3IX0A

Crystal structure of human seminal plasma protein psp94
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
94
structure length
87
Chain Sequence
b'SCYFIPNEGKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-microseminoprotein
publication title Crystal structure of prostate secretory protein PSP94 shows an edge-to-edge association of two monomers to form a homodimer
pubmed doi rcsb
molecule tags Antitumor protein, apoptosis
total genus 13
structure length 87
sequence length 94
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ix0A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3ix0A02
5HYTB 4K12A 5HYPA 4IGDA 4PZ5A 3R62A 2BZMA 3GOVA 2G7IA 2UWNA 1C1ZA 1H2PP 3ZD1A 4B2RA 1OK9A 2RKZA 2RLPA 2WIIC 1QUBA 2KMSA 1E8BA 3NFPI 4B2SA 1GHQB 1OJWA 1PPQA 1OJVA 2XQWC 4FXGG 3RJ3D 4F4OC 1VVDA 1HFIA 4A5WB 5HYUB 2KRIA 2JGXA 1OJYA 1UOTP 2EC3A 4JHSA 3ZD2A 2RKYA 1QO6A 2MCYA 3MQLA 2XWBF 1GKGA 4CSYA 1OK2A 3EJHA 4ZH1D 4AYMA 3OXUD 4KKDA 2YRAA 4LOSA 2XWJI 3GXEA 3OP8A 2IZ3A 2B5ID 1H2QP 1O9AA 3TVJA 4J38B 1VVCA 1QGBA 2W81A 3ERBA 3IX0A 4WJG2 2ERJA 1Q3XA 3KXVA 4MUCA 3ZRZA 1TPNA 2CG6A 3O8EB 2JRAA 5HZPB 1OK3A 2CKUA 5FO8C 2EHFA 4AYIA 2LOJA 1E88A 5I0QB 2CG7A 4AYDA 1H04P 1E5GA 4DJZA 1LY2A 3SW0X 3L89M 2A55A 2RL0A 2V8EA 1ZJKA 1G4FA 1ELVA 1U5MA 2IZ4A 1GKNA 3IU3I 2RLQA 1NWVA 2YBYA 3CALA 1FBRA 1H03P 4YNXA 1MD7A 2W80A 3M7PA 1TPGA 5JPMG 1SRZA 2MCZA 2XRBA 1GPZA 1HCCA 3KZJA 3OEDC 2O39C 2QY0A 2JGWA 4LOTA 1OK1A 1TPMA 3INBC 1SS2A 3T5OA 1G4GA 4ONTD 2XRDA 4C16A 1HFHA 1CKLA 1Z92B 1MD8A 4AYEA
chains in the Genus database with same CATH superfamily
1K732 1ZB9A 3BG0B 1FDOA 5HYPA 2OTJZ 2BZMA 3K3TA 3HOZI 4B2RA 2B63I 4E2WA 3GTGI 2RLPA 2WIIC 3CCQ1 1E8BA 3NFPI 3CCL1 1GHQB 3CI0J 1TWAI 3RJ3D 1RLHA 2W03A 3NJAA 3CXCY 5D1PA 4A3EI 4A5WB 5HYUB 3I551 3IFUA 2KRIA 1YIJZ 4JHSA 4NH1C 2JA6I 1KC81 3VB9A 2RKYA 2OTL1 1QO6A 4NBAA 3MZLB 2MCYA 1M901 3J81f 2GTIA 2NAPA 3G4S1 3GCFA 1VQ91 4XX2A 2HU9A 2X2ZA 4AYMA 3KIFA 3GTMI 2NVXI 3J80b 3CCJ1 1KQSZ 3ESWA 3CCQZ 2EGTA 3TVJA 2GU2A 3RZDI 4J38B 3CCLZ 3FQQA 1VQL1 2NVQI 2VPZA 2JR6A 2ERJA 3KXVA 3EEDA 3ZRZA 5LL6f 2E2JI 3MZKB 3I55Z 3GTOI 3P5JB 1OK3A 2CKUA 5FO8C 1TFIA 2OTLZ 2F4OA 1K9M1 3F3FC 2CG7A 3OW2Y 1VQ9Z 2A55A 1N8R1 3U50C 2RL0A 3CME1 1G4FA 4NBHA 1QF8A 3CCJZ 2IZ4A 4NBDA 2R7ZI 3IU3I 2ZYCA 2YBYA 3GTPI 2V3VA 2QEX1 4NB9A 2JIRA 3T4NB 1VQLZ 3M7PA 3IF8A 3D2LA 1K83I 2XRBA 3GKQA 1GPZA 2E7ZA 5IT9f 1HCCA 2DE7A 1RO2A 3KZJA 2NVYI 5T6BA 3TE5B 1WW9A 2JIMA 1OK1A 1RLYA 1RNIA 3CCU1 1KC82 5IP7I 3VMIA 1KD12 3H3VJ 2AKLA 2QRDB 3CMEZ 3T5OA 3H0GI 4DGLA 4MH4A 2XRDA 2JIPA 1YUKA 1ZB8A 5DN4A 3FQMA 4C16A 5CM2M 5IP9I 5A2Qf 2PMZA 3G6E1 1TWFI 4PZ5A 3R62A 2VPXA 3J81b 3GOVA 3IR7A 2QEXZ 1WIIA 4BY1I 1C1ZA 1KQSY 3NH8A 1OK9A 3F6KA 5FLXf 2NVTI 2OZKA 3CCE1 1VVDA 4RVGA 3GTLI 2VPYA 3PO3I 1HFIA 3CCUZ 4A3JI 