4LOSA

C1s cub2-ccp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
187
structure length
187
Chain Sequence
GVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1s subcomponent heavy chain
publication title Structural basis of the C1q/C1s interaction and its central role in assembly of the C1 complex of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 37
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.42: Complement subcomponent C1s.
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4losA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 4losA01
2B5ID 1PPQA 2EC3A 3KZJA 3POJA 4CSYA 2QQMA 4F4OC 1LY2A 3ZD1A 5HYUB 1E88A 3T5OA 1OJWA 2V8EA 4YNXA 4LORA 2UWNA 1H04P 3L89M 1HCCA 2XQWC 3O8EB 2QQOA 1O9AA 1VVCA 2RLQA 1QO6A 4DJZA 1MD8A 2QQKA 3IU3I 4A5WB 4FXGG 5JPMG 2JGWA 1H2PP 3ZD2A 3EJHA 1NZIA 3POFA 2XRBA 1E5GA 1SRZA 3IX0A 2W80A 2MCZA 3KQ4B 1OK9A 2O39C 1VVDA 2WIIC 1GKGA 2YBYA 5CKNA 5CISA 1OJYA 3POGA 1SPPB 3POBA 5FO8C 5CKQA 1C1ZA 3TVJA 2LOJA 1GPZA 1OK2A 1TPGA 2QQLA 1ZJKA 2KRIA 2BZMA 1TPMA 1NWVA 3POIA 3CALA 3RJ3D 5HZPB 4AYIA 1H2QP 1HFIA 4WJG2 1SS2A 2JGXA 1OJVA 2G7IA 3MQLA 5I0QB 4KKDA 4MUCA 2RLPA 5CKMA 4K12A 1QUBA 4ZH1D 1QGBA 2JRAA 4J38B 3NFPI 2QY0A 2YRAA 1E8BA 1MD7A 2XRDA 4PZ5A 4LOTA 4B2RA 2WNOA 3POEA 4IGDA 1U5MA 1SFPA 1CKLA 4GZ9A 4AYMA 4ONTD 1H03P 1OK1A 2ERJA 2KMSA 3GXEA 4AYDA 1GHQB 2EHFA 1UOTP 2A55A 4LOSA 1SZBA 1GKNA 1ELVA 3KXVA 4JHSA 2RL0A 3OEDC 2IZ4A 1NT0A 5HYTB 2CG6A 4LMFA 3R62A 1Z92B 2IZ3A 1SPPA 1G4GA 3DEMA 3OXUD 3M7PA 1G4FA 2XWBF 2RKZA 3ZRZA 3INBC 3SW0X 2CKUA 1HFHA 3ERBA 5HYPA 1Q3XA 4C16A 2W81A 1TPNA 2RKYA 4B2SA 4AYEA 2CG7A 1OK3A 2MCYA 3OP8A 2XWJI 1FBRA 3GOVA
chains in the Genus database with same CATH superfamily
3ZKYA 2GNDA 4CDWC 3IAPA 1Z7S1 4HXCA 4B7KA 1V6NA 4H55A 2P2KA 1Q8VA 5K7PA 4RR3B 3I54A 2Z4FA 3BTAA 4QHBA 1LY2A 1DYOA 1DZQA 4GB32 5AVPA 4C8DA 5CA6A 4D8MA 3RZHA 2ATFA 1BBT2 3HT1A 5F5CA 2RJ2A 1UXZA 4GA9A 3O0WA 2J1RA 1LHOA 4UBGA 4QX8A 3THDA 4C1WA 1VPHA 3JBG3 3KV4A 1JN2P 1R1A3 2AACA 2QQIA 3VBRA 3BU0A 2F4PA 1REFA 4ASKA 4R9DA 5C9AA 3ON7A 5EYXA 3WR0A 5LK7B 4YZ5A 1L7LA 3E6BA 3OSDA 4Y1YA 3GCWA 1RC6A 3LDBA 3H50A 5GKAC 4UT5A 3VZNA 3ZFEA 4Q8KA 4Z8BA 4YGEA 5J96B 1US3A 1X9PA 3IZOA 4EROA 1W6MA 3PVNA 4YM2A 4GWIA 4BK5A 3JBG2 3WSOA 2D98A 1UCXA 3VZMA 1R1A2 5C4WC 1HB2A 5FZ0A 2ZTNA 1OHFA 5A6QA 2E32A 4AK3A 1CONA 4YVWC 4XIOA 3EYPA 3FUQA 4YM0A 4YG3A 1OJYA 1Z7S3 3KD4A 1H1AA 4JGYB 1SLTA 2JG8B 4XF1A 4XUPA 3UYJA 3DXUA 2R043 1CX4A 1PO21 4YVSB 2ERFA 3U4XA 1B09A 5DG2A 4LO5B 4FSJA 3OPTA 5LEKA 1ULEA 3ZLDA 4FPYA 1YQ6A 1NKGA 4W6YA 5KXBA 4QB2A 3FFQA 4BXFA 1APNA 3WQ0A 4MZUA 4NJ4A 4QQ2A 3AJYA 5L73A 3OTFA 2R042 2IXCA 4ZY9A 1UYPA 4EV0A 4E4DX 3FLTA 2BVVA 3HR9A 1XJAA 2GMPA 2B4KA 2W68A 3I49A 4YLZA 1R092 5KC6A 4DRRA 1UQXA 1CJPA 1QGBA 1QJY3 2UU8A 3FJSA 3GBFA 5F6KA 5AVAA 3VBRC 4XUTA 2PHRA 1RINA 5C9AC 1MS0A 4P5YA 3VLBB 4QGLA 2J1VA 4XOGA 4RFT0 2Y6GA 3RI8A 4MGQA 1S0GA 4DUVA 1CGPA 3ZFEC 1YFUA 5IVJA 3C7HA 2RM21 1UZ0A 4GZ9A 4YM1A 3VB9A 5C3SA 1E5SA 5GLUA 2O1QA 5JXJA 5JAXA 3P3NA 4JQTA 2OA2A 1QJY2 1I5PA 3ZVXA 4BYYA 4DY3A 2QQPA 2C5DA 2Z5WA 1WUVA 4IDZA 1DZRA 2DVGA 4N8MA 2ZGUA 4CPBA 3H7YA 3J26N 5T5OA 5LATA 4AFDA 2J1SA 3BOPA 3UJOA 1G4GA 1DQ1A 3LDKA 1LESA 1N47A 2KD7A 1BVVA 4EZHA 3BIEA 2VNVA 4KGQA 4QQPA 1VRH1 5FO9B 2XUEA 3SCHA 2HBTA 2BYVE 2PHWA 3SISA 5JSRA 2LW8A 3WNKA 3WP5A 2VQTA 