3IX0A

Crystal structure of human seminal plasma protein psp94
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
87
Chain Sequence
SCYFIPNEGKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-microseminoprotein
publication title Crystal structure of prostate secretory protein PSP94 shows an edge-to-edge association of two monomers to form a homodimer
pubmed doi rcsb
molecule tags Antitumor protein, apoptosis
total genus 13
structure length 87
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ix0A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ix0A02
2IZ4A 1H03P 3RJ3D 1ELVA 4FXGG 4A5WB 2YRAA 4KKDA 1GKNA 1OK1A 1PPQA 4YNXA 2CKUA 1TPMA 2G7IA 4B2SA 3L89M 2MCYA 4B2RA 1TPGA 2WIIC 2IZ3A 2JGWA 1H04P 1Q3XA 2LOJA 2XQWC 2A55A 5FO8C 2KMSA 3OEDC 2CG7A 2O39C 1ZJKA 2RL0A 1MD8A 5HYTB 3OP8A 1CKLA 1H2PP 3KZJA 4MUCA 2BZMA 4DJZA 1G4GA 1GHQB 2XRBA 1OK2A 1SS2A 4PZ5A 2JGXA 5I0QB 1GPZA 2EHFA 4CSYA 1OJVA 1HFHA 2QY0A 1OK3A 1QUBA 2B5ID 2RLQA 3T5OA 1SRZA 3OXUD 1MD7A 1QGBA 3ZD2A 4F4OC 3ZRZA 2XRDA 2EC3A 4ZH1D 2UWNA 3GXEA 3IX0A 5HZPB 2MCZA 2RKZA 1OJYA 1NWVA 4WJG2 4LOTA 4J38B 4JHSA 3ERBA 3CALA 1VVCA 3M7PA 2KRIA 1O9AA 2XWBF 4AYDA 3KXVA 3EJHA 4AYEA 2V8EA 4LOSA 1Z92B 1HFIA 4AYIA 1LY2A 3ZD1A 1GKGA 1U5MA 2W80A 2CG6A 4C16A 1E88A 1QO6A 2YBYA 3NFPI 1C1ZA 2RKYA 5HYPA 1FBRA 3TVJA 1E5GA 1OK9A 1H2QP 3O8EB 1E8BA 1G4FA 2ERJA 5HYUB 1TPNA 1OJWA 3MQLA 1VVDA 3SW0X 2XWJI 3GOVA 4K12A 1HCCA 4AYMA 4IGDA 5JPMG 3IU3I 2RLPA 4ONTD 2JRAA 2W81A 1UOTP 3R62A 3INBC
chains in the Genus database with same CATH superfamily
3FQQA 1TWGI 3NFZA 3H3VJ 5LL6f 2YRAA 2VUMI 3K3TA 4A3KI 2PK7A 4RV9A 1PPQA 1ZH1A 4NB9A 2YU9I 1TWFI 2AYDA 3F3PC 2Q4ZA 3I561 3L89M 5FLMI 3CCJZ 4DQYB 3S15I 3CCJ1 5D1OB 4A3FI 4NBDA 1TFIA 1WCMI 2VPWA 1TWAI 4E33A 3OEDC 2DE6A 4NBHA 2RL0A 1ZJKA 1ML8A 2OTL1 4BWCA 2Q51A 1VQPZ 3GTPI 3OP8A 4Y7NI 3OW2Z 1H2PP 3GTGI 3JAMf 1S72Z 1S721 2JA7I 1G4GA 1GHQB 2XRBA 1SS2A 1GPZA 2HF1A 1OJVA 4NBCA 2QY0A 3D6WA 1RO4A 3P5JB 3S1NI 2RLQA 1YUAA 1KC81 1K732 2XRDA 2EC3A 3CC2Z 1QVFZ 3CC21 2MCZA 2RKZA 4WJG2 3S2HI 4LOTA 4JHSA 3RZDI 2JA8I 4APLA 1W2BY 1K9M1 1JJ2Y 3HOUI 3T4NB 2O53A 1USPB 3FQMA 2WB1A 2E2HI 1RNIA 3CALA 2DE5A 1FDIA 5IP7I 4A3MI 3J81f 1KRLA 5AN9F 1VQKZ 2K3RA 3D9XA 2V8EA 4LOSA 3HOVI 3I4NI 1LY2A 1Z01A 2K5RA 3S14I 4DK1A 3HOWI 4C16A 3S16I 1VLAA 2I3CA 1E5GA 1G4FA 3F3FC 1YI2Z 3KIHA 1YI21 2JIPA 2QREB 1YITZ 3J81b 3I07A 4BBRI 2XWJI 1YIT1 3G71Z 1NP6A 1HCCA 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 4IGDA 4ONTD 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 3WSYA 3RJ3D 1WJ2A 1KC82 4N7EA 4RVGA 3EEDA 3CXCY 3PO2I 4FXGG 4A5WB 3CCMZ 2P3YA 1FDOA 4KKDA 3CCM1 1GKNA 1Q821 3CCS1 1Q811 1K9M2 5C4XI 2CKUA 3S2DI 3VWOA 1QVGZ 3CMEZ 1Q861 1YUKA 3CME1 2VF1A 2X2ZA 3G6E1 1NUIA 5CM2M 4E32A 1VQ9Z 4B2RA 1TPGA 2IZ3A 1VQ91 1H04P 2XQWC 