3IX0A

Crystal structure of human seminal plasma protein psp94
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
87
Chain Sequence
SCYFIPNEGKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-microseminoprotein
publication title Crystal structure of prostate secretory protein PSP94 shows an edge-to-edge association of two monomers to form a homodimer
pubmed doi rcsb
molecule tags Antitumor protein, apoptosis
total genus 13
structure length 87
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ix0A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ix0A02
1TPNA 2LOJA 2XQWC 3M7PA 1QGBA 3ZD1A 1LY2A 2YRAA 3O8EB 2RLQA 4A5WB 3KXVA 4IGDA 3TVJA 2RL0A 2RLPA 4PZ5A 3EJHA 1ZJKA 1OJYA 4CSYA 1C1ZA 1QUBA 3IX0A 1ELVA 2ERJA 3L89M 1G4GA 2V8EA 1OJWA 2MCYA 1QO6A 1VVCA 2WIIC 4LOSA 2G7IA 4DJZA 2UWNA 1H03P 2BZMA 2W81A 2CG7A 4K12A 3NFPI 5HYUB 3OEDC 1TPMA 2EC3A 1E88A 3INBC 2W80A 4ONTD 1HFHA 4AYIA 2A55A 3RJ3D 1CKLA 3GXEA 1HFIA 2XRDA 2KRIA 1GPZA 1GHQB 4FXGG 4LOTA 5HYTB 3MQLA 2IZ3A 1Q3XA 1E5GA 4WJG2 2QY0A 1H2QP 2XRBA 3R62A 2KMSA 1HCCA 5JPMG 2JGXA 3IU3I 1OK1A 1G4FA 2IZ4A 4AYEA 3OXUD 3KZJA 4AYDA 2JGWA 3ZRZA 3SW0X 1OK2A 4AYMA 2CG6A 1SS2A 2EHFA 1H2PP 3ERBA 1NWVA 3T5OA 4JHSA 2CKUA 1GKGA 1OK3A 4B2SA 4B2RA 5FO8C 4C16A 2B5ID 1VVDA 3GOVA 1SRZA 1OJVA 2RKYA 1TPGA 2XWBF 5HYPA 4KKDA 2XWJI 1U5MA 3CALA 1E8BA 4F4OC 5HZPB 1Z92B 2JRAA 1H04P 1O9AA 3OP8A 4MUCA 2YBYA 2MCZA 2RKZA 4ZH1D 5I0QB 1MD8A 4J38B 1GKNA 2O39C 3ZD2A 1OK9A 1MD7A 1UOTP 4YNXA 1PPQA 1FBRA
chains in the Genus database with same CATH superfamily
3I55Z 1YIJZ 2LOJA 3IFUA 4E2ZA 1QGBA 3KIFA 2IV2X 2YRAA 2KI7B 3S16I 3CCRZ 1YHQZ 3J81b 2B63I 5FLXf 5IT9f 3VMGA 4PZ5A 1ZJKA 3BG1B 1JJ2Y 1C1ZA 3IX0A 1VQM1 3I4MI 3M3YI 4NB9A 4Y7NI 2MCYA 4E2YA 1QO6A 1VVCA 2WIIC 3D9XA 4LOSA 2JIOA 3CC7Z 3GTKI 3CCEZ 1TFIA 2BZMA 2W81A 1YJWZ 4E30A 1TWGI 2M48A 5HYUB 3CCQ1 4CL1A 4E32A 1X3WA 1L1OC 3RZDI 3G711 1LQLA 2VPZA 1Z03A 3CMEZ 1CKLA 1HFIA 2GU2A 4DK1A 1GPZA 4RV9A 4RVHA 3T4NB 2JUBA 3I551 4A3FI 1VLAA 4NBFA 1NUIA 3CCR1 1YHQ1 3R62A 2NVTI 3CC2Z 3I56Z 2KMSA 2JIPA 5JPMG 2JGXA 1S72Z 4NOZA 4NBDA 3CQZI 4AYEA 3F6KA 3FGRA 3OXUD 3KZJA 3SW0X 2EGTA 3PO3S 1YJN1 3CC71 3CCE1 2Y0SA 1YJW1 3U50C 1VQ61 3G6EZ 4BBRI 1H2PP 1Y1VS 3EEDA 1Q822 1GKGA 2K5RA 1USPA 1OK3A 4DQYB 3CCJ1 2B5ID 4MXUA 4BBSI 3CCLZ 1SRZA 1TWCI 2E2II 3I4NI 2M6NA 5HYPA 4HH4A 5DN5A 1Z02A 5T6BA 1VQ5Z 4E33A 2K3RA 2NVXI 2XWJI 1KC82 3G4SZ 2RPRA 1Q861 4MRIA 1O9AA 3OP8A 3NFZA 3GKQA 1QXFA 1FDOA 4ZH1D 3OW2Z 3ZLEA 3D2LA 3I561 1KQSZ 1VQL1 3VMHA 3CPWZ 1S721 1YJ9Z 1KC81 2R7ZI 1K8A1 4YNXA 4BY1I 1PPQA 4E31A 2JIRA 5D1PA 3M7PA 2DE7A 3ZD1A 3O8EB 3IF8A 1K9M2 5FLXb 5IT9b 3KXVA 2R6MA 4NBAA 2OTL1 4A3MI 1TWFI 3G6E1 3EERA 1YITZ 1OJYA 4NBHA 2ERJA 2YU9I 3NDJA 3L89M 2R93I 2V8EA 2E7ZA 2E9HA 2DE6A 1FDIA 1K731 1OJWA 4A3DI 4A93I 3HOYI 