1W06A 3SH3A 3GYDA 1W8OA 2W1WA 5JIAA 3LWCA 2B5ID 1PPQA 2ORXA 2UWAA 1S55A 2RM23 3ZO0B 3HNYM 4R4ZA 2CHHA 3PUHA 4BCUA 3VL9A 2MEV2 5A3WA 2YBSA 1WD4A 4AHXA 4J6GA 4E4HA 1WCQA 4CCOA 3S0MA 3H3LA 3HQRA 4META 5IK4A 1O5UA 4FOWA 1SBEA 5GLTA 4D7YA 4LLFA 1MZEA 4PO7A 1W8UA 3RMYA 3GGLA 1GNZA 1PZ8A 4CVUA 2RM22 2WYFA 5D21A 1SDWA 1JYWA 3O8EB 4GQ7A 1D2QA 4JHTA 3Q8AA 3ZSKA 3KM5A 2ZKNA 1F35A 5C5TA 4UFLA 4J1XA 3DYPA 2JEMA 3T08A 1IS6A 2B39A 3AP4A 1LJ7A 3F95A 5FYVA 3ZFGA 3ZD2A 2H6CA 1KD7A 2BOJA 5EWSA 5LBBA 1CESA 1RHI1 2FCUA 3CLPA 1LGBA 5G05L 4AI8A 2BJSA 4DOUA 2A71A 3BOWA 2VZOA 4DEVA 4Q4V3 1E57A 5GM0A 3P5BA 2Z79A 1GANA 4AHWA 2ZMNA 4TLFA 2RVAA 4IERA 2GN3A 1SACA 3AZXA 2AUYA 2BBVA 2HYXA 3J4UH 2BU9A 5JMCA 2P3IA 4Z92B 3NNFA 4B4RA 3BN6A 4Q4V2 3N9MA 3WX5A 2QQLA 4XCBA 3LE0A 3WDUA 5FO8B 1OUSA 1WMFA 2H6BA 2OUJA 5A3MA 5DMYA 3TN93 3THTA 3KF3A 2W52A 4XBQA 5FP9A 1VBE1 1OJVA 1C4RA 5JOZA 2E6VA 4CU7A 4XUOA 5EXOA 2ZXQA 1CJDA 2C6SA 2RHPA 2WR9A 1AYN3 3KZ4C 2NP0A 3MZHA 2XONA 1H9PA 4XYXA 4E8DA 2B46X 4LBQB 1RHI3 3OGVA 3ZSEA 2YUEA 5IVFA 1TE1B 4Q4Y2 4AVBA 3WD5A 3E6CC 3TN92 3N7KA 1JZ2A 1MD7A 2R49A 4DMIA 3PVBB 1LHVA 4B2RA 1CIWA 2UWBA 1PM4A 3NNLA 4YFZA 2ZGMA 4HG6B 3ZKUA 1SLIA 1ND3B 2A3YA 3MW4A 3ZFGC 1AYN2 1H8TB 2XVKA 4BIFA 1UZYA 1UOBA 3BIWE 2RJKA 2GC1A 1RHI2 2XBO1 4NIAA 3H3ZA 3WF3A 1FOD2 2D5FA 2UWCA 4P14A 3ME2A 3OEDC 5SV8A 1AYM1 4CDUA 1NT0A 4XAEA 4TLGA 4H7LA 2CG6A 4XE9A 2CSGA 2QZ2A 5FYUA 3UKNA 1Z92B 1ODMA 1WMDA 2PQQA 2EAAA 2Z42A 3D5OA 1F5FA 3GHMA 4PJYA 4V1PA 3VBOA 5GLVA 4A42A 3RMXA 2B5HA 3LSEA 4Q5OA 3UL2A 5DQ0A 2X05A 3S7EA 1EAH1 1GSLA 5HYPA 4AR2A 5BV6A 1Q3XA 3AZVA 4IV1A 2YPJA 3H1MA 1VALA 4AOCA 5JR2A 3MF6A 3N4MA 2JICA 3O5SA 2JE8A 4PLMA 1OK3A 4HN1A 2WJSA 5CFCA 2O0OA 1SLAA 2GNMA 4IE6A 4C90A 2WAAA 2WQ4A 1V70A 3HQUA 1EP0A 1IKPA 1ZBA3 5IATA 2PQSA 4W6XA 1AVBA 1YO8A 5FP3A 4H7MA 3O1RA 1UMIA 3GNEA 4OVEA 4ES8A 1O3SA 4B7EA 4BMBA 5LBEA 1OJWA 3DPRB 1UZZA 2VQUA 4XBNA 3HMYA 1UU6A 2YB7A 3TB0A 4N9IA 3J7HA 1AL0G 1BCXA 1S0DA 1ZBA2 2YFUA 4QGNA 3TYJA 2QQOA 4I30A 2YROA 2OT7A 1N1VA 1BVP1 3RQ0A 5FPLA 1KS4A 2QQKA 2WFPA 3DXTA 3H9AA 4DUXA 3N7LA 1EAH3 4XTPA 1N3QA 2WT2A 5APAA 1GICA 5FXVA 4OUEA 4AGRA 1OLQA 3IDAA 1POQA 2XRBA 1CZSA 1E5GA 1V6KA 2HWB1 1WLDA 2IUWA 4ZXEA 5IVYA 4FXGB 1CAVB 2RS31 4BQXA 2XJUA 5T54A 2MCZA 4HK8A 1DZTA 3VBOC 1W0PA 3ENRA 3LAGA 4IXLA 4TWTA 4M3CA 1JS9A 3I59B 2R30A 4NIIA 1NLSA 3DYOA 3O1MA 2P1BA 4FTBA 2XPJA 5FZ4A 5C33A 1W03A 2CGOA 5CFCC 3CJXA 4XIKA 3I3BA 3IDEA 2V4VA 1HQLA 2ZX2A 3UNPA 1RUNA 2CV6A 1AR61 1RUJ3 1FT9A 1YCIA 4LBQD 3AFKA 5ACA1 3VZKA 5FMOL 2CDOA 2BGOA 1SMVA 4CU6A 1YRZA 3S5QA 4CEYC 5IVBA 4AQ6A 5I0QB 4EYUA 3O14A 2XQXA 5C8CC 1V6JA 4P9XA 1MPXA 2AGSA 3AYCA 4PF5A 3DN7A 4K12A 4B4PA 1S1AA 1RUJ2 4NIDA 3I2HA 1K45A 4L8QA 4PZ5A 3KSCA 4L0PA 4LOTA 5IK7A 4IGDA 3K46A 4URAA 2IXHA 2V5DA 4GWMA 4CP9B 2HEYF 1W6PA 2KMSA 1CAXA 3W59A 5F1RA 2LALA 4Q29A 3NSTA 5JR7B 3WG2A 3RZZA 4IE5A 1LHUA 5F9TA 1HB1A 1K5MA 3BKZA 1GKNA 1NY72 2XHKA 1QNYA 2VW0A 2YU2A 3UGHA 3HNMA 3UETA 1IGOA 4XEZA 2JJ6A 5C71A 5GLWA 1I1EA 5A33A 2RE9A 4A7ZA 2A6VA 4Q26A 5J09A 1PZ9A 1AR63 2G4IA 5JXGA 4I0AA 3ZSMA 4CDQA 3OXUD 1LOCA 2VZUA 2Q0AA 3SLIA 1GUIA 3ZXKA 4MYEA 4CXWA 5ACA3 3V0AB 2AREA 1NCRB 1D7PM 2ZABA 3AZZA 4LIUA 4XCAA 1KJLA 1HB4A 3PHMA 5FYMA 3HJRA 1OFSA 1HV1A 4BISA 2ADDA 2X5IA 4GH4A 5F2SA 3N9PA 3ZN4A 4FAGA 1JHJA 4C91A 3VBHB 4NO4A 4CEWB 3WG4A 4XDOA 1LAJA 1GP5A 3DF0A 