1AA6A 2QR1B 2JA6I 2CG7A 2V8JA 2NVXI 2W04A 1QXFA 1VQMZ 3EERA 1M901 1VQM1 3NH8A 4A3CI 3HKZA 3KIFA 2E7ZA 3GTMI 3KZJA 2JIRA 4MD7A 1X0TA 1RO2A 1WZNA 2RIQA 3M4OI 3M3YI 2VPXA 1OK2A 4A3BI 2M6NA 4MXUA 2EHFA 3MZLB 3I56Z 1HFHA 2KPIA 3J7A4 3K7AI 1QUBA 5T67A 1VQ4Z 3GTLI 1VQ41 4E2ZA 1Q7Y2 1QGBA 4NH1C 3ZRZA 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 3CCVZ 1M1K1 3CCV1 2DE7A 1YJ9Z 2LEXA 1YJ91 1DL6A 3ZLDA 3NDJA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 3J80f 3CMA1 2OTJ1 1Q812 4E31A 4AYDA 3OW2Y 1Q862 3EJHA 2QEX1 2E2JI 5IP9I 2JR6A 2JMOA 3D2LA 3S1MI 1RQFA 4A3DI 2GTIA 1Y8CA 4A3JI 2RPRA 3HOZI 3ZD1A 1Y1VS 4YIZA 2QLVB 1U5MA 3Q87A 4HH4A 2CG6A 2JIOA 1K731 3NDIA 1SIWA 1QO6A 2YBYA 1C1ZA 5T64A 1M902 3PO3I 4BXXI 2M48A 2RBLA 1L1OC 3U50C 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1N8R1 1QVFY 4PO7A 3MQLA 2O4HA 3GOVA 2VPZA 4AYMA 4NBEA 1X3ZA 4HGZA 5JPMG 5T6BA 2JRAA 2W81A 1ZB9A 1SFOI 4E2YA 3GTJI 3INBC 1YJWZ 2I2LA 2IZ4A 1H03P 1YJW1 2JUBA 5C4JI 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2KI7B 5DN5A 2R92I 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 3CC4Z 1S7MA 2G7IA 3CC41 2QA4Z 1Y1WI 2WIIC 2QA41 3HOXI 4MRIA 1Q3XA 2LOJA 3VTNA 2A55A 1YHQZ 1K8A1 3NH4A 3S1QI 1YJNZ 2KMSA 1YJN1 4EWCA 2IV2X 2O39C 1RLYA 3GTOI 2F4OA 1MD8A 4A3LI 4X6AI 2R7ZI 4MUCA 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 3MZKB 1JWHC 4DJZA 1KD11 4A3GI 1N8R2 2V45A 1RLHA 2G2KA 4CSYA 4S1TA 3G6EZ 3CCE1 1OK3A 2B5ID 4E30A 4MD8A 3FGTA 1QVGY 2V8IA 4F4OC 1QF8A 3ZLEA 4ZH1D 2UWNA 5HZPB 4NBFA 2RHBA 2NVQI 2NAPA 4MH4A 3ERBA 4QTTA 1VVCA 2J6AA 3M7PA 2KRIA 5C3EI 4NBAA 2XWBF 3KXVA 4AYEA 2AKLA 3NH5A 1X3WA 1Z92B 4AYIA 1K8A2 1GKGA 2BJOA 1VQ5Z 2W80A 1Z02A 3LUSA 2B63I 3NFPI 5HYPA 1FBRA 4NBGA 1OK9A 3IF8A 3O8EB 1E8BA 2ERJA 1TPNA 1OJWA 2JIMA 3CD6Z 1VVDA 2Y8TA 3SW0X 1KD12 3CD61 4K12A 2OOYB 3CI0J 5C44I 1NJI1 2QEXZ 4Y52I 2VPYA 4XX2A 1KQSY 3IU3I 2RLPA 2OOXB 1TWHI 2Y8SA 3TE5B 2P28A 3VB9A 2JNYA 4RVHA 4A3EI 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 5D1OA 2QKDA 3GTKI 2NVYI 2V8KA 1VQP1 1ELVA 3IR7A 1OK1A 4YNXA 1WIIA 2W03A 3ESWA 3NJAA 1VQ7Z 2Y8RA 1VQ71 3J80b 4NBBA 1TPMA 4B2SA 1Q16A 2MCYA 1K83I 2JGWA 3GTQI 3CPWY 5FO8C 1W2BZ 1JJ2Z 2E2II 3GCFA 4BBSI 5HYTB 4A3II 1P9NA 3QWUA 2F4MA 1CKLA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 2BZMA 5IT9b 4A93I 5D1PA 4PZ5A 2JGXA 3GTMS 4RVFA 5I0QB 2LIYA 1VQK1 2JIQA 1R9TI 1USPA 3FKII 1YIJZ 1YIJ1 1NJI2 3WSXA 3F6KA 3T5OA 1SRZA 3OXUD 3CQZI 1MD7A 3ZD2A 3GXEA 3IX0A 2PM9A 2LFUA 1OJYA 1NWVA 1LQLA 4J38B 4MSLA 2VUGA 1VQOZ 3VMHA 5FLXb 2OZKA 2V3VA 1O9AA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1Y1VI 3CCEZ 1VQ81 2ZYCA 3I4MI 1HFIA 1QYPA 2R6MA 1RO0A 1VQ6Z 3CCRZ 1VQ61 3CCR1 1E88A 2RKYA 3I55Z 1TWCI 3RZOI 2RT9A 3I551 2WAQA 4HGYA 3TVJA 1H2QP 5HYUB 5A2Qb 3FGRA 4AYBA 3PO3S 4MD9A 3VMIA 3CCUZ 5DN4A 3CCU1 2E9HA 2QRDB 4E2WA 3S17I 2JA5I 3CC7Z 2NVTI 3CC71 1VQLZ 4DGLA 1UOTP 1WW9A 1VQL1 3R62A 4RVDA