3MONA 3G711 4NFRA 2JGXA 3S2DI 2JA8I 4RVFA 3VMGA 2QA41 3S1NI 2R93I 2I2LA 3JAMf 1N8R2 2M6NA 2VUMI 1QYPA 2JIQA 1S721 1VQ81 3HOVI 3CCV1 2XWBF 3PO3S 4CSYA 3G6EZ 2JA7I 3NH4A 4A3DI 2DE6A 2JIOA 3FKII 2ZAEB 3I561 3KIHA 1X3ZA 2XWJI 4TNUA 3OP8A 3HKZA 4HGYA 1QVGZ 3F3PC 2YU9I 4BBSI 2JS4A 2QKDA 3NFZA 2Y8SA 1Z03A 4WJG2 1VQ61 4A3LI 4MUCA 4MSLA 1X0TA 4E33A 3G71Z 2CG6A 1Y1VI 2JMOA 2RHBA 5C44I 1KD11 4MRIA 2G2KA 4AYIA 1VQK1 2LOJA 4HGZA 4A3II 1VQ71 1S72Z 5IT9b 1VQ8Z 4AYDA 2R92I 1H04P 3CCVZ 3CMA1 1USPB 1LY2A 3SW0X 2RBLA 4A3BI 1Q811 2P3YA 1YIT1 4NBBA 3CQZI 3S1MI 1DL6A 1U5MA 3I56Z 2VUGA 4A3GI 1NWVA 3CCR1 1YHQ1 2E2HI 4DK1A 3GTMS 3HOWI 3CCS1 4QTUA 3VWOA 1L1OC 1VQ6Z 3I4MI 1W2BZ 2JA5I 2LFUA 2F4MA 4RVHA 1R9TI 2J6AA 1VQKZ 1VQ7Z 2JGWA 1ML8A 3QWUA 3G4SZ 4A93I 1M1K2 3D9XA 3CMAZ 5FLXb 3S15I 1Q862 5AN9F 2DE5A 4Y7NI 4NBGA 1YITZ 3INBC 1VQO1 1SIWA 4ONTD 1K8A2 1HFHA 1KRLA 4K12A 2WAQA 3CCRZ 1YHQZ 3S16I 2Y0SA 2G7IA 3CCSZ 3ZD1A 1TWGI 2WB1A 3J7A4 1P9NA 5T67A 4E2ZA 1VQN1 2QREB 1RQFA 1QVGY 1QUBA 2R6MA 5C3EI 2V45A 1OJVA 4F4OC 3BG1B 4NBCA 4AYBA 2V8JA 1OJYA 1UOTP 2EC3A 1VQOZ 1SFOI 1VQ41 3ZD2A 2QRCB 1Q812 4X6AI 3CC21 1GKGA 1NUIA 1OK2A 3EJHA 4ZH1D 3NDJA 1Y8CA 1PFTA 2K5RA 4KKDA 1YJ91 4MXUA 1VQNZ 1WZNA 2O53A 2Q4ZA 2B5ID 2Q51A 1QGBA 3WSYA 1FDIA 4CL1A 1YJW1 1W2BY 3HOXI 1M1K1 4NOZA 2JRAA 2VPWA 1Q861 5HZPB 1VQ4Z 1VQP1 5D1OB 2EHFA 1LQLA 1N2FA 3CC41 1TWHI 3CC2Z 1E5GA 1K8A1 4DJZA 4BY7I 3NH5A 3Q87A 3L89M 1S7MA 4NBEA 3D6WA 1JJ2Z 1YJ9Z 1JWHC 2LIYA 3TDHB 3CD61 4YIZA 3CCEZ 3CALA 1USPA 1FBRA 1H03P 2W80A 1YJWZ 1VQM1 5JPMG 1I50I 4BXXI 3ZLEA 1SRZA 2MCZA 1I6HI 2QA4Z 3CPWZ 3ZLDA 3HOYI 1VQPZ 4Y52I 1Q822 3OEDC 2O39C 2V8IA 4RVDA 2QY0A 4LOTA 4MD7A 5T64A 4HH4A 3NDIA 3CC4Z 3M3YI 2E9HA 3VMHA 2Y8RA 1Y1VS 2I3CA 1SS2A 5C4JI 2BJOA 1G4GA 4E2YA 4DQYB 1VLAA 2IV2X 1GKNA 4AYEA 3CD6Z 2O4HA 1VQ51 2OOXB 1X3WA 5HYTB 5A2Qb 4IGDA 2JUBA 2K3RA 2UWNA 4MONA 1H2PP 2W04A 1VQMZ 3S2HI 3K7AI 4S1TA 2RKZA 5DN5A 1QVFZ 4NB8A 4E32A 3FGRA 2KMSA 1NJI1 4B2SA 3I07A 3CCM1 3PO2I 1OJWA 1PPQA 2XQWC 2H85A 4FXGG 2KPIA 3HOUI 2RPRA 2RT9A 1WJ2A 2E2II 4E31A 1Z01A 3S1QI 2VF1A 2Y8TA 4E2XA 4MD9A 1Q16A 2KI7B 3JAMb 3GTJI 4A3KI 1Q7Y2 4RS4A 3MQLA 1VQ5Z 4RV9A 2QR1B 3LUSA 3RZOI 4A3CI 2AYDA 3OXUD 1K731 1RO0A 2QLVB 4A3MI 1JJ2Y 4LOSA 2YRAA 3WSXA 4E30A 3GXEA 2IZ3A 1H2QP 1O9AA 1VVCA 3CCMZ 3GTKI 2W81A 1Q821 5C4XI 3ERBA 1QXFA 3IX0A 3S17I 3CXCZ 1Q3XA 1TPNA 5FLMI 3O8EB 2PK7A 4QTTA 3CPWY 1NP6A 1TWCI 3CC71 1E88A 5I0QB 3M4OI 1YI21 3EERA 3J80f 2RIQA 4A3FI 1Y1WI 3VTNA 2V8EA 1YJN1 1ZJKA 1ELVA 1M902 1RO4A 2JNYA 5D1OA 2LEXA 2RLQA 1WCMI 3S14I 2YADA 1ZH1A 2OTJ1 4YNXA 1Z02A 1MD7A 3GTQI 3S1RI 1AA6A 1TPGA 1NJI2 1QVFY 4EWCA 2OOYB 4MD8A 3CC7Z 4PO7A 3I4NI 1YI2Z 3OW2Z 1TPMA 3FGTA 4NBFA 2P28A 1Q7Y1 4BWCA 1YIJ1 1I3QI 1YJNZ 2V8KA 1K9M2 4APLA 2HF1A 2M48A 2GTHA 1YUAA 4BBRI 4N7EA 1CKLA 1Z92B 1MD8A 2PM9A