1AR62 1YQ2A 1N1YA 1QF3A 2J1AA 1D4M1 2EXJA 1W8NA 1OLMA 3GCXA 5ACA2 1GLHA 1GQHA 2BGPA 2CTVA 3GZTB 4OFGA 1PVXA 3AKQA 4XF3A 2OX0A 2WNUA 1BEV2 2RV9A 2QFEA 4CDXA 3CJIB 4XJWA 3VWOA 2Q1FA 3OF1A 4P9IA 2JDUA 3IBMA 5FMCA 4OHVA 3NAPB 3ZIXA 1X36A 3APBA 3SHRA 5FJHA 5FZAA 4OZOA 4LO8A 1IQAA 3VDDA 5ABJB 2ET7A 1UU5A 1W6NA 4P08A 2ZHLA 3GBWA 3T0DA 1BMV1 4N90A 5F39A 1G9DA 4K1ZA 4KG8A 3KV6A 3FX3A 3QH6A 3WNNA 3OUHA 5A3OA 3ZR5A 2W9XA 4AFAA 4QXKA 1WD3A 1RL3A 2FDHA 3OUIA 2WA3A 2Y6FA 4QU1A 4XFIA 4M3CE 4XPVA 2EF6A 1UY3A 4HONA 3MLLA 4OI4A 2HBUA 1Q43A 3PUQA 5LY1A 1HRI1 4MG2A 3E1F1 3OEBA 4O61A 5FK7A 4Y5Z0 2J1EA 2W92A 4GAZA 4WZCA 3N7MA 1QXRA 5IYYA 5JPMB 3KGLA 1DQ4A 1D4M3 4NRMA 2CGPA 3OYWA 2VE1A 1YIFA 3WINE 2AH2A 3D0JA 2PAKA 4WVMA 1CVNA 2X5IC 1RUC1 3T1LA 2ET1A 4XJZA 4COZA 1SPPB 2ZX1A 1W9WA 2XDVA 4BE3A 1W6QA 1JZ3A 1W28A 2X29A 3U37A 1RUOA 4MSVA 2XMLA 1D4M2 1PNGA 4FFHA 3I4IA 2FMYA 5DAWA 5A7WB 5A3UA 2JDNA 3POIA 2VOWA 3POYA 4RR3A 4A7KA 1LOFA 4JKKA 5TSWA 3CO2A 3CZJA 2G9GA 1UY4A 2YC4A 3LDRA 1LENA 3AMPA 4P9LA 3IAQA 2ZZJA 1E5HA 4HZFA 5E89A 1BMV2 3MF9A 5CNAA 5LB6A 4LO4B 4Y4YA 2YG0A 2F6BA 4MH0E 5FZBA 5HV4A 2ZX3A 2VGDA 4K20A 1PMIA 3PIJA 3MIBA 3THPA 3HN1A 4YW3A 1XE8A 1AL23 1H8VA 1MEC2 3BGAA 3AKSA 5FZIA 4DIQA 5EYYA 3K4AA 4JGZC 3VHPA 5CU1A 3ZN6B 1Q8QA 1YJLA 3LZZA 4OI0A 5H9SA 2RDSA 2WO1A 4HKOA 5BNPB 4Y4RA 1W2AX 4LEJA 3KMHA 4KG0A 2J42A 5EJ3A 3S6PA 3LA2A 4JGYA 1QHDA 4JCKA 1OF4A 2IZ3A 1AL22 1YC61 3RYPA 2ZGRA 1X9TA 1RMU3 1ONAA 4YVSA 3ZDSA 4LT5A 2Q8DA 3INBC 3SW0X 4JAAA 5FYYA 2A7AA 3QBQA 2Y6JA 3JD71 3LB9A 3K3NA 3LD8A 4KU8A 1B35A 1ZM1A 2E26A 1CAWB 2Y26A 3CZUA 4N7EA 2R071 4QQOA 5FCCA 1CQ9A 1DQ6A 4RR3C 2JDKA 2C0ZA 1RMU2 2P3KA 1Y9GA 1IPJA 5FY7A 1V9U1 1ENQA 2W95A 3KT1A 1OKOA 3NO8A 2KM2A 4LKDA 4Y1ZA 4Y1VA 4K3UA 2VUCA 1OURA 5A6XA 5GZCA 2HWC1 1NA1B 1N1SA 2DCYA 5FY8A 5FMDA 4EWDA 1OLRA 5L19A 1XSRA 3KLSA 2BZDA 4RGGA 4QD2A 3MGUA 3WDTA 2V8EA 1K12A 1Y3TA 3WP6A 1RUF2 1QJU1 1WMEA 3K2OA 1IQDC 2WN3A 4W50A 1UX6A 2B42B 3H0OA 1HCCA 4YW4A 3WY6A 2HLEA 4LO6B 4NPLA 1QEXA 3B93A 2A6XA 2V73A 2CAUA 2VM9A 4XFCA 3VDAA 1VVCA 1YJKA 2B9VA 1Y7BA 1SLCA 2FCTA 3T4VA 4QHZA 4DEQA 5FZEA 5IFTA 1REEA 4XAAA 4MUVA 3AL5A 2W08A 3WEZA 4ITCA 3JD73 1RVF3 4BWOA 4EJRA 2CL2A 1S2BA 1DGRN 5BNOB 1KGYA 3MIFA 3OGGA 5BNNA 4EN6B 4JGYC 3M3EA 1R1ZA 1TQ5A 4LTAA 2JG8C 5A7OA 5L36A 3DGTA 1XNBA 2Y6LA 2HWD3 5HCFA 3URFA 1GNYA 4GMP3 1PGW2 1PNFA 2FMDA 1V9U3 2G9FA 2RDQA 3KT4A 4YVSC 1AR71 1TZOA 3RVHA 2V5YA 5CBLA 4X8PA 3HOBA 3POGA 1N3PA 3KB5A 5F32A 3JD72 1RVF2 2HWC3 2WZPP 3ZYFA 1R64A 4HOOA 4NPRA 3ZSJA 2IVIB 3ACLA 1IG3A 2A70A 4MV2A 1VJ2A 1AF9A 2ZJCA 1ZZ6A 2HWD2 3H3UA 1V9U2 3NV4A 3PVOA 3M1HA 1YUDA 1NYWA 4NN0A 3H8XA 1H4GA 1QNWA 2BZMA 2I2SA 1NWVA 2VMIA 4NAMA 4PLNA 2VW1A 3V56A 5JLVA 1XE0A 3ZN5A 5HZPB 2HWC2 5B2GB 4MSLA 3K48A 3DKWA 5A6ZA 1COV1 1TVGA 2JGXA 5CG9A 4OI2A 4AEKA 4QWNA 5LK5A 3CL1A 5DUVA 5FZDA 3RSJA 2OXBA 3FWEA 5HBAA 3VKLA 3G7DA 3UESA 3A23A 4XUQA 2XVGA 2OZ6A 2VU9A 1LRHA 3HQXA 2QY0A 1UY2A 2JB8A 1E5IA 2VCMA 1WA4A 3NJVA 1HW5A 4L99A 3FN9A 5AC93 5J1XA 2PHUA 2WL1A 5E6HA 5FY5A 4HSJA 4ZHNA 1AR73 4KH9A 3KGZA 5SV5A 4BB3A 3G6JB 3I8TA 2QVSB 3I3EA 4UBHA 4A2UA 1UNBA 2JDPA 4JV4A 3PUAA 3VHNA 2YGMA 3MFCA 2JDAA 4X6QB 2ZEWA 1H0BA 1UOTP 1WCSA 4QPGB 5FZHA 3FLRA 5FZKA 1LU1A 1Q8PA 2XG3A 1UW8A 3Q8BA 1V0AA 2DBIA 2JIJA 3L2HA 1DGWA 5AC92 3D82A 4FAHA 2AENA 4Q4X1 1V6LA 2VOKA 4GALA 3ES4A 4CDWA 5DAQA 