chains in the Genus database with same CATH topology
3FQQA 1TWGI 3NFZA 3H3VJ 5LL6f 2YRAA 2VUMI 4A3KI 2PK7A 4RV9A 1PPQA 1ZH1A 4NB9A 2YU9I 1TWFI 3F3PC 2Q4ZA 3I561 3L89M 5FLMI 3CCJZ 4DQYB 3S15I 3CCJ1 5D1OB 4A3FI 4NBDA 1TFIA 1WCMI 1TWAI 4E33A 3OEDC 2DE6A 4NBHA 2RL0A 1ZJKA 1ML8A 2OTL1 2Q51A 1VQPZ 3GTPI 3OP8A 4Y7NI 3OW2Z 1H2PP 3GTGI 3JAMf 1S72Z 1S721 2JA7I 1G4GA 1GHQB 2XRBA 1SS2A 1GPZA 2HF1A 1OJVA 4NBCA 2QY0A 3D6WA 1RO4A 3P5JB 3S1NI 2RLQA 1YUAA 1KC81 1K732 2XRDA 2EC3A 3CC2Z 1QVFZ 3CC21 2MCZA 2RKZA 4WJG2 3S2HI 4LOTA 4JHSA 3RZDI 2JA8I 1W2BY 1K9M1 1JJ2Y 3HOUI 3T4NB 2O53A 1USPB 3FQMA 2WB1A 2E2HI 1RNIA 3CALA 2DE5A 5IP7I 4A3MI 3J81f 1KRLA 5AN9F 1VQKZ 2K3RA 3D9XA 2V8EA 4LOSA 3HOVI 3I4NI 1LY2A 1Z01A 2K5RA 3S14I 4DK1A 3HOWI 4C16A 3S16I 1VLAA 2I3CA 1E5GA 1G4FA 3F3FC 1YI2Z 3KIHA 1YI21 2QREB 1YITZ 3J81b 3I07A 4BBRI 2XWJI 1YIT1 3G71Z 1NP6A 1HCCA 2QRCB 2ZAEB 3G711 3TDHB 2HU9A 4IGDA 4ONTD 4RS4A 1I50I 1YHQ1 3BG0B 4NFRA 2GTHA 1Q7Y1 4BY7I 1I3QI 3RJ3D 1KC82 4RVGA 3EEDA 3CXCY 3PO2I 4FXGG 4A5WB 3CCMZ 2P3YA 4KKDA 3CCM1 1GKNA 1Q821 3CCS1 1Q811 1K9M2 5C4XI 2CKUA 3S2DI 1QVGZ 3CMEZ 1Q861 1YUKA 3CME1 2VF1A 3G6E1 1NUIA 5CM2M 4E32A 1VQ9Z 4B2RA 1TPGA 2IZ3A 1VQ91 1H04P 2XQWC 2QR1B 2JA6I 2CG7A 2V8JA 2NVXI 2W04A 1VQMZ 3EERA 1M901 1VQM1 3NH8A 4A3CI 3HKZA 3KIFA 3GTMI 3KZJA 4MD7A 1X0TA 1RO2A 2RIQA 3M4OI 3M3YI 1OK2A 4A3BI 2M6NA 4MXUA 2EHFA 3MZLB 3I56Z 1HFHA 2KPIA 3J7A4 3K7AI 1QUBA 5T67A 1VQ4Z 3GTLI 1VQ41 4E2ZA 1Q7Y2 1QGBA 4NH1C 3ZRZA 1PFTA 1N2FA 2JS4A 1VQ51 2OTLZ 3CCVZ 1M1K1 3CCV1 2DE7A 1YJ9Z 1YJ91 1DL6A 3NDJA 3BG1B 3CMAZ 1Q822 1KQSZ 2OTJZ 3J80f 3CMA1 2OTJ1 1Q812 4E31A 4AYDA 3OW2Y 1Q862 3EJHA 2QEX1 2E2JI 5IP9I 2JR6A 2JMOA 3S1MI 1RQFA 4A3DI 2GTIA 4A3JI 3HOZI 2RPRA 3ZD1A 1Y1VS 2QLVB 1U5MA 3Q87A 4HH4A 2CG6A 1K731 3NDIA 1QO6A 2YBYA 1C1ZA 5T64A 1M902 3PO3I 4BXXI 2M48A 2RBLA 1L1OC 3U50C 3CPWZ 4NB8A 5IT9f 4MONA 4NOZA 2PMZA 3JAMb 1N8R1 1QVFY 3MQLA 2O4HA 3GOVA 4AYMA 4NBEA 1X3ZA 4HGZA 5JPMG 5T6BA 2JRAA 2W81A 1ZB9A 1SFOI 4E2YA 3GTJI 3INBC 1YJWZ 2IZ4A 1H03P 1YJW1 2JUBA 5C4JI 1ZB8A 2GU2A 2R93I 1M1K2 4CL1A 3HOYI 2YADA 2KI7B 2R92I 5FLXf 3CCL1 3H0GI 3S1RI 3GKQA 3CC4Z 1S7MA 2G7IA 3CC41 2QA4Z 1Y1WI 2WIIC 2QA41 3HOXI 4MRIA 1Q3XA 2LOJA 3VTNA 2A55A 1YHQZ 1K8A1 3NH4A 3S1QI 1YJNZ 2KMSA 1YJN1 4EWCA 2O39C 1RLYA 3GTOI 2F4OA 1MD8A 4A3LI 4X6AI 2R7ZI 4MUCA 4E2XA 3CCSZ 5A2Qf 4TNUA 1VQO1 3MZKB 1JWHC 4DJZA 1KD11 4A3GI 1N8R2 2G2KA 4CSYA 4S1TA 3G6EZ 3CCE1 1OK3A 2B5ID 4E30A 4MD8A 1QVGY 2V8IA 4F4OC 1QF8A 4ZH1D 2UWNA 5HZPB 4NBFA 2RHBA 2NVQI 4MH4A 3ERBA 4QTTA 1VVCA 2J6AA 3M7PA 2KRIA 5C3EI 4NBAA 2XWBF 3KXVA 4AYEA 2AKLA 3NH5A 1X3WA 1Z92B 4AYIA 1K8A2 1GKGA 2BJOA 1VQ5Z 2W80A 1Z02A 3LUSA 2B63I 3NFPI 5HYPA 1FBRA 4NBGA 