chains in the Genus database with same CATH topology
1K732 1ZB9A 3BG0B 5HYPA 2OTJZ 2BZMA 3HOZI 4B2RA 2B63I 4E2WA 3GTGI 2RLPA 2WIIC 3CCQ1 1E8BA 3NFPI 3CCL1 1GHQB 1TWAI 3RJ3D 2W03A 4A3EI 3CXCY 5D1PA 4A5WB 5HYUB 3I551 3IFUA 2KRIA 1YIJZ 4JHSA 4NH1C 2JA6I 1KC81 3VB9A 2RKYA 2OTL1 1QO6A 4NBAA 3MZLB 2MCYA 1M901 3J81f 2GTIA 3G4S1 3GCFA 1VQ91 4XX2A 2HU9A 4AYMA 3KIFA 3GTMI 2NVXI 3J80b 3CCJ1 1KQSZ 3ESWA 3CCQZ 2EGTA 3TVJA 2GU2A 3RZDI 4J38B 3CCLZ 3FQQA 1VQL1 2NVQI 2JR6A 2ERJA 3KXVA 3EEDA 3ZRZA 5LL6f 2E2JI 3MZKB 3I55Z 3GTOI 3P5JB 1OK3A 2CKUA 5FO8C 1TFIA 2OTLZ 2F4OA 1K9M1 3F3FC 2CG7A 3OW2Y 1VQ9Z 2A55A 1N8R1 3U50C 2RL0A 3CME1 1G4FA 4NBHA 1QF8A 3CCJZ 2IZ4A 4NBDA 2R7ZI 3IU3I 2YBYA 3GTPI 2QEX1 4NB9A 3T4NB 1VQLZ 3M7PA 3IF8A 1K83I 2XRBA 3GKQA 1GPZA 5IT9f 1HCCA 2DE7A 1RO2A 3KZJA 2NVYI 5T6BA 3TE5B 1WW9A 1OK1A 1RLYA 1RNIA 3CCU1 1KC82 5IP7I 3VMIA 1KD12 3H3VJ 2AKLA 2QRDB 3CMEZ 3T5OA 3H0GI 4DGLA 4MH4A 2XRDA 1YUKA 1ZB8A 3FQMA 4C16A 5CM2M 5IP9I 5A2Qf 2PMZA 3G6E1 1TWFI 4PZ5A 3R62A 2QEXZ 3J81b 3GOVA 4BY1I 1WIIA 1C1ZA 1KQSY 3NH8A 1OK9A 5FLXf 2NVTI 2OZKA 3CCE1 1VVDA 4RVGA 3GTLI 3PO3I 1HFIA 3CCUZ 4A3JI 3MONA 3G711 4NFRA 2JGXA 3S2DI 2JA8I 4RVFA 3VMGA 2QA41 3S1NI 2R93I 3JAMf 1N8R2 2M6NA 2VUMI 1QYPA 1S721 1VQ81 3HOVI 3CCV1 2XWBF 3PO3S 4CSYA 3G6EZ 2JA7I 3NH4A 4A3DI 2DE6A 3FKII 2ZAEB 3I561 3KIHA 1X3ZA 2XWJI 4TNUA 3OP8A 3HKZA 4HGYA 1QVGZ 3F3PC 2YU9I 4BBSI 2JS4A 2QKDA 3NFZA 1Z03A 4WJG2 1VQ61 4A3LI 4MUCA 1X0TA 4E33A 3G71Z 2CG6A 1Y1VI 2JMOA 2RHBA 5C44I 1KD11 4MRIA 2G2KA 4AYIA 1VQK1 2LOJA 4HGZA 4A3II 1VQ71 1S72Z 5IT9b 1VQ8Z 4AYDA 2R92I 1H04P 3CCVZ 3CMA1 1USPB 1LY2A 3SW0X 2RBLA 4A3BI 1Q811 2P3YA 1YIT1 4NBBA 3CQZI 3S1MI 1DL6A 1U5MA 3I56Z 2VUGA 4A3GI 1NWVA 3CCR1 1YHQ1 2E2HI 4DK1A 3GTMS 3HOWI 3CCS1 4QTUA 1L1OC 1VQ6Z 3I4MI 1W2BZ 2JA5I 2LFUA 2F4MA 4RVHA 1R9TI 2J6AA 1VQKZ 1VQ7Z 2JGWA 1ML8A 3QWUA 3G4SZ 4A93I 1M1K2 3D9XA 3CMAZ 5FLXb 3S15I 1Q862 5AN9F 2DE5A 4Y7NI 4NBGA 1YITZ 3INBC 1VQO1 4ONTD 1K8A2 1HFHA 1KRLA 4K12A 2WAQA 3CCRZ 1YHQZ 3S16I 2Y0SA 2G7IA 3CCSZ 3ZD1A 1TWGI 2WB1A 3J7A4 1P9NA 5T67A 4E2ZA 1VQN1 2QREB 1RQFA 1QVGY 1QUBA 2R6MA 5C3EI 1OJVA 4F4OC 3BG1B 4NBCA 4AYBA 2V8JA 1OJYA 1UOTP 2EC3A 1VQOZ 1SFOI 1VQ41 3ZD2A 2QRCB 1Q812 4X6AI 3CC21 1GKGA 1NUIA 1OK2A 3EJHA 4ZH1D 3NDJA 1PFTA 2K5RA 4KKDA 1YJ91 4MXUA 1VQNZ 2O53A 2Q4ZA 2B5ID 2Q51A 1QGBA 4CL1A 1YJW1 1W2BY 3HOXI 1M1K1 4NOZA 2JRAA 1Q861 5HZPB 1VQ4Z 1VQP1 5D1OB 2EHFA 1LQLA 1N2FA 3CC41 1TWHI 3CC2Z 1E5GA 1K8A1 4DJZA 4BY7I 3NH5A 3Q87A 3L89M 1S7MA 4NBEA 3D6WA 1JJ2Z 1YJ9Z 1JWHC 2LIYA 3TDHB 3CD61 3CCEZ 3CALA 1USPA 1FBRA 1H03P 2W80A 1YJWZ 1VQM1 5JPMG 1I50I 4BXXI 1SRZA 2MCZA 1I6HI 2QA4Z 3CPWZ 3HOYI 1VQPZ 4Y52I 1Q822 3OEDC 2O39C 2V8IA 4RVDA 2QY0A 4LOTA 4MD7A 5T64A 4HH4A 3NDIA 3CC4Z 3M3YI 2E9HA 3VMHA 1Y1VS 2I3CA 1SS2A 5C4JI 2BJOA 1G4GA 4E2YA 4DQYB 1VLAA 1GKNA 