1MS3A 3DEMA 2XUMA 1UAIA 4GXLA 5CZKA 1COV3 3R4SA 2ZHNA 4E2GA 5IT6A 1OD5A 2TEPA 1W6OB 2P6CA 4KWKA 5FZ7A 4ONUA 5IJRA 3ZYIB 2V72A 1OSGA 1WCKA 4NHXA 1JYVA 4TN7A 2CG7A 2MCYA 1GWLA 3CIHA 4K6BA 4LHLA 4LKSA 4Y22B 3M3IA 5CVRA 3W5MA 1COV2 1JU3A 2A6YA 1FYUA 3C7OA 5IAVA 5A32B 4V2WA 4L9BA 4LBQA 1FV2A 2VTFA 3LOIA 1W9SA 3NV2A 3VD4A 5HYUB 5C4WA 4E4SA 2J1TA 4LJHA 1ASJ2 1MS5A 1H2KA 1YQ5A 1H6XA 3DCQA 3LA3A 1H6YA 3FBMA 2YY1A 4DXSA 1L7QA 1HJFA 4HLTA 1H8TA 4MGSA 1NG0A 4Q4W3 4FPOB 1QJEA 5JSPA 3VD5A 3AZWA 1MD8A 3RWNA 3B94A 1JOJA 4GULA 3WNMA 3BTZA 2Z69A 2CU5A 3DYMA 3POFA 1JODA 1WGPA 5KHGA 1AR91 3T4HB 2ZKLA 1O3TA 3PJQA 2RJLA 1QKQA 1W9FA 5HCAA 4Q4W2 3NKTA 2ZPXA 4IW3A 5JXIA 5KR7A 1QDOA 1QDCA 1LULA 3VD3A 3POWA 2HKXA 2Q8OA 1WLCA 4KWUA 3VDBA 1DLLA 5C5UA 5EV7A 5CEHA 2XKOA 3I2OA 1CAUB 5EIYB 5FO8C 3ORJA 2W87A 2D3RA 2PLV1 3A22A 2ID4A 5FZ8A 4GMP0 4LE3A 3ZPYA 4OLLA 1TPGA 2XGXA 2A3XA 4LITA 1UN1A 4QX0A 3LA7A 3WQ1A 3ACGA 1YI7A 2VBDA 5E8AA 4AYIA 3ZYBA 1DQ5A 2FQPA 5J36A 3PLQA 2ZHMA 4QX3A 4ZZ8A 3DPRA 1JTZX 1W39A 3PU3A 2YMZA 3O0XA 1VB2A 1PK6B 4IE7A 3P1IA 5A70A 2QCSB 4OUMA 5CFDB 2KXLA 3JZVA 1H8TC 3NFPI 1NCQB 4QQLA 3VBFB 3VDCA 3A0KA 3QLQA 2NQYA 5FUIA 4FQZA 2XWJB 4QU2A 1QJX1 2PN5A 1CD3G 3V65A 3PTRB 3I2FA 2JKXA 4JDOA 1W05A 2VOXA 1GYKA 3VZOA 1KEXA 1P8JA 1CAVA 5F5AA 1AR81 4YZ1A 1KFUL 1WA6X 5FY0A 1ZBE1 4RFRB 2E63A 1Z7S2 4JDMA 2FD8A 4JHSA 3WNLA 4NHKA 2BPA2 3WSXA 3MYXA 4WZFA 3I59A 1XNTA 3ZPOA 2XVLA 2ZAHA 2OUHA 4BK4A 5JI9A 1AX1A 1XPWA 3FHQA 3HBZA 2W39A 1URXA 2R0FA 1W9TA 5FZMA 4Q8LA 2JDHA 1AJKA 1QH7A 3LQCA 1CIYA 2QQUA 3F2ZA 4XILA 3KS7A 1MQTB 4YW7A 2X53S 3P6BA 5EZWA 5L7OA 4C16A 4QX2A 4Y20B 2ENRA 1UYYA 4R52A 3GZUC 3WF2A 1TPNA 2RKYA 3HBKA 4YARA 2FHRA 3QH7A 3T1MA 5DN5A 3WSYA 3PTYA 1QIQA 4M01A 2Y0IA 4N7UA 4OUSA 1XXNA 2EC3A 1WMXA 3DPRC 4LUMA 3KZJA 3POJA 1PO23 1V6IA 3TBDA 2DVAA 4DRVA 3HT2A 4CSYA 4D94A 1UZWA 2D93A 2WS91 4EWEA 2QJVA 4F4OC 3BODA 4BQ5A 2ETEA 3K3OA 1AR83 2UYAA 2YXSA 3NNGA 4K9SA 2WA4A 3OD4A 2GH2A 2QDRA 1J3QA 4LNVA 1S4CA 1JI6A 1U5XA 3JQXA 4EN8B 4P9YA 5H9RA 3I97A 1QJFA 1PO22 3HD8B 4IE0A 3WG1A 1UKRA 1GBGA 2W1QA 1A34A 1VLNA 1Y43B 2RDNA 2XWBB 5B4XA 1US2A 2GALA 4MHUA 1IOAA 4AW7A 4OULA 4QB1A 2O8OA 3B9IA 3ZIWA 1H2PP 2Y0OA 3IWZA 3EJHA 2JDMA 2ZEZA 3M7AA 2HWF1 4FCAA 4PI2A 4QPWA 4W6WA 2CAVA 5DUWA 5IW0A 4AFCA 3LOBA 3T30A 5A7NA 1F4HA 4XABA 2UYBA 5C3QA 2WKKA 3AMHA 4J1WA 2BBAA 3HN3A 3VBSB 4PF1A 4UOJA 3IMMA 1MVEA 2AEYA 5DG1A 3H8OA 1O5LA 3VBHA 1RYYA 2JECA 4CEWA 4JDNA 5FMBA 5FP4A 5J98B 2W5FA 3AM2A 3POBA 4DFSA 2FBEA 2YDEA 4MXWA 1WW4A 3H42B 3BALA 1IS3A 5LA0A 2ZS6B 4O7XA 1C8M1 1QU0A 1VAKA 2SLIA 3OY8A 1ST8A 5FPXA 3CJIA 1YWKA 4LULA 1SBDA 1VRH3 2TNFA 1CN1A 3GJBA 3R0RA 5D8AB 1IS4A 2VH9A 4LR4A 1GR3A 1ENSA 1SFYA 5FZGA 1SG3A 1PO11 2FDJA 4ZZ5A 5ABJA 3ZOIA 4XETA 2EICA 2VNRA 4CCCA 1YHFA 4HKWA 4BH9A 5IWFA 1PMHX 1J58A 2HWF3 4C1XA 1D4VB 1C3HA 1MS4A 2XJTA 1VRH2 2DCZA 2W3JA 2O14A 2WSUA 4ZS3A 3SCGA 4BOWA 3OGSA 4CXXA 2VULA 3LEIA 1T6BX 1CKLA 4AWDA 3RRDA 2W2IA 3Q8EA 4FPGA 3HNBM 2VG9A 3CKHA 2HWF2 1JU4A 2ZAAA 4FVVA 3IT8A 2E7TA 2JD9A 4EN9B 4BQYA 1C5HA 1NCRC 3AMMA 4UFMA 2J7MA 1Z78A 1C8M3 1DGWX 4W8JA 3C7EA 1NOVA 2O8QA 4ZU4A 3M3CA 4WBBA 1SPPA 2DF7A 4K7JA 3VBHC 2VXRA 4CEWC 4TXWA 1ZYBA 5I0UA 1OVPA 1PO13 1UZVA 1X8MA 2GDFA 4AQTA 2VOVA 2CKUA 4JKMA 1D0HA 1W0NA 1R081 4COYA 3GALA 2I07B 2VW2A 5EPAA 4QDQA 5BUVA 1KS5A 4FPFA 1STMA 2DTYA 3CJIC 5CYYA 