2PMZ A;  3H0G I;  2QRE B;  1VQ7 Z;  4BY1 I;  3CCJ Z;  4BBS I;  3GTQ I;  1VQM 1;  3JAM b;  2K3R A;  3G71 Z;  3J81 b;  1TPG A;  1OK3 A;  4RS4 A;  2V8K A;  4A3E I;  4B2S A;  3GXE A;  1VLA A;  3J80 b;  2EHF A;  3ESW A;  5T64 A;  1M1K 2;  3CPW Y;  5A2Q f;  4AYI A;  2QA4 1;  1GKG A;  1USP A;  1X3W A;  4XX2 A;  3S2H I;  1H03 P;  3I56 Z;  3INB C;  1PFT A;  3HOV I;  4AYD A;  2JS4 A;  2JMO A;  4A3L I;  3CXC Z;  2QEX 1;  3TVJ A;  1YJW Z;  2CG7 A;  4E30 A;  3S1R I;  3O8E B;  2RBL A;  2F4M A;  3IX0 A;  3CCQ 1;  3S16 I;  5IT9 f;  2P3Y A;  4A3B I;  4ONT D;  3VMH A;  3GCF A;  3CCE 1;  3R62 A;  2W03 A;  3GKQ A;  2E2J I;  3OW2 Y;  1M1K 1;  1TFI A;  2NVQ I;  1QYP A;  5C4J I;  1VQ7 1;  5D1O B;  5FLX f;  2G2K A;  1S72 Z;  4E32 A;  1Q81 1;  3S1Q I;  2O39 C;  2G7I A;  5I0Q B;  1KC8 1;  2QRD B;  2V8I A;  1NP6 A;  3NH5 A;  3TE5 B;  3KXV A;  5C3E I;  2H85 A;  4IGD A;  2XQW C;  1TWC I;  1VQO 1;  4A3J I;  1VQ4 Z;  1RO0 A;  3ZD2 A;  2OTL 1;  1QVF Z;  1TPM A;  2LOJ A;  2QY0 A;  2CG6 A;  4DJZ A;  3CC4 Z;  1GHQ B;  2VUM I;  3OW2 Z;  4MH4 A;  5JPM G;  3HOY I;  3GTM S;  3BG1 B;  4MUC A;  1KD1 1;  4Y52 I;  1Q86 1;  1YHQ 1;  1K73 1;  1C1Z A;  1VQO Z;  4E2Z A;  3CCV 1;  5FO8 C;  1YJ9 1;  2I3C A;  1CKL A;  3IFU A;  1RLY A;  1K8A 1;  3CCJ 1;  2BZM A;  1W2B Y;  3NFP I;  4K12 A;  2B5I D;  1WII A;  2HU9 A;  1KD1 2;  3G71 1;  2IZ3 A;  2QKD A;  5IT9 b;  2NVT I;  3M4O I;  1YI2 Z;  1VQN Z;  1P9N A;  1WCM I;  1ZH1 A;  4NBA A;  1UOT P;  4MD7 A;  2OTJ 1;  3NDI A;  2CKU A;  4A3K I;  1VQ8 1;  1U5M A;  1YUK A;  3GTL I;  5HYT B;  3ZD1 A;  4BBR I;  3HOZ I;  2KMS A;  3CME 1;  3OXU D;  2E9H A;  2A55 A;  3RZO I;  3CC4 1;  3I55 Z;  1PPQ A;  2DE6 A;  3G6E 1;  2V8J A;  3KIH A;  4HH4 A;  4RVH A;  4MXU A;  2DE7 A;  3PO2 I;  4DQY B;  1JWH C;  5A2Q b;  2OTJ Z;  1YJN Z;  1VQ8 Z;  1Q7Y 2;  2M48 A;  2YBY A;  3MON A;  4RVG A;  3HKZ A;  3CCM Z;  2R6M A;  1HFH A;  2EGT A;  2JA6 I;  2J6A A;  1NJI 1;  2W80 A;  3CCS Z;  2B63 I;  2XRB A;  1OJV A;  3VMI A;  1M90 2;  2RHB A;  1NWV A;  1OK1 A;  2ZAE B;  2YU9 I;  1VQ6 1;  3LUS A;  2OOX B;  4AYE A;  3HOX I;  4NFR A;  3CCL Z;  1SFO I;  2W04 A;  3EJH A;  3FQM A;  4MD8 A;  2IZ4 A;  2QEX Z;  4TNU A;  2R7Z I;  3M3Y I;  1VQ9 1;  3CAL A;  1K9M 2;  2MCZ A;  4EWC A;  2MCY A;  2JA5 I;  1USP B;  1Q81 2;  1QVG Y;  2BJO A;  1TPN A;  3SW0 X;  1L1O C;  3I07 A;  4NBH A;  2JNY A;  5FLX b;  1JJ2 Y;  4E2Y A;  1Q82 2;  4RVF A;  5FLM I;  1TWA I;  2LIY A;  4AYM A;  1E8B A;  1VQL 1;  2VF1 A;  4Y7N I;  3MZL B;  1Y1V I;  3CC2 Z;  3CMA Z;  3GTP I;  1Z03 A;  4HGZ A;  4BY7 I;  4E33 A;  4BXX I;  3CCR 1;  2ERJ A;  1X3Z A;  1QGB A;  1YI2 1;  1Y1W I;  3CCL 1;  3CCE