4B2SA

Solution structure of ccp modules 11-12 of complement factor h
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
127
structure length
127
Chain Sequence
EAEAAGVQSCGPPPELLNGNVKEKTKEEYGHSEVVEYYCNPRFLMKGPNKIQCVDGEWTTLPVCIVEESTCGDIPELEHGWAQLSSPPYYYGDSVEFNCSESFTMIGHRSITCIHGVWTQLPQCVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Solution Structure of Ccp Modules 10-12 Illuminates Functional Architecture of the Complement Regulator, Factor H.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 16
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4b2sA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4b2sA01
5FO8C 1SS2A 1MD8A 1ZJKA 2JGWA 1GKGA 2EHFA 1TPNA 5HYTB 1QGBA 3O8EB 1OK3A 2BZMA 1GPZA 5HZPB 3TVJA 3GXEA 2XWJI 1OK1A 4ONTD 4YNXA 4AYDA 1G4FA 3ERBA 2XWBF 3GOVA 4IGDA 1E5GA 5HYUB 2W81A 2CG6A 3RJ3D 2KRIA 2A55A 1VVCA 2B5ID 2IZ4A 2KMSA 2XRDA 3INBC 2JRAA 4B2RA 3R62A 1H2QP 1NWVA 1ELVA 1OK9A 2CKUA 4JHSA 2QY0A 2YRAA 3EJHA 3OP8A 1QO6A 2UWNA 1OJYA 3L89M 1HFIA 1PPQA 4B2SA 1Z92B 4FXGG 3OXUD 1UOTP 1C1ZA 1U5MA 3KXVA 1E88A 2RLPA 1OJWA 2ERJA 1QUBA 4AYMA 2EC3A 3MQLA 1FBRA 1TPGA 2XQWC 1H2PP 2YBYA 1MD7A 1G4GA 3OEDC 1GKNA 3IX0A 1OK2A 2RLQA 3M7PA 3ZD1A 2XRBA 4MUCA 3ZD2A 1H04P 1GHQB 2RKZA 3T5OA 5HYPA 2IZ3A 1TPMA 1SRZA 2G7IA 4WJG2 4A5WB 4PZ5A 3NFPI 1VVDA 4LOSA 2LOJA 2V8EA 1O9AA 3CALA 2JGXA 4J38B 2MCYA 1Q3XA 3IU3I 4F4OC 4ZH1D 4AYIA 5JPMG 2W80A 2RKYA 1CKLA 1HCCA 4C16A 2RL0A 1H03P 4AYEA 1HFHA 3SW0X 4LOTA 2MCZA 4CSYA 2CG7A 1LY2A 4KKDA 3ZRZA 4K12A 1E8BA 5I0QB 2WIIC 2O39C 4DJZA 3KZJA 1OJVA
chains in the Genus database with same CATH superfamily
3CI0J 5FO8C 1SS2A 1MD8A 4BWCA 1ZJKA 2JGWA 1GKGA 2EHFA 1TPNA 5HYTB 1QGBA 3O8EB 1OK3A 2BZMA 1GPZA 5HZPB 3ZLDA 3TVJA 3GXEA 2XWJI 1OK1A 4ONTD 4YNXA 4AYDA 1G4FA 3ERBA 2XWBF 3GOVA 3F6KA 3NJAA 4IGDA 1E5GA 2Y8RA 5HYUB 2W81A 4PO7A 2CG6A 3RJ3D 2KRIA 2A55A 1VVCA 2B5ID 2IZ4A 2KMSA 2XRDA 3INBC 2X2ZA 2JRAA 4B2RA 3R62A 1H2QP 1NWVA 1ELVA 1OK9A 2CKUA 4JHSA 2QY0A 2YRAA 3EJHA 1RLHA 3OP8A 1QO6A 2I2LA 2UWNA 1OJYA 3L89M 1HFIA 