3O1UA 4B2SA 3BVCA 4H2AA 1LHWA 3N9QA 4EZ4A 5KHKA 3D4KA 1WW5A 4BDVB 3NAPC 5LCWL 5ABJC 5FLHA 1O4TA 5FPVA 3I7DA 3ZXAC 4YZ3A 2WO7A 4NRQA 2YZ4A 1F2NA 5B4NA 4A41A 2Q8EA 3T5OA 4DY5A 4COWA 2E7QA 2Q1MA 5D1IA 2QQWA 1JOBA 5IUQA 2VVFA 3WF0A 5JZGB 1VBE3 3RJ2X 2FZ2A 1OH4A 3OBAA 5FLIA 1DCSA 3I2IA 4S2HA 4COVA 2Y6KA 1W8ZA 4W65A 1WCDJ 3E97A 4RN5A 1EV11 4DZGA 1J1LA 1R083 5BPXA 3WXPA 1NLQA 1DU3D 4QXHA 3ZMOA 1VBE2 2RDRA 5F7UA 2D6NA 3IX0A 5FKBA 2QBXA 2IFRA 1OH3A 3U75A 3VN4A 1E5RA 4DPNA 4YZ4A 4CEYA 3PNAA 2XBO3 2YBYA 3SCFA 5FJKA 1DIWA 3NW4A 1GZ9A 5C8CA 1AYM3 1R082 4R9AA 1XRUA 4NPMA 5HXVA 3USUB 3ILFA 3IDBB 1ND2B 2B9UA 1G9FA 1L7RA 2WYSA 3NNMA 4PIYA 3SXWA 3TAYA 4K21A 3VZLA 4AEMA 1YEWA 1OK2A 4AQ2A 2P3JA 4ET7A 5H9QA 2VZPA 4AVVA 4F7ZA 2Y8KA 4QKBA 2XBO2 2KRIA 1W3XA 1NA1A 2ARXA 4XVHA 3IDCB 1AYM2 5F5QA 2BEOA 1H2NA 3MIDA 4WJG2 3NJZA 4PQ9A 1EV13 1W6MB 2OZJA 1H1IA 2XR4A 4FPJA 3D3AA 3RWKX 2RLPA 1GP6A 2E33A 2BVBA 2HWE1 2HH9A 4RQPB 3U78A 4DNYA 1K5JA 5C6CA 1EAH2 1SHWB 2BQPA 4KMQA 1OXCA 4RHV1 4B1MA 1G6NA 2EXIA 5BNPC 4LLOA 2WN2A 1EV12 2IXKA 4LUKA 2W1UA 3OBZA 1FPN1 4P9JA 4XF4A 1DYPA 5BNOA 3A0NA 3SITA 2A75A 2RR11 4CP1A 3KHCA 4AEDB 4LO7A 1CX1A 4WV8A 3AP7A 4DQAA 4AYUA 2BWAA 1DDLA 1SZBA 2YPDA 2VMCA 3RZGA 5FYCA 4MLOA 4MO3M 4LPLA 5HYTB 4OYUA 3R62A 2Y8SA 2J1UA 2LROA 2XLGA 2ZGKA 3MW3A 4D7SA 3WUDA 5K9YA 3WW3A 1H2LA 4QDRA 5E88A 2XWBF 1G9AA 2HWB3 3RFRA 4D69A 1GMMA 2IWGB 4LHNA 4E9KA 4Y24A 2RS33 3IKWA 4JQRA 1X8EA 3KT7A 4HSLA 1XNAA 1UY1A 3NV3A 3K3TA 3NWKA 3ACHA 5I0RA 2W1SA 1RJ8A 1O4YA 2OPWA 4I09A 2JE9A 1NA1C 2XJQA 2GMEA 3I2GA 4RGKA 5FZOB 3SC7X 4AI9A 2AEZA 4RHV3 3DKQA 2DUPA 5FZ9A 3RYKA 3WNPA 2HWB2 4Z2AA 2QQJA 2WZR1 4WM7B 3U14A 5IAXA 1HLCA 2TUNA 2WLPA 5HCHA 2BV4A 2ZOEB 3HPNA 3AZYA 2RS32 1QQP1 2X2ZA 1FPN3 3W58A 3CU7A 4ES9A 4HFSA 4OHXA 3S57A 3ZXLA 4YNIA 3CNAA 3ZXGA 4NHMA 1A8MA 1AJOA 4PT6A 3WF4A 2I2LA 2P17A 2OS2A 4YNXA 3ZDVA 1JZ8A 4HK9A 4PDWB 4RHV2 1AX0A 1QH6A 4UW5A 1VAVA 1M4WA 2FCVA 2JWPA 1F4AA 1UWWA 1TG7A 2Q30A 5JWPA 2JKBA 4XACA 1H1MA 1LECA 2JD4A 2BNOA 1V6MA 1O9AA 5GZEA 4QPGA 5BNOC 3VD9A 4NMIA 1EYBA 4IGQA 1XNKA 3AP5A 1C5IA 3KCXA 2QZ3A 1TNRA 2X09A 4A5WB 2JGWA 1Y9MA 4JHZA 4MHRA 4RS5B 3WNOA 1O7FA 3RZLA 3U0ZA 5I91A 4YWAA 2DFCA 2IXLA 3IIIA 3IM0A 1PMJX 4K1YA 4DXTA 4D6SA 2PHXA 5JI7A 3EXUA 1GZWA 3M3OA 1POV1 4IQPA 4YGDA 4A45A 3ST7A 4AQSA 1W6OA 5IVCA 4UXAA 3E5XA 3EJKA 2DCJA 4NIGA 3NMBA 1X7NA 1XU1A 1EPWA 5FY1A 4IEWA 4YGCA 5FBZA 3QOPA 3ZXJA 2D43A 4R9BA 3S7IA 1JYXA 2VUAA 1Q5OA 2WIIB 4Y22A 2IC1A 4YFWA 1DQ2A 2GSYA 5FY4A 3K4DA 3OBRA 5A32A 3CF6E 5I93A 4EN0A 4KBBA 2YFZA 3GBGA 3OGRA 1ZRCA 2IVJA 1ZA4A 5JOXA 3LSDA 3VHOA 1U5ZA 3R4DB 1G9BA 4JGZA 4K8RB 5FQ0B 3O1VA 2XJVA 2FDIA 3SEPA 2QUOA 4BQ4A 3D8CA 1HXS1 2F17A 2ZZQA 2BNMA 4X6RB 3IPVB 2D7FA 4XFBA 1QOTA 2JXAA 1GWKA 2VD7A 2C9AA 4KNCA 4XF0A 2JRAA 4J38B 1AXZA 1LOAA 4AAPA 5I0TA 3VV1A 1GKBA 2PA7A 4IUGA 5FRAA 4TZDA 4QPGC 2BFUS 4HPKB 3FMGA 4KU7A 1ZRDA 2XL7A 1CWPA 4XMIA 2EAKA 4XJAA 3J8F1 3PUIA 5L9BA 4B4QA 5A3NA 1S2KA 2XHNA 2CWMA 3WUCA 4Z07A 1CZVA 3ILNA 3BTXA 3AP6A 3SKJE 4FFGA 1I3HA 1GU3A 1RITA 2MPFA 4AVAA 2DV9A 4RGAA 5C7GA 1GWMA 4PI0A 1HRI3 3CHXA 3ZX7A 1G4FA 4B8EA 4AFBA 1XBFA 2D40A 1HFHA 1RXFA 4Q0SA 1CZTA 3AP9A 3WCSA 3C7GA 5A1FA 4XHXA 2JB4A 4DINB 1AXYA 1FX5A 3AVRA 4Y33A 1XYOA 3O0VA 4F8AA 5L7OB 1JMUB 3ELNA 1HRI2 4QMAA 1RUC3 3LEKA 1RUI1 2PAEA 4C0BA 2VQ0A 4KQ7A 1YXWA 3ZMNA 1MS1A 1PK6A 1QOOA 