1OK9A 3IF8A 3O8EB 1E8BA 2ERJA 1TPNA 1OJWA 3CD6Z 1VVDA 3SW0X 1KD12 3CD61 4K12A 2OOYB 5C44I 1NJI1 2QEXZ 4Y52I 4XX2A 1KQSY 3IU3I 2RLPA 2OOXB 1TWHI 3TE5B 3VB9A 2P28A 4A3EI 2JNYA 4RVHA 3G4SZ 2H85A 3CCQZ 1Z03A 4BY1I 3G4S1 3CCQ1 5D1OA 2QKDA 3GTKI 2NVYI 2V8KA 1VQP1 1ELVA 1OK1A 4YNXA 1WIIA 2W03A 3ESWA 1VQ7Z 1VQ71 3J80b 4NBBA 1TPMA 4B2SA 2MCYA 1K83I 2JGWA 3GTQI 3CPWY 5FO8C 1W2BZ 1JJ2Z 2E2II 3GCFA 4BBSI 5HYTB 4A3II 1P9NA 3QWUA 2F4MA 1CKLA 1VQNZ 1I6HI 3VMGA 3CCLZ 1VQN1 2BZMA 5IT9b 4A93I 5D1PA 4PZ5A 2JGXA 3GTMS 4RVFA 5I0QB 2LIYA 1VQK1 1R9TI 1USPA 3FKII 1YIJZ 1YIJ1 1NJI2 3T5OA 1SRZA 3OXUD 3CQZI 1MD7A 3ZD2A 3GXEA 3IX0A 2PM9A 2LFUA 1OJYA 1NWVA 1LQLA 4J38B 2VUGA 1VQOZ 3VMHA 5FLXb 2OZKA 1O9AA 2EGTA 2Y0SA 3IFUA 1VQ8Z 3MONA 4QTUA 3CXCZ 1Y1VI 3CCEZ 1VQ81 3I4MI 1HFIA 1QYPA 2R6MA 1RO0A 1VQ6Z 3CCRZ 1VQ61 3CCR1 1E88A 2RKYA 3I55Z 1TWCI 3RZOI 2RT9A 3I551 2WAQA 4HGYA 3TVJA 1H2QP 5HYUB 5A2Qb 4AYBA 3PO3S 4MD9A 3VMIA 3CCUZ 3CCU1 2E9HA 2QRDB 4E2WA 3S17I 2JA5I 3CC7Z 2NVTI 3CC71 1VQLZ 4DGLA 1UOTP 1WW9A 1VQL1 3R62A 4RVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZ4 A;  1H03 P;  3RJ3 D;  1ELV A;  4FXG G;  4A5W B;  2YRA A;  4KKD A;  1GKN A;  1OK1 A;  1PPQ A;  4YNX A;  2CKU A;  1TPM A;  2G7I A;  4B2S A;  3L89 M;  2MCY A;  4B2R A;  1TPG A;  2WII C;  2IZ3 A;  2JGW A;  1H04 P;  1Q3X A;  2LOJ A;  2XQW C;  2A55 A;  5FO8 C;  2KMS A;  3OED C;  2CG7 A;  2O39 C;  1ZJK A;  2RL0 A;  1MD8 A;  5HYT B;  3OP8 A;  1CKL A;  1H2P P;  3KZJ A;  4MUC A;  2BZM A;  4DJZ A;  1G4G A;  1GHQ B;  2XRB A;  1OK2 A;  1SS2 A;  4PZ5 A;  2JGX A;  5I0Q B;  1GPZ A;  2EHF A;  4CSY A;  1OJV A;  1HFH A;  2QY0 A;  1OK3 A;  1QUB A;  2B5I D;  2RLQ A;  3T5O A;  1SRZ A;  3OXU D;  1MD7 A;  1QGB A;  3ZD2 A;  4F4O C;  3ZRZ A;  2XRD A;  2EC3 A;  4ZH1 D;  2UWN A;  3GXE A;  3IX0 A;  5HZP B;  2MCZ A;  2RKZ A;  1OJY A;  1NWV A;  4WJG 2;  4LOT A;  4J38 B;  4JHS A;  3ERB A;  3CAL A;  1VVC A;  3M7P A;  2KRI A;  1O9A A;  2XWB F;  4AYD A;  3KXV A;  3EJH A;  4AYE A;  2V8E A;  4LOS A;  1Z92 B;  1HFI A;  4AYI A;  1LY2 A;  3ZD1 A;  1GKG A;  1U5M A;  2W80 A;  2CG6 A;  4C16 A;  1E88 A;  1QO6 A;  2YBY A;  3NFP I;  1C1Z A;  2RKY A;  5HYP A;  1FBR A;  3TVJ A;  1E5G A;  1OK9 A;  1H2Q P;  3O8E B;  1E8B A;  1G4F A;  2ERJ A;  5HYU B;  1TPN A;  1OJW A;  3MQL A;  1VVD A;  3SW0 X;  2XWJ I;  3GOV A;  4K12 A;  1HCC A;  4AYM A;  4IGD A;  5JPM G;  3IU3 I;  2RLP A;  4ONT D;  2JRA A;  2W81 A;  1UOT P;  3R62 A;  3INB C; 
#chains in the Genus database with same CATH topology