4AYEA 3CD6Z 2O4HA 1VQ51 2OOXB 1X3WA 5HYTB 5A2Qb 4IGDA 2JUBA 2K3RA 2UWNA 4MONA 1H2PP 2W04A 1VQMZ 3S2HI 3K7AI 4S1TA 2RKZA 1QVFZ 4NB8A 4E32A 2KMSA 1NJI1 4B2SA 3I07A 3CCM1 3PO2I 1OJWA 1PPQA 2XQWC 2H85A 4FXGG 2KPIA 3HOUI 2RPRA 2RT9A 2E2II 4E31A 1Z01A 3S1QI 2VF1A 4E2XA 4MD9A 2KI7B 3JAMb 3GTJI 4A3KI 1Q7Y2 4RS4A 3MQLA 1VQ5Z 4RV9A 2QR1B 3LUSA 3RZOI 4A3CI 3OXUD 1K731 1RO0A 2QLVB 4A3MI 1JJ2Y 4LOSA 2YRAA 4E30A 3GXEA 2IZ3A 1H2QP 1O9AA 1VVCA 3CCMZ 3GTKI 2W81A 1Q821 5C4XI 3ERBA 3IX0A 3S17I 3CXCZ 1Q3XA 1TPNA 5FLMI 3O8EB 2PK7A 4QTTA 3CPWY 1NP6A 1TWCI 3CC71 1E88A 5I0QB 3M4OI 1YI21 3EERA 3J80f 2RIQA 4A3FI 1Y1WI 3VTNA 2V8EA 1YJN1 1ZJKA 1ELVA 1M902 1RO4A 2JNYA 5D1OA 2RLQA 1WCMI 3S14I 2YADA 1ZH1A 2OTJ1 4YNXA 1Z02A 1MD7A 3GTQI 3S1RI 1TPGA 1NJI2 1QVFY 4EWCA 2OOYB 4MD8A 3CC7Z 3I4NI 1YI2Z 3OW2Z 1TPMA 4NBFA 2P28A 1Q7Y1 1YIJ1 1I3QI 1YJNZ 2V8KA 1K9M2 2HF1A 2M48A 2GTHA 1YUAA 4BBRI 1CKLA 1Z92B 1MD8A 2PM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYT B;  4K12 A;  5HYP A;  4IGD A;  4PZ5 A;  3R62 A;  2BZM A;  3GOV A;  2G7I A;  2UWN A;  1C1Z A;  1H2P P;  3ZD1 A;  4B2R A;  1OK9 A;  2RKZ A;  2RLP A;  2WII C;  1QUB A;  2KMS A;  1E8B A;  3NFP I;  4B2S A;  1GHQ B;  1OJW A;  1PPQ A;  1OJV A;  2XQW C;  4FXG G;  3RJ3 D;  4F4O C;  1VVD A;  1HFI A;  4A5W B;  5HYU B;  2KRI A;  2JGX A;  1OJY A;  1UOT P;  2EC3 A;  4JHS A;  3ZD2 A;  2RKY A;  1QO6 A;  2MCY A;  3MQL A;  2XWB F;  1GKG A;  4CSY A;  1OK2 A;  3EJH A;  4ZH1 D;  4AYM A;  3OXU D;  4KKD A;  2YRA A;  4LOS A;  2XWJ I;  3GXE A;  3OP8 A;  2IZ3 A;  2B5I D;  1H2Q P;  1O9A A;  3TVJ A;  4J38 B;  1VVC A;  1QGB A;  2W81 A;  3ERB A;  3IX0 A;  4WJG 2;  2ERJ A;  1Q3X A;  3KXV A;  4MUC A;  3ZRZ A;  1TPN A;  2CG6 A;  3O8E B;  2JRA A;  5HZP B;  1OK3 A;  2CKU A;  5FO8 C;  2EHF A;  4AYI A;  2LOJ A;  1E88 A;  5I0Q B;  2CG7 A;  4AYD A;  1H04 P;  1E5G A;  4DJZ A;  1LY2 A;  3SW0 X;  3L89 M;  2A55 A;  2RL0 A;  2V8E A;  1ZJK A;  1G4F A;  1ELV A;  1U5M A;  2IZ4 A;  1GKN A;  3IU3 I;  2RLQ A;  1NWV A;  2YBY A;  3CAL A;  1FBR A;  1H03 P;  4YNX A;  1MD7 A;  2W80 A;  3M7P A;  1TPG A;  5JPM G;  1SRZ A;  2MCZ A;  2XRB A;  1GPZ A;  1HCC A;  3KZJ A;  3OED C;  2O39 C;  2QY0 A;  2JGW A;  4LOT A;  1OK1 A;  1TPM A;  3INB C;  1SS2 A;  3T5O A;  1G4G A;  4ONT D;  2XRD A;  4C16 A;  1HFH A;  1CKL A;  1Z92 B;  1MD8 A;  4AYE A; 
#chains in the Genus database with same CATH topology