4OQ8A 4JVAA 3MDPA 5A7PA 5IVEA 2UURA 4QQHA 5F6LB 5J3UA 2HEWF 5CFDA 1MS8A 4IEUA 1LTEA 4CDUB 2RMU1 3PMSA 4R9CA 5K4LA 2JG8A 5EQUA 1OLME 5F3CA 1RUC2 4LK6A 2ARAA 2L9LA 4YW5A 1LB2A 4OCTA 2ZMLA 1ULCA 2EIBA 3FBYA 5FBJA 5KWRA 3FHIB 5KC5A 4Y1UA 4H14A 2PHDA 4XZPA 1BXHA 1FI2A 4IV1B 4HETA 2J22A 4UFIA 2X8KA 4IV3B 1GFF2 5LW9A 2EALA 1PIV1 2JDYA 2D6MA 4MGTA 4PLOA 4KL1A 3PMEA 5FPUA 3TEWA 4I3PA 3HAGA 2RS11 1UL9A 4IEYA 3ZYJB 2DYCA 1RUI3 2WLQA 4BLJA 4P00B 4NROA 2XJRA 4BQWA 1MQTA 4FXKB 3KVAA 1O91A 4CYDA 4LKFA 4Y20A 4QM8A 5LEJA 2CYFA 5CISA 1PGL1 3BUCA 3VGIA 2FZ1A 2ORZA 3D6EA 1WKYA 5ANNA 1RUH1 4UAPA 2A6WA 2N7GA 2K9ZA 4Y3OA 5T5JA 3WHUA 2I74A 2RMU3 2VXJA 5C3RA 3RGBA 3N7JA 3OJBA 5ERLA 1GQGA 3N36A 1O6UA 1ZZ7A 3GZAA 3MLJA 3JB4C 3NQHA 4ZS2A 5KHHA 1LCLA 4DXZA 4BWCA 4CU8A 1QMJA 1LKNA 2MNGA 3BPSA 4IEZA 1PK6C 2WO3A 4QXCA 4CUGA 3MUZ1 1AHSA 4FTSA 2WAOA 1CPMA 1DLCA 1X82A 5CFDC 1NCQC 3IMNA 3VBFC 1OMIA 2ZGPA 3HEIA 3ILRA 4YRDA 5A1AA 2G7IA 2RMU2 1LU2A 2HEVF 2R073 4L2NA 3MQLA 1C57A 1CR7A 2YGLA 3KV5A 2GAUA 1H30A 4M4RA 4YPJA 1KDKA 4I0WB 3UT0A 4LBJA 2YRAA 1H2MA 1ZRRA 2KA3A 3PUSA 4BZ4A 4M3CB 3C7FA 5FPAA 1O3QA 4BQ3A 2XLFA 1A3KA 1FV3A 2R072 4N43B 4QGMA 1H03P 3MBWA 3GZEA 4NAOA 1PHMA 1QJU3 4L97A 4CCKA 2WABA 1RUH3 3POSA 3QACA 4FQ4A 5DABA 3SQOA 2NMNA 2XXZA 3IN9A 4MVTA 3U4SA 3USSA 1GOFA 3JB8A 3VBSA 4P9GA 3I3QA 1YI9A 4G3YC 3T3YA 3KCCA 4UF0B 4S2FA 1TME1 4CCDA 4QX7A 1MQTC 5A7QA 1OPMA 1WWYA 3N9NA 1NAEA 4AG4A 1A78A 2AR6A 2YC2A 3NJXA 2VL4A 5DAXA 5BY5A 1QJU2 3IIAA 3M4FA 4GKYA 4B3NA 5K8SA 1RUH2 3BB6A 5LRSA 4CRQA 2E9QA 2VUJA 3W9AA 2NLRA 2A6ZA 2W81A 4XDPA 4ZONA 5C70A 3WVJA 5D8AA 4XJ9A 2P37A 3N9OA 4AYEA 2IXJA 3NVCA 1F9KA 3OP8A 1KQRA 4QDSA 5FO7B 3WHTA 5ANQA 2BERA 2XQRA 3WQBA 5I8SA 2WFF1 2BRTA 3I3MA 5J37A 3RZMA 4FP2A 4LQRA 3ZLIA 4OMCA 1W99A 1K5MB 1S0JA 4FI9A 3VKOA 4DO0A 5KHJA 1IZ3A 1XSQA 3LEMA 1AR72 2VCAA 4RD7A 3SMHA 2LTNA 3B9CA 3KF5A 5A33B 5K0UB 1DYKA 4LORA 1OD3A 3BCWA 4O9EA 3WW2A 2R0HA 4CDQB 5IFPA 1NLRA 5I0SA 2BW8A 3MI8A 3QCWA 4ISRA 2HYKA 5A7SA 4CCEA 1VMHA 4E2SA 3Q8CA 2WBKA 2Y8TA 1H4HA 1G9CA 2Y38A 4DJZA 3KHBA 4FPCA 4GH4B 5FIXA 5JIUA 1GP4A 1UD1A 3CMGA 4LBNA 1UX7A 2IFWA 3EQEA 1VRBA 4TYSA 3VBSC 1C1FA 1NZIA 4ORFA 4XJUA 5CAZA 1F15A 1XQNA 2E51A 5KBFA 1FAYA 1N1TA 4MGKE 2VZRA 1SRZA 3DL3A 1FNZA 3ZXDA 4X8NA 1BK1A 4K8FA 2JG9B 3H1WA 2GH8A 3MW2A 4HBNA 1KXGA 2WNUB 3PVEA 5DZEA 5I8TA 4YSFA 1OK9A 1KDMA 4GB31 1C8NA 1VP6A 4SBVA 2WFF3 5J48A 2YYOA 3AKPA 5DAVA 3AYAA 4FOVA 1GOGA 4LE4A 1UYXA 2OQ6A 5FUPA 3MV11 4YW6A 2VOTA 1JHNA 1ND3A 2JE7A 2Q5TA 2ZGLA 3VDDB 1NQDA 1QY4A 2ES3A 2WZEA 4Q4X3 4IE4A 5D8AC 1JYNA 4QPYA 1JZ6A 1LOBA 4IEPA 3TEZA 2WFF2 5DPNA 2ZYCA 2DWRA 1OA3A 3AX4A 5FLJA 5FPZA 1YLLA 3W21A 2PHFA 3W5NA 2WSVA 3AL6A 1HQNA 3CQOA 3ABZA 3FZ3A 3JBG1 4FPHA 4JRLA 4Q0VA 3HWJA 3NJYA 4Q4X2 2W46A 3WW4A 4CZSA 1HIXA 1KITA 2WT0A 4B29A 4B1LA 5JZGA 1QXPA 4GIQA 5CKMA 5ISLA 3ZR6A 4EWAA 4XTMA 5G04L 1S0BA 3CEWA 3AXDA 1OF3A 4U36A 3OEAA 1J83A 4CCMA 3AK0A 1O4ZA 2XRDA 3KV9A 4FP3A 2W91A 4WVMB 1MZFA 2VJXA 4JTNA 4N53B 1HRV1 4I01A 3DV8A 3GXEA 2BP6A 2AC1A 4LA2A 3CBNA 4YW2A 4AL9A 5EFUA 1W2NA 5FXWA 4FT8A 4CUAA 1OQDA 4QX1A 2A55A 2XH6A 3B3QE 1I6XA 4NUBA 4D7TA 2NZ9A 4YG6A 1S2EA 5AFBA 1OC1A 5C8WA 3LIGA 5JOWA 1PX3A 4GD4A 1OKQA 1UU4A 1VMJA 3WQ7A 1O8PA 1UKGA 2R041 2WDBA 2EXHA 1ZNPA 2CDPA 2B7YA 2Z2SB 1JUIA 2LRPA 4G9SB 3PL0A 5BXXA 2Y60A 3USUA 1W8FA 5IVVA 2OVUA 4FTEA 