 3FQQ A;  1TWG I;  3NFZ A;  3H3V J;  5LL6 f;  2YRA A;  2VUM I;  3K3T A;  4A3K I;  2PK7 A;  4RV9 A;  1PPQ A;  1ZH1 A;  4NB9 A;  2YU9 I;  1TWF I;  2AYD A;  3F3P C;  2Q4Z A;  3I56 1;  3L89 M;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1TFI A;  1WCM I;  2VPW A;  1TWA I;  4E33 A;  3OED C;  2DE6 A;  4NBH A;  2RL0 A;  1ZJK A;  1ML8 A;  2OTL 1;  4BWC A;  2Q51 A;  1VQP Z;  3GTP I;  3OP8 A;  4Y7N I;  3OW2 Z;  1H2P P;  3GTG I;  3JAM f;  1S72 Z;  1S72 1;  2JA7 I;  1G4G A;  1GHQ B;  2XRB A;  1SS2 A;  1GPZ A;  2HF1 A;  1OJV A;  4NBC A;  2QY0 A;  3D6W A;  1RO4 A;  3P5J B;  3S1N I;  2RLQ A;  1YUA A;  1KC8 1;  1K73 2;  2XRD A;  2EC3 A;  3CC2 Z;  1QVF Z;  3CC2 1;  2MCZ A;  2RKZ A;  4WJG 2;  3S2H I;  4LOT A;  4JHS A;  3RZD I;  2JA8 I;  4APL A;  1W2B Y;  1K9M 1;  1JJ2 Y;  3HOU I;  3T4N B;  2O53 A;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  1RNI A;  3CAL A;  2DE5 A;  1FDI A;  5IP7 I;  4A3M I;  3J81 f;  1KRL A;  5AN9 F;  1VQK Z;  2K3R A;  3D9X A;  2V8E A;  4LOS A;  3HOV I;  3I4N I;  1LY2 A;  1Z01 A;  2K5R A;  3S14 I;  4DK1 A;  3HOW I;  4C16 A;  3S16 I;  1VLA A;  2I3C A;  1E5G A;  1G4F A;  3F3F C;  1YI2 Z;  3KIH A;  1YI2 1;  2JIP A;  2QRE B;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  2XWJ I;  1YIT 1;  3G71 Z;  1NP6 A;  1HCC A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  4IGD A;  4ONT D;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  3WSY A;  3RJ3 D;  1WJ2 A;  1KC8 2;  4N7E A;  4RVG A;  3EED A;  3CXC Y;  3PO2 I;  4FXG G;  4A5W B;  3CCM Z;  2P3Y A;  1FDO A;  4KKD A;  3CCM 1;  1GKN A;  1Q82 1;  3CCS 1;  1Q81 1;  1K9M 2;  5C4X I;  2CKU A;  3S2D I;  3VWO A;  1QVG Z;  3CME Z;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  2X2Z A;  3G6E 1;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  4B2R A;  1TPG A;  2IZ3 A;  1VQ9 1;  1H04 P;  2XQW C;  1AA6 A;  2QR1 B;  2JA6 I;  2CG7 A;  2V8J A;  2NVX I;  2W04 A;  1QXF A;  1VQM Z;  3EER A;  1M90 1;  1VQM 1;  3NH8 A;  4A3C I;  3HKZ A;  3KIF A;  2E7Z A;  3GTM I;  3KZJ A;  2JIR A;  4MD7 A;  1X0T A;  1RO2 A;  1WZN A;  2RIQ A;  3M4O I;  3M3Y I;  2VPX A;  1OK2 A;  4A3B I;  2M6N A;  4MXU A;  2EHF A;  3MZL B;  3I56 Z;  1HFH A;  2KPI A;  3J7A 4;  3K7A I;  1QUB A;  5T67 A;  1VQ4 Z;  3GTL I;  1VQ4 1;  4E2Z A;  1Q7Y 2;  1QGB A;  4NH1 C;  3ZRZ A;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  3CCV Z;  1M1K 1;  3CCV 1;  2DE7 A;  1YJ9 Z;  2LEX A;  1YJ9 1;  1DL6 A;  3ZLD A;  3NDJ A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  4E31 A;  4AYD A;  3OW2 Y;  1Q86 2;  3EJH A;  2QEX 1;  2E2J I;  5IP9 I;  2JR6 A;  2JMO A;  3D2L A;  3S1M I;  1RQF A;  4A3D I;  2GTI A;  1Y8C A;  4A3J I;  2RPR A;  3HOZ I;  3ZD1 A;  1Y1V S;  4YIZ A;  2QLV B;  1U5M A;  3Q87 A;  4HH4 A;  2CG6 A;  2JIO A;  1K73 1;  3NDI A;  1SIW A;  1QO6 A;  2YBY A;  1C1Z A;  5T64 A;  1M90 2;  3PO3 I;  4BXX I;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1N8R 1;  1QVF Y;  4PO7 A;  3MQL A;  2O4H A;  3GOV A;  2VPZ A;  4AYM A;  4NBE A;  1X3Z A;  4HGZ A;  5JPM G;  5T6B A;  2JRA A;  2W81 A;  1ZB9 A;  1SFO I;  4E2Y A;  3GTJ I;  3INB C;  1YJW Z;  2I2L A;  2IZ4 A;  1H03 P;  1YJW 1;  2JUB A;  5C4J I;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2KI7 B;  5DN5 A;  2R92 I;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  3CC4 Z;  1S7M A;  2G7I A;  3CC4 1;  2QA4 Z;  1Y1W I;  2WII C;  2QA4 1;  3HOX I;  4MRI A;  1Q3X A;  2LOJ A;  3VTN A;  2A55 A;  1YHQ Z;  1K8A 1;  3NH4 A;  3S1Q I;  1YJN Z;  2KMS A;  1YJN 1;  4EWC A;  2IV2 X;  2O39 C;  1RLY A;  3GTO I;  2F4O A;  1MD8 A;  4A3L I;  4X6A I;  2R7Z I;  4MUC A;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  3MZK B;  1JWH C;  4DJZ A;  1KD1 1;  4A3G I;  1N8R 2;  2V45 A;  1RLH A;  2G2K A;  4CSY A;  4S1T A;  3G6E Z;  3CCE 1;  1OK3 A;  2B5I D;  4E30 A;  4MD8 A;  3FGT A;  1QVG Y;  2V8I A;  4F4O C;  1QF8 A;  3ZLE A;  4ZH1 D;  2UWN A;  5HZP B;  4NBF A;  2RHB A;  2NVQ I;  2NAP A;  4MH4 A;  3ERB A;  4QTT A;  1VVC A;  2J6A A;  3M7P A;  2KRI A;  5C3E I;  4NBA A;  2XWB F;  3KXV A;  4AYE A;  2AKL A;  3NH5 A;  1X3W A;  1Z92 B;  4AYI A;  1K8A 2;  1GKG A;  2BJO A;  1VQ5 Z;  2W80 A;  1Z02 A;  3LUS A;  2B63 I;  3NFP I;  5HYP A;  1FBR A;  4NBG A;  1OK9 A;  3IF8 A;  3O8E B;  1E8B A;  2ERJ A;  1TPN A;  1OJW A;  2JIM A;  3CD6 Z;  1VVD A;  2Y8T A;  3SW0 X;  1KD1 2;  3CD6 1;  4K12 A;  2OOY B;  3CI0 J;  5C44 I;  1NJI 1;  2QEX Z;  4Y52 I;  2VPY A;  4XX2 A;  1KQS Y;  3IU3 I;  2RLP A;  2OOX B;  1TWH I;  2Y8S A;  3TE5 B;  2P28 A;  3VB9 A;  2JNY A;  4RVH A;  4A3E I;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  2V8K A;  1VQP 1;  1ELV A;  3IR7 A;  1OK1 A;  4YNX A;  1WII A;  2W03 A;  3ESW A;  3NJA A;  1VQ7 Z;  2Y8R A;  1VQ7 1;  3J80 b;  4NBB A;  1TPM A;  4B2S A;  1Q16 A;  2MCY A;  1K83 I;  2JGW A;  3GTQ I;  3CPW Y;  5FO8 C;  1W2B Z;  1JJ2 Z;  2E2I I;  3GCF A;  4BBS I;  5HYT B;  4A3I I;  1P9N A;  3QWU A;  2F4M A;  1CKL A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  2BZM A;  5IT9 b;  4A93 I;  5D1P A;  4PZ5 A;  2JGX A;  3GTM S;  4RVF A;  5I0Q B;  2LIY A;  1VQK 1;  2JIQ A;  1R9T I;  1USP A;  3FKI I;  1YIJ Z;  1YIJ 1;  1NJI 2;  3WSX A;  3F6K A;  3T5O A;  1SRZ A;  3OXU D;  3CQZ I;  1MD7 A;  3ZD2 A;  3GXE A;  3IX0 A;  2PM9 A;  2LFU A;  1OJY A;  1NWV A;  1LQL A;  4J38 B;  4MSL A;  2VUG A;  1VQO Z;  3VMH A;  5FLX b;  2OZK A;  2V3V A;  1O9A A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1Y1V I;  3CCE Z;  1VQ8 1;  2ZYC A;  3I4M I;  1HFI A;  1QYP A;  2R6M A;  1RO0 A;  1VQ6 Z;  3CCR Z;  1VQ6 1;  3CCR 1;  1E88 A;  2RKY A;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  2WAQ A;  4HGY A;  3TVJ A;  1H2Q P;  5HYU B;  5A2Q b;  3FGR A;  4AYB A;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  5DN4 A;  3CCU 1;  2E9H A;  2QRD B;  4E2W A;  3S17 I;  2JA5 I;  3CC7 Z;  2NVT I;  3CC7 1;  1VQL Z;  4DGL A;  1UOT P;  1WW9 A;  1VQL 1;  3R62 A;  4RVD A; 