Z;  3KIF A;  4NBE A;  3F3F C;  1QF8 A;  1S72 1;  1O9A A;  3ERB A;  3CCS 1;  4A3D I;  2JA7 I;  2Y0S A;  5C4X I;  2Q4Z A;  3VB9 A;  1M90 1;  5T67 A;  2W81 A;  3CC2 1;  5D1P A;  1LQL A;  4DK1 A;  1KC8 2;  3CD6 Z;  4NBF A;  2NVX I;  2GTH A;  2OOY B;  1VQP 1;  2JUB A;  2V8E A;  1VQ5 Z;  3S2D I;  1YJW 1;  5T6B A;  3JAM f;  3HOW I;  2GTI A;  2M6N A;  3BG0 B;  3CCV Z;  1Q86 2;  3S1M I;  3IF8 A;  2R92 I;  2RKY A;  4FXG G;  1H04 P;  3EED A;  3CQZ I;  2AKL A;  1S7M A;  5IP9 I;  1N2F A;  1YHQ Z;  2YAD A;  4A3C I;  4E2X A;  1W2B Z;  1VQ4 1;  3Q87 A;  1VQ5 1;  1N8R 1;  1LY2 A;  1OK9 A;  3NH8 A;  4NBG A;  1H2P P;  1Z01 A;  1K83 I;  3IU3 I;  2RLP A;  4MON A;  1E5G A;  3PO3 I;  1DL6 A;  4LOT A;  2RIQ A;  5IP7 I;  3GTK I;  1Y1V S;  2O53 A;  1MD8 A;  3D9X A;  2RLQ A;  1N8R 2;  3I4M I;  1Q82 1;  1NUI A;  1QUB A;  5HYP A;  1VQ6 Z;  4QTT A;  1SRZ A;  4MRI A;  3CC7 Z;  2YRA A;  2EC3 A;  2JR6 A;  4X6A I;  1OJY A;  2WB1 A;  4NH1 C;  2KRI A;  3S15 I;  2RL0 A;  1YJ9 Z;  1OK2 A;  1YUA A;  1X0T A;  1KRL A;  2QR1 B;  1HFI A;  1RNI A;  1RO2 A;  1HCC A;  3G6E Z;  1YJN 1;  2QA4 Z;  3T4N B;  4AYB A;  4NBB A;  2JGX A;  1ELV A;  1KQS Z;  1I3Q I;  1RQF A;  1QVF Y;  3NDJ A;  3G4S Z;  3PO3 S;  3QWU A;  2QLV B;  3J80 f;  1SS2 A;  4PZ5 A;  3U50 C;  4A3F I;  1G4G A;  4RVD A;  3D6W A;  2PM9 A;  2JRA A;  2QRC B;  3VTN A;  1VQ9 Z;  2RKZ A;  4B2R A;  5C44 I;  4A3I I;  5HZP B;  1K8A 2;  2JGW A;  2WII C;  4JHS A;  1Z02 A;  3S14 I;  1OJW A;  4E2W A;  1K73 2;  3VMG A;  5LL6 f;  3CD6 1;  1R9T I;  4F4O C;  2RPR A;  3CCQ Z;  3GTO I;  4C16 A;  1WW9 A;  1RO4 A;  2E2I I;  3S1N I;  4A93 I;  3RJ3 D;  4NB9 A;  3GTG I;  3CPW Z;  3F3P C;  3OED C;  3MZK B;  3TDH B;  4A3M I;  1VQK 1;  2HF1 A;  4YNX A;  4KKD A;  1QO6 A;  3OP8 A;  3CXC Y;  3G4S 1;  4NBC A;  1H2Q P;  5CM2 M;  1YIJ Z;  5AN9 F;  2R93 I;  3P5J B;  1JJ2 Z;  3RZD I;  2KPI A;  2Q51 A;  3M7P A;  1ZJK A;  1YIT Z;  2OTL Z;  4A5W B;  4MD9 A;  1VVD A;  3L89 M;  1YIT 1;  3I56 1;  1E88 A;  1VQP Z;  4QTU A;  3HOU I;  4WJG 2;  3KZJ A;  2JA8 I;  4NB8 A;  1ML8 A;  1VQN 1;  2K5R A;  4CSY A;  3CCU Z;  3T5O A;  4NOZ A;  3I4N I;  1VQM Z;  4S1T A;  4E31 A;  1MD7 A;  2VUG A;  3CC7 1;  1VQK Z;  3GTM I;  2O4H A;  2WAQ A;  1Q3X A;  4HGY A;  1KQS Y;  3FQQ A;  1QVG Z;  1G4F A;  4A3G I;  4LOS A;  1TWF I;  1FBR A;  3J81 f;  3GOV A;  2RT9 A;  3ZRZ A;  3NFZ A;  3CCU 1;  3CCM 1;  2XRD A;  2XWB F;  3GTJ I;  4ZH1 D;  2LFU A;  2XWJ I;  1I6H I;  1TWG I;  2P28 A;  1VVC A;  3NH4 A;  3EER A;  4RV9 A;  1Z92 B;  3CCR Z;  1VQL Z;  3CMA 1;  3H3V J;  4J38 B;  3J7A 4;  4DGL A;  3K7A I;  3CME Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...