1ND2A 1AR93 1ND3C 1R091 3AMNA 5F3GA 4QB6A 4OQ9A 2RKZA 4BMEA 1ULDA 3ERBA 2WRAA 4BPZA 3AC0A 3LPGA 4BLIA 1J1TA 2VO5A 3DUIA 4ZKTB 3H7JA 4IEQA 1IKQA 5D2AA 4QKFA 3VUOA 1PVC1 1W9YA 2D3SA 1AR92 4NRPA 2DVFA 4XZUG 5FREA 2AYHA 1QJY1 2PLV3 1HRV3 1VB4A 2G1MA 2MHFA 3LEGA 5JZGC 4RQPA 4RYDA 3ZD1A 2R32A 2WWUA 2JDZA 3GDBA 4W4ZA 1X33A 2C1FA 4AI0A 3VZJA 3ZYGA 3NNJA 3I2JA 4AI3A 4R8HA 4QHOA 3L89M 2W94A 4Z2WA 2XQWC 2A5ZA 1UOJA 1UYZA 2PLV2 3U10A 1HRV2 4BQ1A 3RZKA 2ILMA 3OGJA 4GWJA 4AEDA 1Z0HA 3KCYA 5C3OA 1NXD1 4M00A 1R093 1HJGA 2WNVB 2P34A 5FK8A 4AVCA 1AX2A 1B35B 2BDRA 4BXSV 5JPNB 2VMHA 3OCPA 4Q0UA 4UFJA 4CP0A 4ASMB 1WZXA 4Z1VA 1OA4A 1EUTA 1QJX3 4G4FA 4ATFA 2H0VA 1PVC3 4NOTA 4N7IA 1ND2C 2MEV1 3KQ4B 2O39C 4M3CF 4XC9A 1VVDA 3SEEA 1UMHA 5T55A 1ZBE3 2RS51 1IHMA 3L2YA 5CKNA 4TSVA 5T3NA 3VHRA 5FZ6A 5IK8A 4XXPA 3OBTA 4WM8B 4CP9A 2ADEA 4MGYE 4NE9A 4QXBA 1QJX2 1XB9A 5FZOA 5H9PA 3T2OA 3WDXA 2VCCA 4PBOA 4EE2A 3FFZA 2VR4A 1I9RA 1PVC2 1YQCA 3ZYRA 2FDGA 4WM7A 1GPZA 3MO4A 5JMOA 1U0AA 1YNAA 2DURA 3AXEA 1O3RA 3CDZB 1AR82 2OPKA 4QPIB 4Q0PA 1JZ4A 1ZBE2 1RTVA 2P5BA 4CU9A 4DUWA 1NE4A 3H1YA 3ZLEA 2E53A 2EXKA 1HFIA 2GU9A 3BYWA 4RQPC 5JSOA 2Q1ZB 2E7AA 4PDWA 1NX9A 2JENA 2A3WA 4KWLA 5BNNB 3FLPA 3J7NA 4MUCA 3V0AA 3V0BB 1NCRA 3M70A 1HKDA 4A6OA 3O1TA 1DBNA 2X10A 1W0OA 4XHBA 3RYRA 2YBPA 1W8TA 1OOPB 1JYCA 1YFWA 3K51A 5FYTA 3K77A 2NN8A 4FPEA 2NM1A 1FXZA 3ZYPA 4I2OA 2WS93 2WQZC 4AEDC 1RUD1 3OB8A 2YU1A 2WNOA 2MEV3 5E16A 3AKTA 4RS5A 2TBVA 2JIGA 3J7LA 4LBKA 1RXGA 2RS53 1OFNA 1IPSA 1YIPA 4ATEA 4MXVA 3JCIA 3ZFFB 4Q4V1 4XURA 4NR1A 4LXLA 2PYTA 4YM3A 2WS92 3GXUA 3NAPA 4A7YA 3TNPB 4MADA 1W04A 5FMOS 4M0NA 3PIGA 2RS52 3B7MA 5FR3A 3Q8FA 4PIXA 1FNYA 1PZ7A 2ZGOA 3VKFC 2D6LX 1WLTA 3AYDA 2VBPA 3R4UA 5IHRA 1JYIA 3ZRZA 3LIHA 1NXMA 2W47A 4MOAA 4LBLA 4Q4Y1 4YGBA 1L3JA 2B45X 3TN91 3ASIA 1ACCA 4WM7C 1VBC1 1SQ4A 2DVBA 3PURA 1RB8G 1DGLA 4RSUA 2VNGA 3TWIA 4J25A 1XYPA 3LKJA 1SCSA 2BOIA 2Y6HA 4U2AA 1ZRFA 3ALQA 1W2UA 4ZU7A 4XDQA 1AYN1 5FQ0A 1LR5A 1RUD3 1OA2A 2ZGTA 3A7QA 4EQVA 5JUVA 3VBUB 4Q1RA 5LBFA 2QNKA 4PDWC 1FOD1 2QTWB 3IPVA 3MPBA 4E8CA 1JZ7A 3AB0A 2CGNA 4LHSA 2WC2A 3MIEA 2K46A 4JTOA 3U1XA 3ES1A 5LA1A 2ZHKA 5KHIA 4HPKA 4BU2A 1KRIA 2UWNA 3PU8A 1H04P 4V2VA 1RUD2 4NHLA 1G8WA 4Q27A 4YYOA 4CCLA 4CDWB 4JRAA 4RS5C 2XJSA 2DU1A 5FDBA 4FOYA 4KWJA 1W2OA 4HMZA 4CP2A 1W90A 1X50A 1C8M2 5A7WA 3N35A 2WWSA 5BNQA 4BHPA 3AKRA 4CCNA 2WT1A 1W8WA 3A21A 4BA6A 3IU3I 1GV9A 3SH4A 4FXGG 4CSWA 4Q4Y3 5FWEA 4Q2FA 5FZCA 2ZX4A 4E4ZA 2YV8A 3UK9A 5FOJB 1VBC3 3WNXA 4ARYA 1PO12 2DBNA 4LBMA 2DDUA 1REDA 5LWBA 2Q8CA 1VR3A 4AFMA 3NJAA 2ZEXA 3MHZA 4AI2A 3GF6A 2WIIC 4XW3A 1ULFA 1UPIA 4COUA 3EO6A 1FOD3 2R1BA 3FGTA 4IEXA 5C4WB 1VBC2 2G19A 2ZMKA 3O1SA 2LUWA 1SCRA 1AXKA 1C28A 2ZBJA 3OPZA 5E1RA 4D3WA 4FO9A 4HL0A 4GWNA 1C1ZA 1ZBA1 2A1XA 4FPLA 4ISQA 4UW3A 1PX4A 4Y26A 4YVWB 5FZ3A 3V64A 3H8UA 1EPZA 2C9KA 3ZN6A 4A6SA 5BNPA 2P4EA 1NUKA 2VC9A 3BPZA 5DZGA 1DG6A 1U5YA 1XE7A 1MACA 2DU0A 3MIGA 5LASA 5EHDA 2VMEA 1SS2A 2CNAA 3PDQA 4MGZE 4F3JA 5JOYA 4CCJA 4IESA 4XMAA 5LY2A 3HIFA 4KKDA 4LIVA 1LEDA 4XFFA 4CDXC 5HV0A 1YFXA 2R061 3C3VA 4JX0A 5DUXA 3WLUA 2PAMA 2EIEA 5FYSA 2Y64A 3WDWA 1E8BA 3TRSB 2GC3A 1CAWA 5FYBA 1LOEA 1LEMA 4IV3A 4OHWA 5GALA 1U5MA 1QJZA 2Y33A 1SFPA 1WBLA 2A73B 3AYEA 2AZ5A 4Q1PA 3VBRB 4HVOA 3OG2A 5LRRA 2VMFA 3MIHA 1J3PA 3MV01 3Q9OA 3WF1A 5C9AB 1LHNA 4UW6A 5FP8A 4H3WA 3KXVA 