1PPQA 4B2SA 1Z92B 3FGRA 4FXGG 2Y8TA 3OXUD 2ZYCA 1UOTP 1C1ZA 1U5MA 3KXVA 1E88A 2RLPA 1OJWA 2ERJA 1QUBA 4AYMA 3WSXA 2EC3A 3MQLA 1FBRA 1TPGA 2XQWC 1H2PP 2YBYA 1MD7A 1G4GA 3OEDC 1GKNA 3IX0A 1OK2A 2RLQA 3M7PA 3ZD1A 2XRBA 4MUCA 3ZD2A 1H04P 1GHQB 2RKZA 3T5OA 5HYPA 3K3TA 2IZ3A 1TPMA 4N7EA 1SRZA 2G7IA 4WJG2 4A5WB 4APLA 4PZ5A 3NFPI 1VVDA 4LOSA 2LOJA 2V8EA 1O9AA 3CALA 2JGXA 3FGTA 4J38B 2MCYA 1Q3XA 3IU3I 4MSLA 4F4OC 4AYIA 4ZH1D 5JPMG 3WSYA 2W80A 2RKYA 1CKLA 1HCCA 5DN5A 4C16A 2RL0A 1H03P 4AYEA 1HFHA 3SW0X 4LOTA 2MCZA 3VWOA 2CG7A 1LY2A 4CSYA 4KKDA 2Y8SA 3ZRZA 4K12A 1E8BA 5DN4A 5I0QB 2WIIC 2O39C 4DJZA 3KZJA 4YIZA 3ZLEA 1OJVA
chains in the Genus database with same CATH topology
5FO8C 1SS2A 1MD8A 1ZJKA 2JGWA 1GKGA 2EHFA 1TPNA 5HYTB 1QGBA 3O8EB 1OK3A 2BZMA 1GPZA 5HZPB 3TVJA 3GXEA 2XWJI 1OK1A 4ONTD 4YNXA 4AYDA 1G4FA 3ERBA 2XWBF 3GOVA 4IGDA 1E5GA 5HYUB 2W81A 2CG6A 3RJ3D 2KRIA 2A55A 1VVCA 2B5ID 2IZ4A 2KMSA 2XRDA 3INBC 2JRAA 4B2RA 3R62A 1H2QP 1NWVA 1ELVA 1OK9A 2CKUA 4JHSA 2QY0A 2YRAA 3EJHA 3OP8A 1QO6A 2UWNA 1OJYA 3L89M 1HFIA 1PPQA 4B2SA 1Z92B 4FXGG 3OXUD 1UOTP 1C1ZA 1U5MA 3KXVA 1E88A 2RLPA 1OJWA 2ERJA 1QUBA 4AYMA 2EC3A 3MQLA 1FBRA 1TPGA 2XQWC 1H2PP 2YBYA 1MD7A 1G4GA 3OEDC 1GKNA 3IX0A 1OK2A 2RLQA 3M7PA 3ZD1A 2XRBA 4MUCA 3ZD2A 1H04P 1GHQB 2RKZA 3T5OA 5HYPA 2IZ3A 1TPMA 1SRZA 2G7IA 4WJG2 4A5WB 4PZ5A 3NFPI 1VVDA 4LOSA 2LOJA 2V8EA 1O9AA 3CALA 2JGXA 4J38B 2MCYA 1Q3XA 3IU3I 4F4OC 4ZH1D 4AYIA 5JPMG 2W80A 2RKYA 1CKLA 1HCCA 4C16A 2RL0A 1H03P 4AYEA 1HFHA 3SW0X 4LOTA 2MCZA 4CSYA 2CG7A 1LY2A 4KKDA 3ZRZA 4K12A 1E8BA 5I0QB 2WIIC 2O39C 4DJZA 3KZJA 1OJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FO8 C;  1SS2 A;  1MD8 A;  1ZJK A;  2JGW A;  1GKG A;  2EHF A;  1TPN A;  5HYT B;  1QGB A;  3O8E B;  1OK3 A;  2BZM A;  1GPZ A;  5HZP B;  3TVJ A;  3GXE A;  2XWJ I;  1OK1 A;  4ONT D;  4YNX A;  4AYD A;  1G4F A;  3ERB A;  2XWB F;  3GOV A;  4IGD A;  1E5G A;  5HYU B;  2W81 A;  2CG6 A;  3RJ3 D;  2KRI A;  2A55 A;  1VVC A;  2B5I D;  2IZ4 A;  2KMS A;  2XRD A;  3INB C;  2JRA A;  4B2R A;  