2JS4A 2NAPA 3CCL1 2RT9A 2V8IA 5FLMI 2UWNA 3CC4Z 2CG7A 4TNUA 3RZOI 3NFPI 2GTHA 1VQ7Z 1VQO1 4NBEA 3GCFA 4A3CI 1RLYA 4NBGA 3OEDC 3HOVI 1Q811 4DGLA 1QVFY 1VQKZ 1VQ91 3GTMI 3RJ3D 4PO7A 3GXEA 2RBLA 4MONA 2P3YA 1YJ91 1GHQB 1ZB8A 4RVFA 1SIWA 4HGYA 4MD7A 2WB1A 4LOTA 5HYTB 3FQMA 4A3JI 2IZ3A 2DE5A 1Q3XA 4QTTA 1M1K1 4WJG2 2QY0A 2Q4ZA 1H2QP 2XRBA 1RO2A 2JIQA 1P9NA 1QYPA 5T67A 3HOWI 3NDIA 3CPWY 1VQN1 4MD9A 3GTPI 2JIMA 2JA6I 3J80f 2JGWA 2RIQA 3CCMZ 5D1OB 3GTLI 2QA4Z 2W03A 2PMZA 3S1MI 3M4OI 4RVDA 3ERBA 1Q7Y1 3CCVZ 1YIJ1 2BJOA 2CKUA 2QEXZ 1PFTA 1W2BZ 2X2ZA 3VMIA 4B2SA 1VQK1 2RKYA 1RQFA 2XWBF 2LIYA 2Y8RA 4KKDA 1U5MA 3CALA 4NBCA 3ESWA 4A3LI 2H85A 5HZPB 1M901 4MSLA 1WCMI 4MUCA 3J7A4 3HOZI 2JMOA 2RKZA 1AA6A 3S17I 3PO3I 5DN4A 1MD8A 4EWCA 2R92I 1I6HI 3ZD2A 1VQPZ 1OK9A 1Q862 3F3FC 1TPNA 2XQWC 3CCM1 5A2Qf 1Y1VI 5LL6f 3CME1 2RLQA 4A5WB 4IGDA 5T64A 2P28A 3KIHA 2RLPA 1YUAA 3I07A 1ELVA 1X0TA 1R9TI 1K8A2 4X6AI 5IP7I 4YIZA 3FKII 3GTJI 2QEX1 2VUMI 2QR1B 2NVYI 3F3PC 2VPYA 3S1QI 1VQ4Z 2V8KA 3CC21 3WSYA 3NH8A 4S1TA 2NVQI 1H03P 2LFUA 4K12A 2QRCB 4XX2A 3CD6Z 3ZLDA 2QKDA 5C4JI 1JJ2Z 3QWUA 1YUKA 2O4HA 3CCUZ 1TPMA 2EC3A 1E88A 1RO4A 3GTQI 1K732 1RLHA 1HFHA 4AYIA 2A55A 1W2BY 1TWHI 1QF8A 1DL6A 2OZKA 1Y8CA 2VUGA 3NH5A 2WAQA 4FXGG 1Q812 3HOXI 1VQ8Z 2AYDA 3MQLA 4BXXI 1VQ51 4BY7I 1ZB9A 4NFRA 3FGTA 3IU3I 4RS4A 1G4FA 3J80b 3G4S1 1I3QI 2IZ4A 1KD11 3CCQZ 3ZRZA 1OK2A 1M1K2 3H3VJ 1Z01A 1K83I 3H0GI 1NWVA 1RNIA 3T5OA 4QTUA 3CMAZ 4JHSA 3Q87A 1USPB 2QREB 4C16A 4A3BI 3OW2Y 1YI2Z 1YIT1 1KQSY 3WSXA 1Q7Y2 2VPWA 2OOXB 2I2LA 1E8BA 1Q16A 4AYBA 4HGZA 1VQ81 4A3EI 1H04P 3CC41 1WJ2A 1YJNZ 3FQQA 1VQ71 3JAMf 5I0QB 1WIIA 3CCSZ 2PK7A 1GKNA 2LEXA 1VQ6Z 5IP9I 1M902 1UOTP 3TDHB 5A2Qb 1NJI2 2F4OA 2KPIA 2QRDB 2V8JA 2Y8TA 3P5JB 3VTNA 1LY2A 3S15I 2VF1A 1WZNA 3TVJA 2W04A 3CCJZ 2RL0A 5CM2M 2GTIA 3EJHA 3J81f 4CSYA 3K7AI 1QUBA 1RO0A 2JNYA 2OTJZ 1NJI1 3TE5B 3IR7A 1QVGZ 3CMA1 1G4GA 4A3GI 2JA7I 4Y52I 2G7IA 4DJZA 3NJAA 1YI21 1TWAI 2OOYB 3NH4A 2G2KA 3S2DI 2V45A 1Y1WI 1VQLZ 4RVGA 3D6WA 3VB9A 3INBC 1I50I 4E2WA 2W80A 4N7EA 4ONTD 3CXCZ 2QA41 3S1NI 3VWOA 5AN9F 1SFOI 2O53A 2XRDA 2J6AA 3CCS1 3CCV1 3LUSA 2KRIA 2OTLZ 4MD8A 2QLVB 1KRLA 5C4XI 3MZKB 2JA5I 3HOUI 1E5GA 1QVFZ 3K3TA 3PO2I 1HCCA 2HU9A 4APLA 2JR6A 1OK1A 2OTJ1 1WW9A 2ZYCA 1VQOZ 1Q821 4NB8A 3HKZA 2PM9A 4AYDA 1N8R2 5D1OA 2V3VA 3S1RI 1VQ9Z 3GTOI 4AYMA 2CG6A 2HF1A 1SS2A 1VQP1 4NH1C 2ZAEB 2EHFA 4BWCA 1N2FA 1VQMZ 2Y8SA 1QVGY 1KD12 3S14I 4A3KI 2Q51A 1N8R1 4E2XA 2I3CA 4B2RA 5FO8C 3CI0J 4A3II 2E2HI 1VVDA 3GOVA 1OJVA 1ZH1A 3MZLB 2E2JI 1TPGA 1ML8A 1S7MA 1X3ZA 2F4MA 4MH4A 4F4OC 2RHBA 1Z92B 1VQNZ 2JRAA 1VQ41 1JWHC 3CXCY 3G71Z 5C44I 2YBYA 2JA8I 2AKLA 1K9M1 3JAMb 2MCZA 5C3EI 3CD61 2YADA 4J38B 3CCU1 2O39C 4NBBA 1MD7A 3BG0B 3GTMS 3S2HI 2VPXA 1NP6A 3MONA 1FBRA 3GTGI
chains in the Genus database with same CATH topology