#chains in the Genus database with same CATH homology
 3FQQ A;  1TWG I;  3NFZ A;  3H3V J;  5LL6 f;  2YRA A;  2VUM I;  4A3K I;  2PK7 A;  4RV9 A;  1PPQ A;  1ZH1 A;  4NB9 A;  2YU9 I;  1TWF I;  3F3P C;  2Q4Z A;  3I56 1;  3L89 M;  5FLM I;  3CCJ Z;  4DQY B;  3S15 I;  3CCJ 1;  5D1O B;  4A3F I;  4NBD A;  1TFI A;  1WCM I;  1TWA I;  4E33 A;  3OED C;  2DE6 A;  4NBH A;  2RL0 A;  1ZJK A;  1ML8 A;  2OTL 1;  2Q51 A;  1VQP Z;  3GTP I;  3OP8 A;  4Y7N I;  3OW2 Z;  1H2P P;  3GTG I;  3JAM f;  1S72 Z;  1S72 1;  2JA7 I;  1G4G A;  1GHQ B;  2XRB A;  1SS2 A;  1GPZ A;  2HF1 A;  1OJV A;  4NBC A;  2QY0 A;  3D6W A;  1RO4 A;  3P5J B;  3S1N I;  2RLQ A;  1YUA A;  1KC8 1;  1K73 2;  2XRD A;  2EC3 A;  3CC2 Z;  1QVF Z;  3CC2 1;  2MCZ A;  2RKZ A;  4WJG 2;  3S2H I;  4LOT A;  4JHS A;  3RZD I;  2JA8 I;  1W2B Y;  1K9M 1;  1JJ2 Y;  3HOU I;  3T4N B;  2O53 A;  1USP B;  3FQM A;  2WB1 A;  2E2H I;  1RNI A;  3CAL A;  2DE5 A;  5IP7 I;  4A3M I;  3J81 f;  1KRL A;  5AN9 F;  1VQK Z;  2K3R A;  3D9X A;  2V8E A;  4LOS A;  3HOV I;  3I4N I;  1LY2 A;  1Z01 A;  2K5R A;  3S14 I;  4DK1 A;  3HOW I;  4C16 A;  3S16 I;  1VLA A;  2I3C A;  1E5G A;  1G4F A;  3F3F C;  1YI2 Z;  3KIH A;  1YI2 1;  2QRE B;  1YIT Z;  3J81 b;  3I07 A;  4BBR I;  2XWJ I;  1YIT 1;  3G71 Z;  1NP6 A;  1HCC A;  2QRC B;  2ZAE B;  3G71 1;  3TDH B;  2HU9 A;  4IGD A;  4ONT D;  4RS4 A;  1I50 I;  1YHQ 1;  3BG0 B;  4NFR A;  2GTH A;  1Q7Y 1;  4BY7 I;  1I3Q I;  3RJ3 D;  1KC8 2;  4RVG A;  3EED A;  3CXC Y;  3PO2 I;  4FXG G;  4A5W B;  3CCM Z;  2P3Y A;  4KKD A;  3CCM 1;  1GKN A;  1Q82 1;  3CCS 1;  1Q81 1;  1K9M 2;  5C4X I;  2CKU A;  3S2D I;  1QVG Z;  3CME Z;  1Q86 1;  1YUK A;  3CME 1;  2VF1 A;  3G6E 1;  1NUI A;  5CM2 M;  4E32 A;  1VQ9 Z;  4B2R A;  1TPG A;  2IZ3 A;  1VQ9 1;  1H04 P;  2XQW C;  2QR1 B;  2JA6 I;  2CG7 A;  2V8J A;  2NVX I;  2W04 A;  1VQM Z;  3EER A;  1M90 1;  1VQM 1;  3NH8 A;  4A3C I;  3HKZ A;  3KIF A;  3GTM I;  3KZJ A;  4MD7 A;  1X0T A;  1RO2 A;  2RIQ A;  3M4O I;  3M3Y I;  1OK2 A;  4A3B I;  2M6N A;  4MXU A;  2EHF A;  3MZL B;  3I56 Z;  1HFH A;  2KPI A;  3J7A 4;  3K7A I;  1QUB A;  5T67 A;  1VQ4 Z;  3GTL I;  1VQ4 1;  4E2Z A;  1Q7Y 2;  1QGB A;  4NH1 C;  3ZRZ A;  1PFT A;  1N2F A;  2JS4 A;  1VQ5 1;  2OTL Z;  3CCV Z;  1M1K 1;  3CCV 1;  2DE7 A;  1YJ9 Z;  1YJ9 1;  1DL6 A;  3NDJ A;  3BG1 B;  3CMA Z;  1Q82 2;  1KQS Z;  2OTJ Z;  3J80 f;  3CMA 1;  2OTJ 1;  1Q81 2;  4E31 A;  4AYD A;  3OW2 Y;  1Q86 2;  3EJH A;  2QEX 1;  2E2J I;  5IP9 I;  2JR6 A;  2JMO A;  3S1M I;  1RQF A;  4A3D I;  2GTI A;  4A3J I;  3HOZ I;  2RPR A;  3ZD1 A;  1Y1V S;  2QLV B;  1U5M A;  3Q87 A;  4HH4 A;  2CG6 A;  1K73 1;  3NDI A;  1QO6 A;  2YBY A;  1C1Z A;  5T64 A;  1M90 2;  3PO3 I;  4BXX I;  2M48 A;  2RBL A;  1L1O C;  3U50 C;  3CPW Z;  4NB8 A;  5IT9 f;  4MON A;  4NOZ A;  2PMZ A;  3JAM b;  1N8R 