3R62 A;  1H2Q P;  1NWV A;  1ELV A;  1OK9 A;  2CKU A;  4JHS A;  2QY0 A;  2YRA A;  3EJH A;  3OP8 A;  1QO6 A;  2UWN A;  1OJY A;  3L89 M;  1HFI A;  1PPQ A;  4B2S A;  1Z92 B;  4FXG G;  3OXU D;  1UOT P;  1C1Z A;  1U5M A;  3KXV A;  1E88 A;  2RLP A;  1OJW A;  2ERJ A;  1QUB A;  4AYM A;  2EC3 A;  3MQL A;  1FBR A;  1TPG A;  2XQW C;  1H2P P;  2YBY A;  1MD7 A;  1G4G A;  3OED C;  1GKN A;  3IX0 A;  1OK2 A;  2RLQ A;  3M7P A;  3ZD1 A;  2XRB A;  4MUC A;  3ZD2 A;  1H04 P;  1GHQ B;  2RKZ A;  3T5O A;  5HYP A;  2IZ3 A;  1TPM A;  1SRZ A;  2G7I A;  4WJG 2;  4A5W B;  4PZ5 A;  3NFP I;  1VVD A;  4LOS A;  2LOJ A;  2V8E A;  1O9A A;  3CAL A;  2JGX A;  4J38 B;  2MCY A;  1Q3X A;  3IU3 I;  4F4O C;  4ZH1 D;  4AYI A;  5JPM G;  2W80 A;  2RKY A;  1CKL A;  1HCC A;  4C16 A;  2RL0 A;  1H03 P;  4AYE A;  1HFH A;  3SW0 X;  4LOT A;  2MCZ A;  4CSY A;  2CG7 A;  1LY2 A;  4KKD A;  3ZRZ A;  4K12 A;  1E8B A;  5I0Q B;  2WII C;  2O39 C;  4DJZ A;  3KZJ A;  1OJV A; 
#chains in the Genus database with same CATH topology
 3CI0 J;  5FO8 C;  1SS2 A;  1MD8 A;  4BWC A;  1ZJK A;  2JGW A;  1GKG A;  2EHF A;  1TPN A;  5HYT B;  1QGB A;  3O8E B;  1OK3 A;  2BZM A;  1GPZ A;  5HZP B;  3ZLD A;  3TVJ A;  3GXE A;  2XWJ I;  1OK1 A;  4ONT D;  4YNX A;  4AYD A;  1G4F A;  3ERB A;  2XWB F;  3GOV A;  3F6K A;  3NJA A;  4IGD A;  1E5G A;  2Y8R A;  5HYU B;  2W81 A;  4PO7 A;  2CG6 A;  3RJ3 D;  2KRI A;  2A55 A;  1VVC A;  2B5I D;  2IZ4 A;  2KMS A;  2XRD A;  3INB C;  2X2Z A;  2JRA A;  4B2R A;  3R62 A;  1H2Q P;  1NWV A;  1ELV A;  1OK9 A;  2CKU A;  4JHS A;  2QY0 A;  2YRA A;  3EJH A;  1RLH A;  3OP8 A;  1QO6 A;  2I2L A;  2UWN A;  1OJY A;  3L89 M;  1HFI A;  1PPQ A;  4B2S A;  1Z92 B;  3FGR A;  4FXG G;  2Y8T A;  3OXU D;  2ZYC A;  1UOT P;  1C1Z A;  1U5M A;  3KXV A;  1E88 A;  2RLP A;  1OJW A;  2ERJ A;  1QUB A;  4AYM A;  3WSX A;  2EC3 A;  3MQL A;  1FBR A;  1TPG A;  2XQW C;  1H2P P;  2YBY A;  1MD7 A;  1G4G A;  3OED C;  1GKN A;  3IX0 A;  1OK2 A;  2RLQ A;  3M7P A;  3ZD1 A;  2XRB A;  4MUC A;  3ZD2 A;  1H04 P;  1GHQ B;  2RKZ A;  