3I55Z 1YIJZ 2LOJA 3IFUA 4E2ZA 1QGBA 3KIFA 2YRAA 2KI7B 3S16I 3CCRZ 1YHQZ 3J81b 2B63I 5FLXf 5IT9f 3VMGA 4PZ5A 1ZJKA 3BG1B 1JJ2Y 1C1ZA 3IX0A 1VQM1 3I4MI 3M3YI 4NB9A 4Y7NI 2MCYA 4E2YA 1QO6A 1VVCA 2WIIC 3D9XA 4LOSA 3CC7Z 3GTKI 3CCEZ 1TFIA 2BZMA 2W81A 1YJWZ 4E30A 1TWGI 2M48A 5HYUB 3CCQ1 4CL1A 4E32A 1X3WA 1L1OC 3RZDI 3G711 1LQLA 1Z03A 3CMEZ 1CKLA 1HFIA 2GU2A 4DK1A 1GPZA 4RV9A 4RVHA 3T4NB 2JUBA 3I551 4A3FI 1VLAA 4NBFA 1NUIA 3CCR1 1YHQ1 3R62A 2NVTI 3CC2Z 3I56Z 2KMSA 5JPMG 2JGXA 1S72Z 4NOZA 4NBDA 3CQZI 4AYEA 3OXUD 3KZJA 3SW0X 2EGTA 3PO3S 1YJN1 3CC71 3CCE1 2Y0SA 1YJW1 3U50C 1VQ61 3G6EZ 4BBRI 1H2PP 1Y1VS 3EEDA 1Q822 1GKGA 2K5RA 1USPA 1OK3A 4DQYB 3CCJ1 2B5ID 4MXUA 4BBSI 3CCLZ 1SRZA 1TWCI 2E2II 3I4NI 2M6NA 5HYPA 4HH4A 1Z02A 5T6BA 1VQ5Z 2NVXI 4E33A 2K3RA 2XWJI 1KC82 3G4SZ 2RPRA 1Q861 4MRIA 1O9AA 3OP8A 3NFZA 3GKQA 4ZH1D 3OW2Z 3I561 1KQSZ 1VQL1 3VMHA 3CPWZ 1S721 1YJ9Z 1KC81 2R7ZI 1K8A1 4YNXA 4BY1I 1PPQA 4E31A 5D1PA 3M7PA 2DE7A 3ZD1A 3O8EB 3IF8A 1K9M2 5FLXb 5IT9b 3KXVA 2R6MA 4NBAA 2OTL1 4A3MI 1TWFI 3G6E1 3EERA 1YITZ 1OJYA 4NBHA 2ERJA 2YU9I 3NDJA 3L89M 2R93I 2V8EA 2E9HA 2DE6A 1K731 1OJWA 4A3DI 4A93I 3HOYI 2JS4A 3CCL1 2RT9A 2V8IA 5FLMI 2UWNA 3CC4Z 2CG7A 4TNUA 3RZOI 3NFPI 2GTHA 1VQ7Z 1VQO1 4NBEA 3GCFA 4A3CI 1RLYA 4NBGA 3OEDC 3HOVI 1Q811 4DGLA 1QVFY 1VQKZ 1VQ91 3GTMI 3RJ3D 3GXEA 2RBLA 4MONA 2P3YA 1YJ91 1GHQB 1ZB8A 4RVFA 4HGYA 4MD7A 2WB1A 4LOTA 5HYTB 3FQMA 4A3JI 2IZ3A 2DE5A 1Q3XA 4QTTA 1M1K1 4WJG2 2QY0A 2Q4ZA 1H2QP 2XRBA 1RO2A 1P9NA 1QYPA 5T67A 3HOWI 3NDIA 3CPWY 1VQN1 4MD9A 3GTPI 2JA6I 3J80f 2JGWA 2RIQA 3CCMZ 5D1OB 3GTLI 2QA4Z 2W03A 2PMZA 3S1MI 3M4OI 4RVDA 3ERBA 1Q7Y1 3CCVZ 1YIJ1 2BJOA 2CKUA 2QEXZ 1PFTA 1W2BZ 3VMIA 4B2SA 1VQK1 2RKYA 1RQFA 2XWBF 2LIYA 4KKDA 1U5MA 3CALA 4NBCA 3ESWA 4A3LI 2H85A 5HZPB 1M901 1WCMI 4MUCA 3J7A4 3HOZI 2JMOA 2RKZA 3S17I 3PO3I 1MD8A 4EWCA 2R92I 1I6HI 3ZD2A 1VQPZ 1OK9A 1Q862 3F3FC 1TPNA 2XQWC 3CCM1 5A2Qf 1Y1VI 5LL6f 3CME1 2RLQA 4A5WB 4IGDA 5T64A 2P28A 3KIHA 2RLPA 1YUAA 3I07A 1ELVA 1X0TA 1R9TI 1K8A2 4X6AI 5IP7I 3FKII 3GTJI 2QEX1 2VUMI 2QR1B 2NVYI 3F3PC 3S1QI 1VQ4Z 2V8KA 3CC21 3NH8A 4S1TA 2NVQI 1H03P 2LFUA 4K12A 2QRCB 4XX2A 3CD6Z 2QKDA 5C4JI 1JJ2Z 3QWUA 1YUKA 2O4HA 3CCUZ 1TPMA 2EC3A 1E88A 1RO4A 3GTQI 1K732 1HFHA 4AYIA 2A55A 1W2BY 1TWHI 1QF8A 1DL6A 2OZKA 2VUGA 3NH5A 2WAQA 4FXGG 1Q812 3HOXI 1VQ8Z 3MQLA 4BXXI 1VQ51 4BY7I 1ZB9A 4NFRA 3IU3I 4RS4A 1G4FA 3J80b 3G4S1 1I3QI 2IZ4A 1KD11 3CCQZ 3ZRZA 1OK2A 1M1K2 3H3VJ 1Z01A 1K83I 3H0GI 1NWVA 1RNIA 3T5OA 4QTUA 3CMAZ 4JHSA 3Q87A 1USPB 2QREB 4C16A 4A3BI 3OW2Y 1YI2Z 1YIT1 1KQSY 1Q7Y2 2OOXB 1E8BA 4AYBA 4HGZA 1VQ81 4A3EI 1H04P 3CC41 1YJNZ 3FQQA 1VQ71 3JAMf 5I0QB 1WIIA 3CCSZ 2PK7A 1GKNA 1VQ6Z 5IP9I 1M902 1UOTP 3TDHB 5A2Qb 1NJI2 2F4OA 2KPIA 2QRDB 2V8JA 3P5JB 3VTNA 1LY2A 3S15I 2VF1A 3TVJA 2W04A 