 1K73 2;  1ZB9 A;  3BG0 B;  1FDO A;  5HYP A;  2OTJ Z;  2BZM A;  3K3T A;  3HOZ I;  4B2R A;  2B63 I;  4E2W A;  3GTG I;  2RLP A;  2WII C;  3CCQ 1;  1E8B A;  3NFP I;  3CCL 1;  1GHQ B;  3CI0 J;  1TWA I;  3RJ3 D;  1RLH A;  2W03 A;  3NJA A;  3CXC Y;  5D1P A;  4A3E I;  4A5W B;  5HYU B;  3I55 1;  3IFU A;  2KRI A;  1YIJ Z;  4JHS A;  4NH1 C;  2JA6 I;  1KC8 1;  3VB9 A;  2RKY A;  2OTL 1;  1QO6 A;  4NBA A;  3MZL B;  2MCY A;  1M90 1;  3J81 f;  2GTI A;  2NAP A;  3G4S 1;  3GCF A;  1VQ9 1;  4XX2 A;  2HU9 A;  2X2Z A;  4AYM A;  3KIF A;  3GTM I;  2NVX I;  3J80 b;  3CCJ 1;  1KQS Z;  3ESW A;  3CCQ Z;  2EGT A;  3TVJ A;  2GU2 A;  3RZD I;  4J38 B;  3CCL Z;  3FQQ A;  1VQL 1;  2NVQ I;  2VPZ A;  2JR6 A;  2ERJ A;  3KXV A;  3EED A;  3ZRZ A;  5LL6 f;  2E2J I;  3MZK B;  3I55 Z;  3GTO I;  3P5J B;  1OK3 A;  2CKU A;  5FO8 C;  1TFI A;  2OTL Z;  2F4O A;  1K9M 1;  3F3F C;  2CG7 A;  3OW2 Y;  1VQ9 Z;  2A55 A;  1N8R 1;  3U50 C;  2RL0 A;  3CME 1;  1G4F A;  4NBH A;  1QF8 A;  3CCJ Z;  2IZ4 A;  4NBD A;  2R7Z I;  3IU3 I;  2ZYC A;  2YBY A;  3GTP I;  2V3V A;  2QEX 1;  4NB9 A;  2JIR A;  3T4N B;  1VQL Z;  3M7P A;  3IF8 A;  3D2L A;  1K83 I;  2XRB A;  3GKQ A;  1GPZ A;  2E7Z A;  5IT9 f;  1HCC A;  2DE7 A;  1RO2 A;  3KZJ A;  2NVY I;  5T6B A;  3TE5 B;  1WW9 A;  2JIM A;  1OK1 A;  1RLY A;  1RNI A;  3CCU 1;  1KC8 2;  5IP7 I;  3VMI A;  1KD1 2;  3H3V J;  2AKL A;  2QRD B;  3CME Z;  3T5O A;  3H0G I;  4DGL A;  4MH4 A;  2XRD A;  2JIP A;  1YUK A;  1ZB8 A;  5DN4 A;  3FQM A;  4C16 A;  5CM2 M;  5IP9 I;  5A2Q f;  2PMZ A;  3G6E 1;  1TWF I;  4PZ5 A;  3R62 A;  2VPX A;  3J81 b;  3GOV A;  3IR7 A;  2QEX Z;  1WII A;  4BY1 I;  1C1Z A;  1KQS Y;  3NH8 A;  1OK9 A;  3F6K A;  5FLX f;  2NVT I;  2OZK A;  3CCE 1;  1VVD A;  4RVG A;  3GTL I;  2VPY A;  3PO3 I;  1HFI A;  3CCU Z;  4A3J I;  3MON A;  3G71 1;  4NFR A;  2JGX A;  3S2D I;  2JA8 I;  4RVF A;  3VMG A;  2QA4 1;  3S1N I;  2R93 I;  2I2L A;  3JAM f;  1N8R 2;  2M6N A;  2VUM I;  1QYP A;  2JIQ A;  1S72 1;  1VQ8 1;  3HOV I;  3CCV 1;  2XWB F;  3PO3 S;  4CSY A;  3G6E Z;  2JA7 I;  3NH4 A;  4A3D I;  2DE6 A;  2JIO A;  3FKI I;  2ZAE B;  3I56 1;  3KIH A;  1X3Z A;  2XWJ I;  4TNU A;  3OP8 A;  3HKZ A;  4HGY A;  1QVG Z;  3F3P C;  2YU9 I;  4BBS I;  2JS4 A;  2QKD A;  3NFZ A;  2Y8S A;  1Z03 A;  4WJG 2;  1VQ6 1;  4A3L I;  4MUC A;  4MSL A;  1X0T A;  4E33 A;  3G71 Z;  2CG6 A;  1Y1V I;  2JMO A;  2RHB A;  5C44 I;  1KD1 1;  4MRI A;  2G2K A;  4AYI A;  1VQK 1;  2LOJ A;  4HGZ A;  4A3I I;  1VQ7 1;  1S72 Z;  5IT9 b;  1VQ8 Z;  4AYD A;  2R92 I;  1H04 P;  3CCV Z;  3CMA 1;  1USP B;  1LY2 A;  3SW0 X;  2RBL A;  4A3B I;  1Q81 1;  2P3Y A;  1YIT 1;  4NBB A;  3CQZ I;  3S1M I;  1DL6 A;  1U5M A;  3I56 Z;  2VUG A;  4A3G I;  1NWV A;  3CCR 1;  1YHQ 1;  2E2H I;  4DK1 A;  3GTM S;  3HOW I;  3CCS 1;  4QTU A;  3VWO A;  1L1O C;  1VQ6 Z;  3I4M I;  1W2B Z;  2JA5 I;  2LFU A;  2F4M A;  4RVH A;  1R9T I;  2J6A A;  1VQK Z;  1VQ7 Z;  2JGW A;  1ML8 A;  3QWU A;  3G4S Z;  4A93 I;  1M1K 2;  3D9X A;  3CMA Z;  5FLX b;  3S15 I;  1Q86 2;  5AN9 F;  2DE5 A;  4Y7N I;  4NBG A;  1YIT Z;  3INB C;  1VQO 1;  1SIW A;  4ONT D;  1K8A 2;  1HFH A;  1KRL A;  4K12 A;  2WAQ A;  3CCR Z;  1YHQ Z;  3S16 I;  2Y0S A;  2G7I A;  3CCS Z;  3ZD1 A;  1TWG I;  