3ZLDA

Crystal structure of toxoplasma gondii sporozoite ama1 in complex with a 36 aa region of sporozoite ron2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
381
structure length
363
Chain Sequence
GQNPWATTTAFADFMKRFNIPQVHGSGIFVDLGRDTEGYREVGGKCPVFGKAIQMHQPAEYSNNFLDDAPTSNDASKKPLPGGFNNPQVYTSGQKFSPIDDSLLQERLGTAGPKTAIGRCALYAYSTIAVNPSTNYTSTYKYPFVYDAVSRKCYVLSVSAQLLKGEKYCSVNGTPSGLTWACFEPVKEKSSARALVYGSAFVAEGNPDAWQSACPNDAVKDALFGKWEDGQCVPFDTKTSVQSDQATNKEECWKRVFANPLVASDAPTTSSPKSGGFGANWANFYLEKESGETICAIFDQVPDCFAPITGAVAYTALGSSTEVNLPQCDSASFIPIEGPCNNCVQVVTECVGNQFDQTSKACC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APICAL MEMBRANE ANTIGEN 1
publication title Toxoplasma Gondii Sporozoites Invade Host Cells Using Two Novel Paralogs of Ron2 and Ama1
pubmed doi rcsb
source organism Toxoplasma gondii
molecule tags Membrane protein
total genus 84
structure length 363
sequence length 381
ec nomenclature
pdb deposition date 2013-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02430 AMA-1 Apical membrane antigen 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.70 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3zldA03
3ZLDA 2Y8RA 2Y8TA 4APLA 2Y8SA 3ZLEA 4YIZA 2X2ZA
chains in the Genus database with same CATH superfamily
4B2SA 1PPQA 3KXVA 3EJHA 3GXEA 1H04P 2Y8TA 1OJVA 2X2ZA 1MD7A 1G4GA 2JRAA 1U5MA 4JHSA 3WSYA 1GPZA 3MQLA 1H2QP 4B2RA 4F4OC 2RKZA 1Q3XA 2O39C 1HFHA 2W81A 1MD8A 4J38B 4ZH1D 3K3TA 2EHFA 2Y8RA 2JGWA 2IZ4A 1ELVA 4A5WB 2V8EA 1TPGA 3O8EB 3CALA 4FXGG 2Y8SA 3ZRZA 2KMSA 1QO6A 3L89M 1OJWA 1E88A 3M7PA 3WSXA 3VWOA 4LOSA 3R62A 3NJAA 5JPMG 1H03P 2IZ3A 2LOJA 2XRBA 1OK1A 2XWJI 1NWVA 4KKDA 2ZYCA 2UWNA 4MSLA 4DJZA 1OK9A 3F6KA 4IGDA 1HFIA 2CKUA 2I2LA 1GKNA 4K12A 4BWCA 3SW0X 2CG7A 1O9AA 2G7IA 2QY0A 1H2PP 3OP8A 4N7EA 4YNXA 2W80A 2MCZA 1QUBA 4AYDA 4AYEA 2EC3A 1TPNA 3ERBA 1SRZA 3ZLEA 4C16A 3IU3I 1Z92B 2CG6A 3INBC 2JGXA 4CSYA 1HCCA 2RKYA 1VVDA 3FGRA 3CI0J 3NFPI 3ZD1A 1E8BA 1OK3A 1LY2A 2MCYA 3KZJA 2ERJA 3GOVA 4PZ5A 5HZPB 1SS2A 5HYTB 1FBRA 4WJG2 4LOTA 2WIIC 4PO7A 2XRDA 2BZMA 2A55A 1UOTP 3RJ3D 1CKLA 1C1ZA 4MUCA 4YIZA 2XQWC 5DN5A 3TVJA 2KRIA 5DN4A 2RL0A 1E5GA 1QGBA 3ZD2A 5FO8C 1RLHA 3OEDC 4AYIA 2YRAA 2B5ID 1G4FA 4ONTD 3OXUD 2XWBF 4APLA 2YBYA 3FGTA 5HYUB 3IX0A 5I0QB 2RLQA 1GHQB 1TPMA 1OJYA 1VVCA 2RLPA 1GKGA 4AYMA 3ZLDA 1ZJKA 1OK2A 5HYPA 3T5OA