3CCJZ 2RL0A 5CM2M 2GTIA 3EJHA 3J81f 4CSYA 3K7AI 1QUBA 1RO0A 2JNYA 2OTJZ 1NJI1 3TE5B 1QVGZ 3CMA1 1G4GA 4A3GI 2JA7I 4Y52I 2G7IA 4DJZA 1YI21 1TWAI 2OOYB 3NH4A 2G2KA 3S2DI 1Y1WI 1VQLZ 4RVGA 3D6WA 3VB9A 3INBC 1I50I 4E2WA 2W80A 3CXCZ 4ONTD 2QA41 3S1NI 5AN9F 1SFOI 2O53A 2XRDA 2J6AA 3CCS1 3CCV1 3LUSA 2KRIA 2OTLZ 4MD8A 2QLVB 1KRLA 5C4XI 3MZKB 2JA5I 3HOUI 1E5GA 1QVFZ 3PO2I 1HCCA 2HU9A 2JR6A 1OK1A 2OTJ1 1WW9A 1VQOZ 1Q821 4NB8A 3HKZA 2PM9A 4AYDA 1N8R2 5D1OA 3S1RI 1VQ9Z 3GTOI 4AYMA 2CG6A 2HF1A 1SS2A 1VQP1 4NH1C 2ZAEB 2EHFA 1N2FA 1VQMZ 1QVGY 1KD12 3S14I 4A3KI 2Q51A 1N8R1 4E2XA 2I3CA 4B2RA 5FO8C 4A3II 2E2HI 1VVDA 3GOVA 1OJVA 1ZH1A 3MZLB 2E2JI 1TPGA 1ML8A 1S7MA 1X3ZA 2F4MA 4MH4A 4F4OC 2RHBA 1Z92B 1VQNZ 2JRAA 1VQ41 1JWHC 3CXCY 3G71Z 5C44I 2YBYA 2JA8I 2AKLA 1K9M1 3JAMb 2MCZA 5C3EI 3CD61 2YADA 4J38B 3CCU1 2O39C 4NBBA 1MD7A 3BG0B 3GTMS 3S2HI 1NP6A 3MONA 1FBRA 3GTGI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TPN A;  2LOJ A;  2XQW C;  3M7P A;  1QGB A;  3ZD1 A;  1LY2 A;  2YRA A;  3O8E B;  2RLQ A;  4A5W B;  3KXV A;  4IGD A;  3TVJ A;  2RL0 A;  2RLP A;  4PZ5 A;  3EJH A;  1ZJK A;  1OJY A;  4CSY A;  1C1Z A;  1QUB A;  3IX0 A;  1ELV A;  2ERJ A;  3L89 M;  1G4G A;  2V8E A;  1OJW A;  2MCY A;  1QO6 A;  1VVC A;  2WII C;  4LOS A;  2G7I A;  4DJZ A;  2UWN A;  1H03 P;  2BZM A;  2W81 A;  2CG7 A;  4K12 A;  3NFP I;  5HYU B;  3OED C;  1TPM A;  2EC3 A;  1E88 A;  3INB C;  2W80 A;  4ONT D;  1HFH A;  4AYI A;  2A55 A;  3RJ3 D;  1CKL A;  3GXE A;  1HFI A;  2XRD A;  2KRI A;  1GPZ A;  1GHQ B;  4FXG G;  4LOT A;  5HYT B;  3MQL A;  2IZ3 A;  1Q3X A;  1E5G A;  4WJG 2;  2QY0 A;  1H2Q P;  2XRB A;  3R62 A;  2KMS A;  1HCC A;  5JPM G;  2JGX A;  3IU3 I;  1OK1 A;  1G4F A;  2IZ4 A;  4AYE A;  3OXU D;  3KZJ A;  4AYD A;  2JGW A;  3ZRZ A;  3SW0 X;  1OK2 A;  4AYM A;  2CG6 A;  1SS2 A;  2EHF A;  1H2P P;  3ERB A;  1NWV A;  3T5O A;  4JHS A;  2CKU A;  1GKG A;  1OK3 A;  4B2S A;  4B2R A;  5FO8 C;  4C16 A;  2B5I D;  1VVD A;  3GOV A;  1SRZ A;  1OJV A;  2RKY A;  1TPG A;  2XWB F;  5HYP A;  4KKD A;  2XWJ I;  1U5M A;  3CAL A;  1E8B A;  4F4O C;  5HZP B;  1Z92 B;  2JRA A;  1H04 P;  1O9A A;  3OP8 A;  4MUC A;  2YBY A;  2MCZ A;  2RKZ A;  4ZH1 D;  5I0Q B;  1MD8 A;  4J38 B;  1GKN A;  2O39 C;  3ZD2 A;  1OK9 A;  1MD7 A;  1UOT P;  4YNX A;  1PPQ A;  1FBR A; 
#chains in the Genus database with same CATH topology
 3I55 Z;  1YIJ Z;  2LOJ A;  3IFU A;  4E2Z A;  1QGB A;  3KIF A;  2IV2 X;  2YRA A;  2KI7 B;  3S16 I;  3CCR Z;  1YHQ Z;  3J81 b;  2B63 I;  5FLX f;  5IT9 f;  3VMG A;  4PZ5 A;  1ZJK A;  3BG1 B;  1JJ2 Y;  1C1Z A;  3IX0 A;  1VQM 1;  3I4M I;  3M3Y I;  4NB9 A;  4Y7N I;  2MCY A;  4E2Y A;  1QO6 A;  1VVC A;  2WII C;  3D9X A;  4LOS A;  2JIO A;  3CC7 Z;  3GTK I;  3CCE Z;  1TFI A;  2BZM A;  2W81 A;  1YJW Z;  4E30 A;  1TWG I;  2M48 A;  5HYU B;  3CCQ 1;  4CL1 A;  4E32 A;  1X3W A;  1L1O C;  3RZD I;  3G71 1;  1LQL A;  2VPZ A;  1Z03 A;  3CME Z;  1CKL A;  1HFI A;  2GU2 A;  4DK1 A;  1GPZ A;  4RV9 A;  4RVH A;  3T4N B;  2JUB A;  3I55 1;  4A3F I;  1VLA A;  4NBF A;  1NUI A;  3CCR 1;  1YHQ 1;  3R62 A;  2NVT I;  3CC2 Z;  3I56 Z;  2KMS A;  2JIP A;  5JPM G;  2JGX A;  1S72 Z;  4NOZ A;  4NBD A;  3CQZ I;  4AYE A;  3F6K A;  3FGR A;  3OXU D;  3KZJ A;  3SW0 X;  2EGT A;  3PO3 S;  1YJN 1;  3CC7 1;  3CCE 1;  2Y0S A;  1YJW 1;  3U50 C;  1VQ6 1;  3G6E Z;  4BBR I;  1H2P P;  1Y1V S;  3EED A;  1Q82 2;  1GKG A;  2K5R A;  1USP A;  1OK3 A;  4DQY B;  3CCJ 1;  2B5I D;  4MXU A;  4BBS I;  3CCL Z;  1SRZ A;  1TWC I;  2E2I I;  3I4N I;  2M6N A;  5HYP A;  4HH4 A;  5DN5 A;  1Z02 A;  5T6B A;  1VQ5 Z;  4E33 A;  2K3R A;  2NVX I;  2XWJ I;  1KC8 2;  3G4S Z;  2RPR A;  1Q86 1;  4MRI A;  1O9A A;  3OP8 A;  3NFZ A;  3GKQ A;  1QXF A;  1FDO A;  4ZH1 D;  3OW2 Z;  3ZLE A;  3D2L A;  3I56 1;  1KQS Z;  1VQL 1;  3VMH A;  3CPW Z;  1S72 1;  1YJ9 Z;  1KC8 1;  2R7Z I;  1K8A 1;  4YNX A;  4BY1 I;  1PPQ A;  4E31 A;  2JIR A;  5D1P A;  3M7P A;  2DE7 A;  3ZD1 A;  3O8E B;  3IF8 A;  1K9M 2;  5FLX b;  5IT9 b;  3KXV A;  2R6M A;  4NBA A;  2OTL 1;  4A3M I;  1TWF I;  3G6E 1;  3EER A;  1YIT Z;  1OJY A;  4NBH A;  2ERJ A;  2YU9 I;  3NDJ A;  3L89 M;  2R93 I;  2V8E A;  2E7Z A;  2E9H A;  2DE6 A;  1FDI A;  1K73 1;  1OJW A;  4A3D I;  4A93 I;  3HOY I;  2JS4 A;  2NAP A;  3CCL 1;  2RT9 A;  2V8I A;  5FLM I;  2UWN A;  3CC4 Z;  2CG7 A;  4TNU A;  3RZO I;  3NFP I;  2GTH A;  1VQ7 Z;  1VQO 1;  4NBE A;  3GCF A;  4A3C I;  1RLY A;  4NBG A;  3OED C;  3HOV I;  1Q81 1;  4DGL A;  1QVF Y;  1VQK Z;  1VQ9 1;  3GTM I;  3RJ3 D;  4PO7 A;  3GXE A;  2RBL A;  4MON A;  2P3Y A;  1YJ9 1;  1GHQ B;  1ZB8 A;  4RVF A;  1SIW A;  4HGY A;  4MD7 A;  2WB1 A;  4LOT A;  5HYT B;  3FQM A;  4A3J I;  2IZ3 A;  2DE5 A;  1Q3X A;  4QTT A;  1M1K 1;  4WJG 2;  2QY0 A;  2Q4Z A;  1H2Q P;  2XRB A;  1RO2 A;  2JIQ A;  1P9N A;  1QYP A;  5T67 A;  3HOW I;  3NDI A;  3CPW Y;  1VQN 1;  4MD9 A;  3GTP I;  2JIM A;  2JA6 I;  3J80 f;  2JGW A;  2RIQ A;  3CCM Z;  5D1O B;  3GTL I;  2QA4 Z;  2W03 A;  2PMZ A;  3S1M I;  3M4O I;  4RVD A;  3ERB A;  1Q7Y 1;  3CCV Z;  1YIJ 1;  2BJO A;  2CKU A;  2QEX Z;  1PFT A;  1W2B Z;  2X2Z A;  3VMI A;  4B2S A;  1VQK 1;  2RKY A;  1RQF A;  2XWB F;  2LIY A;  2Y8R A;  4KKD A;  1U5M A;  3CAL A;  4NBC A;  3ESW A;  4A3L I;  2H85 A;  5HZP B;  1M90 1;  4MSL A;  1WCM I;  4MUC A;  3J7A 4;  3HOZ I;  2JMO A;  2RKZ A;  1AA6 A;  3S17 I;  3PO3 I;  5DN4 A;  1MD8 A;  4EWC A;  2R92 I;  1I6H I;  3ZD2 A;  1VQP Z;  1OK9 A;  1Q86 2;  3F3F C;  1TPN A;  2XQW C;  3CCM 1;  5A2Q f;  1Y1V I;  5LL6 f;  3CME 1;  2RLQ A;  4A5W B;  4IGD A;  5T64 A;  2P28 A;  3KIH A;  2RLP A;  1YUA A;  3I07 A;  1ELV A;  1X0T A;  1R9T I;  