2WB1 A;  3J7A 4;  1P9N A;  5T67 A;  4E2Z A;  1VQN 1;  2QRE B;  1RQF A;  1QVG Y;  1QUB A;  2R6M A;  5C3E I;  2V45 A;  1OJV A;  4F4O C;  3BG1 B;  4NBC A;  4AYB A;  2V8J A;  1OJY A;  1UOT P;  2EC3 A;  1VQO Z;  1SFO I;  1VQ4 1;  3ZD2 A;  2QRC B;  1Q81 2;  4X6A I;  3CC2 1;  1GKG A;  1NUI A;  1OK2 A;  3EJH A;  4ZH1 D;  3NDJ A;  1Y8C A;  1PFT A;  2K5R A;  4KKD A;  1YJ9 1;  4MXU A;  1VQN Z;  1WZN A;  2O53 A;  2Q4Z A;  2B5I D;  2Q51 A;  1QGB A;  3WSY A;  1FDI A;  4CL1 A;  1YJW 1;  1W2B Y;  3HOX I;  1M1K 1;  4NOZ A;  2JRA A;  2VPW A;  1Q86 1;  5HZP B;  1VQ4 Z;  1VQP 1;  5D1O B;  2EHF A;  1LQL A;  1N2F A;  3CC4 1;  1TWH I;  3CC2 Z;  1E5G A;  1K8A 1;  4DJZ A;  4BY7 I;  3NH5 A;  3Q87 A;  3L89 M;  1S7M A;  4NBE A;  3D6W A;  1JJ2 Z;  1YJ9 Z;  1JWH C;  2LIY A;  3TDH B;  3CD6 1;  4YIZ A;  3CCE Z;  3CAL A;  1USP A;  1FBR A;  1H03 P;  2W80 A;  1YJW Z;  1VQM 1;  5JPM G;  1I50 I;  4BXX I;  3ZLE A;  1SRZ A;  2MCZ A;  1I6H I;  2QA4 Z;  3CPW Z;  3ZLD A;  3HOY I;  1VQP Z;  4Y52 I;  1Q82 2;  3OED C;  2O39 C;  2V8I A;  4RVD A;  2QY0 A;  4LOT A;  4MD7 A;  5T64 A;  4HH4 A;  3NDI A;  3CC4 Z;  3M3Y I;  2E9H A;  3VMH A;  2Y8R A;  1Y1V S;  2I3C A;  1SS2 A;  5C4J I;  2BJO A;  1G4G A;  4E2Y A;  4DQY B;  1VLA A;  2IV2 X;  1GKN A;  4AYE A;  3CD6 Z;  2O4H A;  1VQ5 1;  2OOX B;  1X3W A;  5HYT B;  5A2Q b;  4IGD A;  2JUB A;  2K3R A;  2UWN A;  4MON A;  1H2P P;  2W04 A;  1VQM Z;  3S2H I;  3K7A I;  4S1T A;  2RKZ A;  5DN5 A;  1QVF Z;  4NB8 A;  4E32 A;  3FGR A;  2KMS A;  1NJI 1;  4B2S A;  3I07 A;  3CCM 1;  3PO2 I;  1OJW A;  1PPQ A;  2XQW C;  2H85 A;  4FXG G;  2KPI A;  3HOU I;  2RPR A;  2RT9 A;  1WJ2 A;  2E2I I;  4E31 A;  1Z01 A;  3S1Q I;  2VF1 A;  2Y8T A;  4E2X A;  4MD9 A;  1Q16 A;  2KI7 B;  3JAM b;  3GTJ I;  4A3K I;  1Q7Y 2;  4RS4 A;  3MQL A;  1VQ5 Z;  4RV9 A;  2QR1 B;  3LUS A;  3RZO I;  4A3C I;  2AYD A;  3OXU D;  1K73 1;  1RO0 A;  2QLV B;  4A3M I;  1JJ2 Y;  4LOS A;  2YRA A;  3WSX A;  4E30 A;  3GXE A;  2IZ3 A;  1H2Q P;  1O9A A;  1VVC A;  3CCM Z;  3GTK I;  2W81 A;  1Q82 1;  5C4X I;  3ERB A;  1QXF A;  3IX0 A;  3S17 I;  3CXC Z;  1Q3X A;  1TPN A;  5FLM I;  3O8E B;  2PK7 A;  4QTT A;  3CPW Y;  1NP6 A;  1TWC I;  3CC7 1;  1E88 A;  5I0Q B;  3M4O I;  1YI2 1;  3EER A;  3J80 f;  2RIQ A;  4A3F I;  1Y1W I;  3VTN A;  2V8E A;  1YJN 1;  1ZJK A;  1ELV A;  1M90 2;  1RO4 A;  2JNY A;  5D1O A;  2LEX A;  2RLQ A;  1WCM I;  3S14 I;  2YAD A;  1ZH1 A;  2OTJ 1;  4YNX A;  1Z02 A;  1MD7 A;  3GTQ I;  3S1R I;  1AA6 A;  1TPG A;  1NJI 2;  1QVF Y;  4EWC A;  2OOY B;  4MD8 A;  3CC7 Z;  4PO7 A;  3I4N I;  1YI2 Z;  3OW2 Z;  1TPM A;  3FGT A;  4NBF A;  2P28 A;  1Q7Y 1;  4BWC A;  1YIJ 1;  1I3Q I;  1YJN Z;  2V8K A;  1K9M 2;  4APL A;  2HF1 A;  2M48 A;  2GTH A;  1YUA A;  4BBR I;  4N7E A;  1CKL A;  1Z92 B;  1MD8 A;  2PM9 A; 