3T5O A;  5HYP A;  3K3T A;  2IZ3 A;  1TPM A;  4N7E A;  1SRZ A;  2G7I A;  4WJG 2;  4A5W B;  4APL A;  4PZ5 A;  3NFP I;  1VVD A;  4LOS A;  2LOJ A;  2V8E A;  1O9A A;  3CAL A;  2JGX A;  3FGT A;  4J38 B;  2MCY A;  1Q3X A;  3IU3 I;  4MSL A;  4F4O C;  4AYI A;  4ZH1 D;  5JPM G;  3WSY A;  2W80 A;  2RKY A;  1CKL A;  1HCC A;  5DN5 A;  4C16 A;  2RL0 A;  1H03 P;  4AYE A;  1HFH A;  3SW0 X;  4LOT A;  2MCZ A;  3VWO A;  2CG7 A;  1LY2 A;  4CSY A;  4KKD A;  2Y8S A;  3ZRZ A;  4K12 A;  1E8B A;  5DN4 A;  5I0Q B;  2WII C;  2O39 C;  4DJZ A;  3KZJ A;  4YIZ A;  3ZLE A;  1OJV A; 
#chains in the Genus database with same CATH homology
 5FO8 C;  1SS2 A;  1MD8 A;  1ZJK A;  2JGW A;  1GKG A;  2EHF A;  1TPN A;  5HYT B;  1QGB A;  3O8E B;  1OK3 A;  2BZM A;  1GPZ A;  5HZP B;  3TVJ A;  3GXE A;  2XWJ I;  1OK1 A;  4ONT D;  4YNX A;  4AYD A;  1G4F A;  3ERB A;  2XWB F;  3GOV A;  4IGD A;  1E5G A;  5HYU B;  2W81 A;  2CG6 A;  3RJ3 D;  2KRI A;  2A55 A;  1VVC A;  2B5I D;  2IZ4 A;  2KMS A;  2XRD A;  3INB C;  2JRA A;  4B2R A;  3R62 A;  1H2Q P;  1NWV A;  1ELV A;  1OK9 A;  2CKU A;  4JHS A;  2QY0 A;  2YRA A;  3EJH A;  3OP8 A;  1QO6 A;  2UWN A;  1OJY A;  3L89 M;  1HFI A;  1PPQ A;  4B2S A;  1Z92 B;  4FXG G;  3OXU D;  1UOT P;  1C1Z A;  1U5M A;  3KXV A;  1E88 A;  2RLP A;  1OJW A;  2ERJ A;  1QUB A;  4AYM A;  2EC3 A;  3MQL A;  1FBR A;  1TPG A;  2XQW C;  1H2P P;  2YBY A;  1MD7 A;  1G4G A;  3OED C;  1GKN A;  3IX0 A;  1OK2 A;  2RLQ A;  3M7P A;  3ZD1 A;  2XRB A;  4MUC A;  3ZD2 A;  1H04 P;  1GHQ B;  2RKZ A;  3T5O A;  5HYP A;  2IZ3 A;  1TPM A;  1SRZ A;  2G7I A;  4WJG 2;  4A5W B;  4PZ5 A;  3NFP I;  1VVD A;  4LOS A;  2LOJ A;  2V8E A;  1O9A A;  3CAL A;  2JGX A;  4J38 B;  2MCY A;  1Q3X A;  3IU3 I;  4F4O C;  4ZH1 D;  4AYI A;  5JPM G;  2W80 A;  2RKY A;  1CKL A;  1HCC A;  4C16 A;  2RL0 A;  1H03 P;  4AYE A;  1HFH A;  3SW0 X;  4LOT A;  2MCZ A;  4CSY A;  2CG7 A;  1LY2 A;  4KKD A;  3ZRZ A;  4K12 A;  1E8B A;  5I0Q B;  2WII C;  2O39 C;  4DJZ A;  3KZJ A;  1OJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...