1K8A 2;  4X6A I;  5IP7 I;  4YIZ A;  3FKI I;  3GTJ I;  2QEX 1;  2VUM I;  2QR1 B;  2NVY I;  3F3P C;  2VPY A;  3S1Q I;  1VQ4 Z;  2V8K A;  3CC2 1;  3WSY A;  3NH8 A;  4S1T A;  2NVQ I;  1H03 P;  2LFU A;  4K12 A;  2QRC B;  4XX2 A;  3CD6 Z;  3ZLD A;  2QKD A;  5C4J I;  1JJ2 Z;  3QWU A;  1YUK A;  2O4H A;  3CCU Z;  1TPM A;  2EC3 A;  1E88 A;  1RO4 A;  3GTQ I;  1K73 2;  1RLH A;  1HFH A;  4AYI A;  2A55 A;  1W2B Y;  1TWH I;  1QF8 A;  1DL6 A;  2OZK A;  1Y8C A;  2VUG A;  3NH5 A;  2WAQ A;  4FXG G;  1Q81 2;  3HOX I;  1VQ8 Z;  2AYD A;  3MQL A;  4BXX I;  1VQ5 1;  4BY7 I;  1ZB9 A;  4NFR A;  3FGT A;  3IU3 I;  4RS4 A;  1G4F A;  3J80 b;  3G4S 1;  1I3Q I;  2IZ4 A;  1KD1 1;  3CCQ Z;  3ZRZ A;  1OK2 A;  1M1K 2;  3H3V J;  1Z01 A;  1K83 I;  3H0G I;  1NWV A;  1RNI A;  3T5O A;  4QTU A;  3CMA Z;  4JHS A;  3Q87 A;  1USP B;  2QRE B;  4C16 A;  4A3B I;  3OW2 Y;  1YI2 Z;  1YIT 1;  1KQS Y;  3WSX A;  1Q7Y 2;  2VPW A;  2OOX B;  2I2L A;  1E8B A;  1Q16 A;  4AYB A;  4HGZ A;  1VQ8 1;  4A3E I;  1H04 P;  3CC4 1;  1WJ2 A;  1YJN Z;  3FQQ A;  1VQ7 1;  3JAM f;  5I0Q B;  1WII A;  3CCS Z;  2PK7 A;  1GKN A;  2LEX A;  1VQ6 Z;  5IP9 I;  1M90 2;  1UOT P;  3TDH B;  5A2Q b;  1NJI 2;  2F4O A;  2KPI A;  2QRD B;  2V8J A;  2Y8T A;  3P5J B;  3VTN A;  1LY2 A;  3S15 I;  2VF1 A;  1WZN A;  3TVJ A;  2W04 A;  3CCJ Z;  2RL0 A;  5CM2 M;  2GTI A;  3EJH A;  3J81 f;  4CSY A;  3K7A I;  1QUB A;  1RO0 A;  2JNY A;  2OTJ Z;  1NJI 1;  3TE5 B;  3IR7 A;  1QVG Z;  3CMA 1;  1G4G A;  4A3G I;  2JA7 I;  4Y52 I;  2G7I A;  4DJZ A;  3NJA A;  1YI2 1;  1TWA I;  2OOY B;  3NH4 A;  2G2K A;  3S2D I;  2V45 A;  1Y1W I;  1VQL Z;  4RVG A;  3D6W A;  3VB9 A;  3INB C;  1I50 I;  4E2W A;  2W80 A;  4N7E A;  4ONT D;  3CXC Z;  2QA4 1;  3S1N I;  3VWO A;  5AN9 F;  1SFO I;  2O53 A;  2XRD A;  2J6A A;  3CCS 1;  3CCV 1;  3LUS A;  2KRI A;  2OTL Z;  4MD8 A;  2QLV B;  1KRL A;  5C4X I;  3MZK B;  2JA5 I;  3HOU I;  1E5G A;  1QVF Z;  3K3T A;  3PO2 I;  1HCC A;  2HU9 A;  4APL A;  2JR6 A;  1OK1 A;  2OTJ 1;  1WW9 A;  2ZYC A;  1VQO Z;  1Q82 1;  4NB8 A;  3HKZ A;  2PM9 A;  4AYD A;  1N8R 2;  5D1O A;  2V3V A;  3S1R I;  1VQ9 Z;  3GTO I;  4AYM A;  2CG6 A;  2HF1 A;  1SS2 A;  1VQP 1;  4NH1 C;  2ZAE B;  2EHF A;  4BWC A;  1N2F A;  1VQM Z;  2Y8S A;  1QVG Y;  1KD1 2;  3S14 I;  4A3K I;  2Q51 A;  1N8R 1;  4E2X A;  2I3C A;  4B2R A;  5FO8 C;  3CI0 J;  4A3I I;  2E2H I;  1VVD A;  3GOV A;  1OJV A;  1ZH1 A;  3MZL B;  2E2J I;  1TPG A;  1ML8 A;  1S7M A;  1X3Z A;  2F4M A;  4MH4 A;  4F4O C;  2RHB A;  1Z92 B;  1VQN Z;  2JRA A;  1VQ4 1;  1JWH C;  3CXC Y;  3G71 Z;  5C44 I;  2YBY A;  2JA8 I;  2AKL A;  1K9M 1;  3JAM b;  2MCZ A;  5C3E I;  3CD6 1;  2YAD A;  4J38 B;  3CCU 1;  2O39 C;  4NBB A;  1MD7 A;  3BG0 B;  3GTM S;  3S2H I;  2VPX A;  1NP6 A;  3MON A;  1FBR A;  3GTG I; 