#chains in the Genus database with same CATH homology
 1K73 2;  1ZB9 A;  3BG0 B;  5HYP A;  2OTJ Z;  2BZM A;  3HOZ I;  4B2R A;  2B63 I;  4E2W A;  3GTG I;  2RLP A;  2WII C;  3CCQ 1;  1E8B A;  3NFP I;  3CCL 1;  1GHQ B;  1TWA I;  3RJ3 D;  2W03 A;  4A3E I;  3CXC Y;  5D1P A;  4A5W B;  5HYU B;  3I55 1;  3IFU A;  2KRI A;  1YIJ Z;  4JHS A;  4NH1 C;  2JA6 I;  1KC8 1;  3VB9 A;  2RKY A;  2OTL 1;  1QO6 A;  4NBA A;  3MZL B;  2MCY A;  1M90 1;  3J81 f;  2GTI A;  3G4S 1;  3GCF A;  1VQ9 1;  4XX2 A;  2HU9 A;  4AYM A;  3KIF A;  3GTM I;  2NVX I;  3J80 b;  3CCJ 1;  1KQS Z;  3ESW A;  3CCQ Z;  2EGT A;  3TVJ A;  2GU2 A;  3RZD I;  4J38 B;  3CCL Z;  3FQQ A;  1VQL 1;  2NVQ I;  2JR6 A;  2ERJ A;  3KXV A;  3EED A;  3ZRZ A;  5LL6 f;  2E2J I;  3MZK B;  3I55 Z;  3GTO I;  3P5J B;  1OK3 A;  2CKU A;  5FO8 C;  1TFI A;  2OTL Z;  2F4O A;  1K9M 1;  3F3F C;  2CG7 A;  3OW2 Y;  1VQ9 Z;  2A55 A;  1N8R 1;  3U50 C;  2RL0 A;  3CME 1;  1G4F A;  4NBH A;  1QF8 A;  3CCJ Z;  2IZ4 A;  4NBD A;  2R7Z I;  3IU3 I;  2YBY A;  3GTP I;  2QEX 1;  4NB9 A;  3T4N B;  1VQL Z;  3M7P A;  3IF8 A;  1K83 I;  2XRB A;  3GKQ A;  1GPZ A;  5IT9 f;  1HCC A;  2DE7 A;  1RO2 A;  3KZJ A;  2NVY I;  5T6B A;  3TE5 B;  1WW9 A;  1OK1 A;  1RLY A;  1RNI A;  3CCU 1;  1KC8 2;  5IP7 I;  3VMI A;  1KD1 2;  3H3V J;  2AKL A;  2QRD B;  3CME Z;  3T5O A;  3H0G I;  4DGL A;  4MH4 A;  2XRD A;  1YUK A;  1ZB8 A;  3FQM A;  4C16 A;  5CM2 M;  5IP9 I;  5A2Q f;  2PMZ A;  3G6E 1;  1TWF I;  4PZ5 A;  3R62 A;  2QEX Z;  3J81 b;  3GOV A;  4BY1 I;  1WII A;  1C1Z A;  1KQS Y;  3NH8 A;  1OK9 A;  5FLX f;  2NVT I;  2OZK A;  3CCE 1;  1VVD A;  4RVG A;  3GTL I;  3PO3 I;  1HFI A;  3CCU Z;  4A3J I;  3MON A;  3G71 1;  4NFR A;  2JGX A;  3S2D I;  2JA8 I;  4RVF A;  3VMG A;  2QA4 1;  3S1N I;  2R93 I;  3JAM f;  1N8R 2;  2M6N A;  2VUM I;  1QYP A;  1S72 1;  1VQ8 1;  3HOV I;  3CCV 1;  2XWB F;  3PO3 S;  4CSY A;  3G6E Z;  2JA7 I;  3NH4 A;  4A3D I;  2DE6 A;  3FKI I;  2ZAE B;  3I56 1;  3KIH A;  1X3Z A;  2XWJ I;  4TNU A;  3OP8 A;  3HKZ A;  4HGY A;  1QVG Z;  3F3P C;  2YU9 I;  4BBS I;  2JS4 A;  2QKD A;  3NFZ A;  1Z03 A;  4WJG 2;  1VQ6 1;  4A3L I;  4MUC A;  1X0T A;  4E33 A;  3G71 Z;  2CG6 A;  1Y1V I;  2JMO A;  2RHB A;  5C44 I;  1KD1 1;  4MRI A;  2G2K A;  4AYI A;  1VQK 1;  2LOJ A;  4HGZ A;  4A3I I;  1VQ7 1;  1S72 Z;  5IT9 b;  1VQ8 Z;  4AYD A;  2R92 I;  1H04 P;  3CCV Z;  3CMA 1;  1USP B;  1LY2 A;  3SW0 X;  2RBL A;  4A3B I;  1Q81 1;  2P3Y A;  1YIT 1;  4NBB A;  3CQZ I;  3S1M I;  1DL6 A;  1U5M A;  3I56 Z;  2VUG A;  4A3G I;  1NWV A;  3CCR 1;  1YHQ 1;  2E2H I;  4DK1 A;  3GTM S;  3HOW I;  3CCS 1;  4QTU A;  1L1O C;  1VQ6 Z;  3I4M I;  1W2B Z;  2JA5 I;  2LFU A;  2F4M A;  4RVH A;  1R9T I;  2J6A A;  1VQK Z;  1VQ7 Z;  2JGW A;  1ML8 A;  3QWU A;  3G4S Z;  4A93 I;  1M1K 2;  3D9X A;  3CMA Z;  5FLX b;  3S15 I;  1Q86 