chains in the Genus database with same CATH topology
3WSXA 3NJAA 2Y8TA 3FGRA 2X2ZA 3WSYA 4MSLA 4APLA 3F6KA 3FGTA 2I2LA 4BWCA 4PO7A 2Y8RA 4N7EA 3ZLDA 2Y8SA 3ZLEA 4YIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZLD A;  2Y8R A;  2Y8T A;  4APL A;  2Y8S A;  3ZLE A;  4YIZ A;  2X2Z A; 
#chains in the Genus database with same CATH topology
 4B2S A;  1PPQ A;  3KXV A;  3EJH A;  3GXE A;  1H04 P;  2Y8T A;  1OJV A;  2X2Z A;  1MD7 A;  1G4G A;  2JRA A;  1U5M A;  4JHS A;  3WSY A;  1GPZ A;  3MQL A;  1H2Q P;  4B2R A;  4F4O C;  2RKZ A;  1Q3X A;  2O39 C;  1HFH A;  2W81 A;  1MD8 A;  4J38 B;  4ZH1 D;  3K3T A;  2EHF A;  2Y8R A;  2JGW A;  2IZ4 A;  1ELV A;  4A5W B;  2V8E A;  1TPG A;  3O8E B;  3CAL A;  4FXG G;  2Y8S A;  3ZRZ A;  2KMS A;  1QO6 A;  3L89 M;  1OJW A;  1E88 A;  3M7P A;  3WSX A;  3VWO A;  4LOS A;  3R62 A;  3NJA A;  5JPM G;  1H03 P;  2IZ3 A;  2LOJ A;  2XRB A;  1OK1 A;  2XWJ I;  1NWV A;  4KKD A;  2ZYC A;  2UWN A;  4MSL A;  4DJZ A;  1OK9 A;  3F6K A;  4IGD A;  1HFI A;  2CKU A;  2I2L A;  1GKN A;  4K12 A;  4BWC A;  3SW0 X;  2CG7 A;  1O9A A;  2G7I A;  2QY0 A;  1H2P P;  3OP8 A;  4N7E A;  4YNX A;  2W80 A;  2MCZ A;  1QUB A;  4AYD A;  4AYE A;  2EC3 A;  1TPN A;  3ERB A;  1SRZ A;  3ZLE A;  4C16 A;  3IU3 I;  1Z92 B;  2CG6 A;  3INB C;  2JGX A;  4CSY A;  1HCC A;  2RKY A;  1VVD A;  3FGR A;  3CI0 J;  3NFP I;  3ZD1 A;  1E8B A;  1OK3 A;  1LY2 A;  2MCY A;  3KZJ A;  2ERJ A;  3GOV A;  4PZ5 A;  5HZP B;  1SS2 A;  5HYT B;  1FBR A;  4WJG 2;  4LOT A;  2WII C;  4PO7 A;  2XRD A;  2BZM A;  2A55 A;  1UOT P;  3RJ3 D;  1CKL A;  1C1Z A;  4MUC A;  4YIZ A;  2XQW C;  5DN5 A;  3TVJ A;  2KRI A;  5DN4 A;  2RL0 A;  1E5G A;  1QGB A;  3ZD2 A;  5FO8 C;  1RLH A;  3OED C;  4AYI A;  2YRA A;  2B5I D;  1G4F A;  4ONT D;  3OXU D;  2XWB F;  4APL A;  2YBY A;  3FGT A;  5HYU B;  3IX0 A;  5I0Q B;  2RLQ A;  1GHQ B;  1TPM A;  1OJY A;  1VVC A;  2RLP A;  1GKG A;  4AYM A;  3ZLD A;  1ZJK A;  1OK2 A;  5HYP A;  3T5O A; 
#chains in the Genus database with same CATH homology
 3WSX A;  3NJA A;  2Y8T A;  3FGR A;  2X2Z A;  3WSY A;  4MSL A;  4APL A;  3F6K A;  3FGT A;  2I2L A;  4BWC A;  4PO7 A;  2Y8R A;  4N7E A;  3ZLD A;  2Y8S A;  3ZLE A;  4YIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...