#chains in the Genus database with same CATH homology
 3I55 Z;  1YIJ Z;  2LOJ A;  3IFU A;  4E2Z A;  1QGB A;  3KIF A;  2YRA A;  2KI7 B;  3S16 I;  3CCR Z;  1YHQ Z;  3J81 b;  2B63 I;  5FLX f;  5IT9 f;  3VMG A;  4PZ5 A;  1ZJK A;  3BG1 B;  1JJ2 Y;  1C1Z A;  3IX0 A;  1VQM 1;  3I4M I;  3M3Y I;  4NB9 A;  4Y7N I;  2MCY A;  4E2Y A;  1QO6 A;  1VVC A;  2WII C;  3D9X A;  4LOS A;  3CC7 Z;  3GTK I;  3CCE Z;  1TFI A;  2BZM A;  2W81 A;  1YJW Z;  4E30 A;  1TWG I;  2M48 A;  5HYU B;  3CCQ 1;  4CL1 A;  4E32 A;  1X3W A;  1L1O C;  3RZD I;  3G71 1;  1LQL A;  1Z03 A;  3CME Z;  1CKL A;  1HFI A;  2GU2 A;  4DK1 A;  1GPZ A;  4RV9 A;  4RVH A;  3T4N B;  2JUB A;  3I55 1;  4A3F I;  1VLA A;  4NBF A;  1NUI A;  3CCR 1;  1YHQ 1;  3R62 A;  2NVT I;  3CC2 Z;  3I56 Z;  2KMS A;  5JPM G;  2JGX A;  1S72 Z;  4NOZ A;  4NBD A;  3CQZ I;  4AYE A;  3OXU D;  3KZJ A;  3SW0 X;  2EGT A;  3PO3 S;  1YJN 1;  3CC7 1;  3CCE 1;  2Y0S A;  1YJW 1;  3U50 C;  1VQ6 1;  3G6E Z;  4BBR I;  1H2P P;  1Y1V S;  3EED A;  1Q82 2;  1GKG A;  2K5R A;  1USP A;  1OK3 A;  4DQY B;  3CCJ 1;  2B5I D;  4MXU A;  4BBS I;  3CCL Z;  1SRZ A;  1TWC I;  2E2I I;  3I4N I;  2M6N A;  5HYP A;  4HH4 A;  1Z02 A;  5T6B A;  1VQ5 Z;  2NVX I;  4E33 A;  2K3R A;  2XWJ I;  1KC8 2;  3G4S Z;  2RPR A;  1Q86 1;  4MRI A;  1O9A A;  3OP8 A;  3NFZ A;  3GKQ A;  4ZH1 D;  3OW2 Z;  3I56 1;  1KQS Z;  1VQL 1;  3VMH A;  3CPW Z;  1S72 1;  1YJ9 Z;  1KC8 1;  2R7Z I;  1K8A 1;  4YNX A;  4BY1 I;  1PPQ A;  4E31 A;  5D1P A;  3M7P A;  2DE7 A;  3ZD1 A;  3O8E B;  3IF8 A;  1K9M 2;  5FLX b;  5IT9 b;  3KXV A;  2R6M A;  4NBA A;  2OTL 1;  4A3M I;  1TWF I;  3G6E 1;  3EER A;  1YIT Z;  1OJY A;  4NBH A;  2ERJ A;  2YU9 I;  3NDJ A;  3L89 M;  2R93 I;  2V8E A;  2E9H A;  2DE6 A;  1K73 1;  1OJW A;  4A3D I;  4A93 I;  3HOY I;  2JS4 A;  3CCL 1;  2RT9 A;  2V8I A;  5FLM I;  2UWN A;  3CC4 Z;  2CG7 A;  4TNU A;  3RZO I;  3NFP I;  2GTH A;  1VQ7 Z;  1VQO 1;  4NBE A;  3GCF A;  4A3C I;  1RLY A;  4NBG A;  3OED C;  3HOV I;  1Q81 1;  4DGL A;  1QVF Y;  1VQK Z;  1VQ9 1;  3GTM I;  3RJ3 D;  3GXE A;  2RBL A;  4MON A;  2P3Y A;  1YJ9 1;  1GHQ B;  1ZB8 A;  4RVF A;  4HGY A;  4MD7 A;  2WB1 A;  4LOT A;  5HYT B;  3FQM A;  4A3J I;  2IZ3 A;  2DE5 A;  1Q3X A;  4QTT A;  1M1K 1;  4WJG 2;  2QY0 A;  2Q4Z A;  1H2Q P;  2XRB A;  1RO2 A;  1P9N A;  1QYP A;  5T67 A;  3HOW I;  3NDI A;  3CPW Y;  1VQN 1;  4MD9 A;  3GTP I;  2JA6 I;  3J80 f;  2JGW A;  2RIQ A;  3CCM Z;  5D1O B;  3GTL I;  2QA4 Z;  2W03 A;  2PMZ A;  3S1M I;  3M4O I;  4RVD A;  3ERB A;  1Q7Y 1;  3CCV Z;  1YIJ 1;  2BJO A;  2CKU A;  2QEX Z;  1PFT A;  1W2B Z;  3VMI A;  4B2S A;  1VQK 1;  2RKY A;  1RQF A;  2XWB F;  2LIY A;  4KKD A;  1U5M A;  3CAL A;  4NBC A;  3ESW A;  4A3L I;  2H85 A;  5HZP B;  1M90 1;  1WCM I;  4MUC A;  3J7A 4;  3HOZ I;  2JMO A;  2RKZ A;  3S17 I;  3PO3 I;  1MD8 A;  4EWC A;  