2;  5AN9 F;  2DE5 A;  4Y7N I;  4NBG A;  1YIT Z;  3INB C;  1VQO 1;  4ONT D;  1K8A 2;  1HFH A;  1KRL A;  4K12 A;  2WAQ A;  3CCR Z;  1YHQ Z;  3S16 I;  2Y0S A;  2G7I A;  3CCS Z;  3ZD1 A;  1TWG I;  2WB1 A;  3J7A 4;  1P9N A;  5T67 A;  4E2Z A;  1VQN 1;  2QRE B;  1RQF A;  1QVG Y;  1QUB A;  2R6M A;  5C3E I;  1OJV A;  4F4O C;  3BG1 B;  4NBC A;  4AYB A;  2V8J A;  1OJY A;  1UOT P;  2EC3 A;  1VQO Z;  1SFO I;  1VQ4 1;  3ZD2 A;  2QRC B;  1Q81 2;  4X6A I;  3CC2 1;  1GKG A;  1NUI A;  1OK2 A;  3EJH A;  4ZH1 D;  3NDJ A;  1PFT A;  2K5R A;  4KKD A;  1YJ9 1;  4MXU A;  1VQN Z;  2O53 A;  2Q4Z A;  2B5I D;  2Q51 A;  1QGB A;  4CL1 A;  1YJW 1;  1W2B Y;  3HOX I;  1M1K 1;  4NOZ A;  2JRA A;  1Q86 1;  5HZP B;  1VQ4 Z;  1VQP 1;  5D1O B;  2EHF A;  1LQL A;  1N2F A;  3CC4 1;  1TWH I;  3CC2 Z;  1E5G A;  1K8A 1;  4DJZ A;  4BY7 I;  3NH5 A;  3Q87 A;  3L89 M;  1S7M A;  4NBE A;  3D6W A;  1JJ2 Z;  1YJ9 Z;  1JWH C;  2LIY A;  3TDH B;  3CD6 1;  3CCE Z;  3CAL A;  1USP A;  1FBR A;  1H03 P;  2W80 A;  1YJW Z;  1VQM 1;  5JPM G;  1I50 I;  4BXX I;  1SRZ A;  2MCZ A;  1I6H I;  2QA4 Z;  3CPW Z;  3HOY I;  1VQP Z;  4Y52 I;  1Q82 2;  3OED C;  2O39 C;  2V8I A;  4RVD A;  2QY0 A;  4LOT A;  4MD7 A;  5T64 A;  4HH4 A;  3NDI A;  3CC4 Z;  3M3Y I;  2E9H A;  3VMH A;  1Y1V S;  2I3C A;  1SS2 A;  5C4J I;  2BJO A;  1G4G A;  4E2Y A;  4DQY B;  1VLA A;  1GKN A;  4AYE A;  3CD6 Z;  2O4H A;  1VQ5 1;  2OOX B;  1X3W A;  5HYT B;  5A2Q b;  4IGD A;  2JUB A;  2K3R A;  2UWN A;  4MON A;  1H2P P;  2W04 A;  1VQM Z;  3S2H I;  3K7A I;  4S1T A;  2RKZ A;  1QVF Z;  4NB8 A;  4E32 A;  2KMS A;  1NJI 1;  4B2S A;  3I07 A;  3CCM 1;  3PO2 I;  1OJW A;  1PPQ A;  2XQW C;  2H85 A;  4FXG G;  2KPI A;  3HOU I;  2RPR A;  2RT9 A;  2E2I I;  4E31 A;  1Z01 A;  3S1Q I;  2VF1 A;  4E2X A;  4MD9 A;  2KI7 B;  3JAM b;  3GTJ I;  4A3K I;  1Q7Y 2;  4RS4 A;  3MQL A;  1VQ5 Z;  4RV9 A;  2QR1 B;  3LUS A;  3RZO I;  4A3C I;  3OXU D;  1K73 1;  1RO0 A;  2QLV B;  4A3M I;  1JJ2 Y;  4LOS A;  2YRA A;  4E30 A;  3GXE A;  2IZ3 A;  1H2Q P;  1O9A A;  1VVC A;  3CCM Z;  3GTK I;  2W81 A;  1Q82 1;  5C4X I;  3ERB A;  3IX0 A;  3S17 I;  3CXC Z;  1Q3X A;  1TPN A;  5FLM I;  3O8E B;  2PK7 A;  4QTT A;  3CPW Y;  1NP6 A;  1TWC I;  3CC7 1;  1E88 A;  5I0Q B;  3M4O I;  1YI2 1;  3EER A;  3J80 f;  2RIQ A;  4A3F I;  1Y1W I;  3VTN A;  2V8E A;  1YJN 1;  1ZJK A;  1ELV A;  1M90 2;  1RO4 A;  2JNY A;  5D1O A;  2RLQ A;  1WCM I;  3S14 I;  2YAD A;  1ZH1 A;  2OTJ 1;  4YNX A;  1Z02 A;  1MD7 A;  3GTQ I;  3S1R I;  1TPG A;  1NJI 2;  1QVF Y;  4EWC A;  2OOY B;  4MD8 A;  3CC7 Z;  3I4N I;  1YI2 Z;  3OW2 Z;  1TPM A;  4NBF A;  2P28 A;  1Q7Y 1;  1YIJ 1;  1I3Q I;  1YJN Z;  2V8K A;  1K9M 2;  2HF1 A;  2M48 A;  2GTH A;  1YUA A;  4BBR I;  1CKL A;  1Z92 B;  1MD8 A;  2PM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...