1;  1QVF Y;  3MQL A;  2O4H A;  3GOV A;  4AYM A;  4NBE A;  1X3Z A;  4HGZ A;  5JPM G;  5T6B A;  2JRA A;  2W81 A;  1ZB9 A;  1SFO I;  4E2Y A;  3GTJ I;  3INB C;  1YJW Z;  2IZ4 A;  1H03 P;  1YJW 1;  2JUB A;  5C4J I;  1ZB8 A;  2GU2 A;  2R93 I;  1M1K 2;  4CL1 A;  3HOY I;  2YAD A;  2KI7 B;  2R92 I;  5FLX f;  3CCL 1;  3H0G I;  3S1R I;  3GKQ A;  3CC4 Z;  1S7M A;  2G7I A;  3CC4 1;  2QA4 Z;  1Y1W I;  2WII C;  2QA4 1;  3HOX I;  4MRI A;  1Q3X A;  2LOJ A;  3VTN A;  2A55 A;  1YHQ Z;  1K8A 1;  3NH4 A;  3S1Q I;  1YJN Z;  2KMS A;  1YJN 1;  4EWC A;  2O39 C;  1RLY A;  3GTO I;  2F4O A;  1MD8 A;  4A3L I;  4X6A I;  2R7Z I;  4MUC A;  4E2X A;  3CCS Z;  5A2Q f;  4TNU A;  1VQO 1;  3MZK B;  1JWH C;  4DJZ A;  1KD1 1;  4A3G I;  1N8R 2;  2G2K A;  4CSY A;  4S1T A;  3G6E Z;  3CCE 1;  1OK3 A;  2B5I D;  4E30 A;  4MD8 A;  1QVG Y;  2V8I A;  4F4O C;  1QF8 A;  4ZH1 D;  2UWN A;  5HZP B;  4NBF A;  2RHB A;  2NVQ I;  4MH4 A;  3ERB A;  4QTT A;  1VVC A;  2J6A A;  3M7P A;  2KRI A;  5C3E I;  4NBA A;  2XWB F;  3KXV A;  4AYE A;  2AKL A;  3NH5 A;  1X3W A;  1Z92 B;  4AYI A;  1K8A 2;  1GKG A;  2BJO A;  1VQ5 Z;  2W80 A;  1Z02 A;  3LUS A;  2B63 I;  3NFP I;  5HYP A;  1FBR A;  4NBG A;  1OK9 A;  3IF8 A;  3O8E B;  1E8B A;  2ERJ A;  1TPN A;  1OJW A;  3CD6 Z;  1VVD A;  3SW0 X;  1KD1 2;  3CD6 1;  4K12 A;  2OOY B;  5C44 I;  1NJI 1;  2QEX Z;  4Y52 I;  4XX2 A;  1KQS Y;  3IU3 I;  2RLP A;  2OOX B;  1TWH I;  3TE5 B;  3VB9 A;  2P28 A;  4A3E I;  2JNY A;  4RVH A;  3G4S Z;  2H85 A;  3CCQ Z;  1Z03 A;  4BY1 I;  3G4S 1;  3CCQ 1;  5D1O A;  2QKD A;  3GTK I;  2NVY I;  2V8K A;  1VQP 1;  1ELV A;  1OK1 A;  4YNX A;  1WII A;  2W03 A;  3ESW A;  1VQ7 Z;  1VQ7 1;  3J80 b;  4NBB A;  1TPM A;  4B2S A;  2MCY A;  1K83 I;  2JGW A;  3GTQ I;  3CPW Y;  5FO8 C;  1W2B Z;  1JJ2 Z;  2E2I I;  3GCF A;  4BBS I;  5HYT B;  4A3I I;  1P9N A;  3QWU A;  2F4M A;  1CKL A;  1VQN Z;  1I6H I;  3VMG A;  3CCL Z;  1VQN 1;  2BZM A;  5IT9 b;  4A93 I;  5D1P A;  4PZ5 A;  2JGX A;  3GTM S;  4RVF A;  5I0Q B;  2LIY A;  1VQK 1;  1R9T I;  1USP A;  3FKI I;  1YIJ Z;  1YIJ 1;  1NJI 2;  3T5O A;  1SRZ A;  3OXU D;  3CQZ I;  1MD7 A;  3ZD2 A;  3GXE A;  3IX0 A;  2PM9 A;  2LFU A;  1OJY A;  1NWV A;  1LQL A;  4J38 B;  2VUG A;  1VQO Z;  3VMH A;  5FLX b;  2OZK A;  1O9A A;  2EGT A;  2Y0S A;  3IFU A;  1VQ8 Z;  3MON A;  4QTU A;  3CXC Z;  1Y1V I;  3CCE Z;  1VQ8 1;  3I4M I;  1HFI A;  1QYP A;  2R6M A;  1RO0 A;  1VQ6 Z;  3CCR Z;  1VQ6 1;  3CCR 1;  1E88 A;  2RKY A;  3I55 Z;  1TWC I;  3RZO I;  2RT9 A;  3I55 1;  2WAQ A;  4HGY A;  3TVJ A;  1H2Q P;  5HYU B;  5A2Q b;  4AYB A;  3PO3 S;  4MD9 A;  3VMI A;  3CCU Z;  3CCU 1;  2E9H A;  2QRD B;  4E2W A;  3S17 I;  2JA5 I;  3CC7 Z;  2NVT I;  3CC7 1;  1VQL Z;  4DGL A;  1UOT P;  1WW9 A;  1VQL 1;  3R62 A;  4RVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...