2R92 I;  1I6H I;  3ZD2 A;  1VQP Z;  1OK9 A;  1Q86 2;  3F3F C;  1TPN A;  2XQW C;  3CCM 1;  5A2Q f;  1Y1V I;  5LL6 f;  3CME 1;  2RLQ A;  4A5W B;  4IGD A;  5T64 A;  2P28 A;  3KIH A;  2RLP A;  1YUA A;  3I07 A;  1ELV A;  1X0T A;  1R9T I;  1K8A 2;  4X6A I;  5IP7 I;  3FKI I;  3GTJ I;  2QEX 1;  2VUM I;  2QR1 B;  2NVY I;  3F3P C;  3S1Q I;  1VQ4 Z;  2V8K A;  3CC2 1;  3NH8 A;  4S1T A;  2NVQ I;  1H03 P;  2LFU A;  4K12 A;  2QRC B;  4XX2 A;  3CD6 Z;  2QKD A;  5C4J I;  1JJ2 Z;  3QWU A;  1YUK A;  2O4H A;  3CCU Z;  1TPM A;  2EC3 A;  1E88 A;  1RO4 A;  3GTQ I;  1K73 2;  1HFH A;  4AYI A;  2A55 A;  1W2B Y;  1TWH I;  1QF8 A;  1DL6 A;  2OZK A;  2VUG A;  3NH5 A;  2WAQ A;  4FXG G;  1Q81 2;  3HOX I;  1VQ8 Z;  3MQL A;  4BXX I;  1VQ5 1;  4BY7 I;  1ZB9 A;  4NFR A;  3IU3 I;  4RS4 A;  1G4F A;  3J80 b;  3G4S 1;  1I3Q I;  2IZ4 A;  1KD1 1;  3CCQ Z;  3ZRZ A;  1OK2 A;  1M1K 2;  3H3V J;  1Z01 A;  1K83 I;  3H0G I;  1NWV A;  1RNI A;  3T5O A;  4QTU A;  3CMA Z;  4JHS A;  3Q87 A;  1USP B;  2QRE B;  4C16 A;  4A3B I;  3OW2 Y;  1YI2 Z;  1YIT 1;  1KQS Y;  1Q7Y 2;  2OOX B;  1E8B A;  4AYB A;  4HGZ A;  1VQ8 1;  4A3E I;  1H04 P;  3CC4 1;  1YJN Z;  3FQQ A;  1VQ7 1;  3JAM f;  5I0Q B;  1WII A;  3CCS Z;  2PK7 A;  1GKN A;  1VQ6 Z;  5IP9 I;  1M90 2;  1UOT P;  3TDH B;  5A2Q b;  1NJI 2;  2F4O A;  2KPI A;  2QRD B;  2V8J A;  3P5J B;  3VTN A;  1LY2 A;  3S15 I;  2VF1 A;  3TVJ A;  2W04 A;  3CCJ Z;  2RL0 A;  5CM2 M;  2GTI A;  3EJH A;  3J81 f;  4CSY A;  3K7A I;  1QUB A;  1RO0 A;  2JNY A;  2OTJ Z;  1NJI 1;  3TE5 B;  1QVG Z;  3CMA 1;  1G4G A;  4A3G I;  2JA7 I;  4Y52 I;  2G7I A;  4DJZ A;  1YI2 1;  1TWA I;  2OOY B;  3NH4 A;  2G2K A;  3S2D I;  1Y1W I;  1VQL Z;  4RVG A;  3D6W A;  3VB9 A;  3INB C;  1I50 I;  4E2W A;  2W80 A;  3CXC Z;  4ONT D;  2QA4 1;  3S1N I;  5AN9 F;  1SFO I;  2O53 A;  2XRD A;  2J6A A;  3CCS 1;  3CCV 1;  3LUS A;  2KRI A;  2OTL Z;  4MD8 A;  2QLV B;  1KRL A;  5C4X I;  3MZK B;  2JA5 I;  3HOU I;  1E5G A;  1QVF Z;  3PO2 I;  1HCC A;  2HU9 A;  2JR6 A;  1OK1 A;  2OTJ 1;  1WW9 A;  1VQO Z;  1Q82 1;  4NB8 A;  3HKZ A;  2PM9 A;  4AYD A;  1N8R 2;  5D1O A;  3S1R I;  1VQ9 Z;  3GTO I;  4AYM A;  2CG6 A;  2HF1 A;  1SS2 A;  1VQP 1;  4NH1 C;  2ZAE B;  2EHF A;  1N2F A;  1VQM Z;  1QVG Y;  1KD1 2;  3S14 I;  4A3K I;  2Q51 A;  1N8R 1;  4E2X A;  2I3C A;  4B2R A;  5FO8 C;  4A3I I;  2E2H I;  1VVD A;  3GOV A;  1OJV A;  1ZH1 A;  3MZL B;  2E2J I;  1TPG A;  1ML8 A;  1S7M A;  1X3Z A;  2F4M A;  4MH4 A;  4F4O C;  2RHB A;  1Z92 B;  1VQN Z;  2JRA A;  1VQ4 1;  1JWH C;  3CXC Y;  3G71 Z;  5C44 I;  2YBY A;  2JA8 I;  2AKL A;  1K9M 1;  3JAM b;  2MCZ A;  5C3E I;  3CD6 1;  2YAD A;  4J38 B;  3CCU 1;  2O39 C;  4NBB A;  1MD7 A;  3BG0 B;  3GTM S;  3S2H I;  1NP6 A;  3MON A;  1FBR A;  3GTG I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...