1UOFA 4XFGA 3ZFEB 3RS6A 2BUKA 4FFFA 3ZXFA 4IETA 1RJ7A 1HX6A 4Y1XA 1A6CA 4PCRA 3ITQA 1OT5A 3IB3A 3OOXA 5LA2A 1GZTA 1F31A 2WO2A 2ZGQA 5F8PA 2PHTA 4XF9A 5L7OC 1RUJ1 4NVPA 5F5IA 1WW6A 3R05A 2R063 4HKLA 4WVWA 2VZ1A 4YIZA 4UW4A 5LA9A 4CE8A 1QWRA 2VY0A 2D6OX 3C8XA 3LFMA 2OKXA 1F8VA 3GOVA 2R16A 3RG0A 4CDUC 3MLKA 2DCTA 1ZZ9A 2QE3A 4F83A 4MX3A 4ZU5A 2WUHA 1NY71 2QQMA 1RLHA 2SBAA 4Y5SA 2PHLA 3U11A 4BM8A 1HQWA 2R062 3E5QA 3K4ZA 2OYZA 1UO9A 1UIJA 2WQ8A 3KWVA 4D6RA 1V00A 2VCBA 5DN4A 2BTVC 2R7EB 2ZACA 3UKTA 4BQ2A 4WVZA 3P3PA 4APLA 3M2MA 4IV1C 5A6YA 4IV3C 4N43A 5C3PA 3VD7A 1VBA1 3FHAA 1PGSA 3L9JT 1M06G 1RUE1 2WINB 2ZX0A 1Q8OA 5CADA 3OD0A 2RLQA 4RA0A 2HWE3 3ETPA 4M0HA 5DN2A 5A1LA 2Q4SA 3K75B 4A3ZA 1K3IA 1S0EA 3M8LA 4UF0A 5JPMG 2K2SA 4C0HA 1HDKA 4CXYA 1EY2A 4GJZA 2E31A 4QKDA 5DUUA 1BEV1 3SNMA 1MZ5A 5T5LA 2W80A 3MEPA 1FATA 3T2QA 3BI3A 2HJIA 2HWE2 3ZM8A 2RR13 4CUCA 4TTGA 4XJ8A 4Y5TA 3MPPG 3THCA 3W20A 2NYYA 4DS0A 3J9SA 2BWCA 5FWJA 5HI0A 2VVEA 3MFAA 4PQQA 5DXDA 3VL8A 4Z82A 1SDDB 3UGGA 3WDVA 3EMRA 3WOGA 1MZ6A 2DTWA 2D97A 5LZ6A 3WDYA 1ZZCA 3B00A 1FPN2 4XBLA 2LOJA 1D2SA 1ZRIA 1H9WA 2RR12 3UV9A 2FDFA 4M4PA 4LKEA 1DP0A 1OQEA 1VBA3 2XLAA 3QD6A 5FV3A 1RUE3 4E2QA 2VZ3A 3RJ3D 1XU2A 2WZ8A 1JUHA 2ARCA 4IGOA 5T50A 4OZXA 3T0BA 4AHYA 3WZ1A 4BIOA 3WP3A 4A4AA 4AGGA 2GP3A 1ZREA 1W8HA 4XQ4A 5FTTC 5K0UA 4AAXA 2DFBA 1AUYA 3WP4A 1BK0A 2XOMA 1NZCA 5GZDA 4N43C 2ZCWA 2VAUA 1ULGA 2WZR3 1VBA2 1QUBA 4ZH1D 2ZEYA 5T5PA 1HN0A 1RUE2 2NPIA 4EN7B 1BEV3 1VMFA 3A4UA 1QQP3 1J59A 1I5ZA 2VTXJ 2PELA 1HN1A 1Y9QA 3ACIA 5FOBB 1NE6A 4JZRA 4I0BA 3MUY1 3KVBA 1F5JA 4AYMA 5GZGA 4ONTD 3GM8A 4K40A 4Q0QA 4HN0A 4MXWB 3U07A 3B5LB 5KXCA 4AYDA 4AXOA 4FBFA 2R1DA 5CIRA 2YC0A 1S0FA 5FXZA 2WZR2 2JG9A 5FZLA 4OI1A 4YG0A 3KQRA 3OY8B 1ELVA 1QQP2 2VQAA 3T09A 4N9HA 2V4AA 3UKVA 1XNDA 3ZFGB 4AVSA 5A3LA 3T0AA 4I3GA 5AFEA 3PJYA 1JOPA 5FPBA 3X29B 3GHNA 3I2KA 1UIKA 3FE5A 5F2WA 1OQ1A 2QQNA 1WCUA 1WW7A 2WNEA 5F3EA 2D6KA 1GZCA 1KJRA 1Q56A 1V6OA 2OQ7A 2ZA9A 4A3XA 3EHKA 1POV3 4YZ2A 4P9WA 3EB7A 1CPNA 1O8SA 1K5MC 1MEC1 5FYHA 1VAMA 3S5AA 2UY8A 4XUNA 1C1LA 3FC0A 5K0UC 4QT6A 2EIDA 1RUG1 4GJYA 4AVTA 4ZXKA 4CDQC 1J3RA 1EUUA 2NMOA 3NV1A 1T2XA 3OUJA 3E5UA 5DDJ1 4AHZA 3CI0J 3I3DA 4LK7A 4YW1A 5M0TA 1AL21 1CAUA 5FYZA 4CA9A 1ENRA 5A3PA 4GH4C 4XXAA 3ETQA 2VUDA 2H0BA 4N53A 5FY9A 3BTYA 1XNCA 3NRUA 1OVSA 1HXS3 1RGSA 1VBB1 2QDNA 1NQJA 1ZX5A 1QGLA 2ARBA 2JG9C 1G86A 2WNUC 2XJPA 1ZA7A 1G7YA 4FOQA 1RMU1 1D0GA 4CPBD 1SLBA 4IGPA 1A8DA 2B8MA 4ZPIA 1XYNA 5HCBA 1XOYA 3FUOA 3J8F3 1ALYA 3VDDC 1HXS2 3T2TA 5L9RA 1MEC3 4P5HA 4OHYA 2VBBA 1JW6A 1NCQA 2QQVA 3N9LA 3VBFA 5HXMA 2QKDA 2VNOA 5BYNA 2LS6A 4D6QA 4XFHA 4GKXA 1RUG3 5DAPA 1RUF1 5JXHA 1DHKB 2DUOA 1Q8SA 2EVXA 5DDJ3 1BJQA 3OPWA 5CKQA 3VBOB 2V09A 1JXNA 3ZSLA 3HVDA 3J8F2 1U5IA 4PBPA 4MGIE 4R4XA 4UWDA 1N3OA 3B01A 1MVQA 1J84A 1DF0A 4O9GA 1ZJKA 5JVVA 1TPMA 2GN7A 1RUG2 3CALA 1VE0A 2KR2A 1LODA 2BNNA 1VBB3 2XL9A 3C2UA 5DDJ2 5CFCB 1BZWA 2IXIA 3UGFA 4DB5A 3AVSA 1FMD1 1ZVFA 5EJ1B 1LGCA 5FZ1A 1PGW1 1RIRA 3ROUA 4N53C 4QX5A 2GNBA 2F4LA 4WVVA 2DVDA 5I8YA 1KFXL 2D6PA 4NWWA 3WT3A 4AI1A 4CEYB 3NKGA 2CY6A 2WNVA 4ARXA 1RVF1 3F6KA 1VBB2 3LPFA 4LBOA 3MICA 1HV0A 1QXJA 4JC1A 3RDIA 1YFYA 4HT1T 5C8CB 1MS9A 4KBZA 5HPOA 3JU9A 2C24A 3J7MA 4CUBA 1ULPA 1OK1A 2VPVA 2ERJA 1JBCA 1UF2C 3BU7A 1LOFC 1RUI2 2HWD1 1RUF3 3LCPA 1GHQB 2YBKA 4GMP1 4KGGA 4LHKA 5GLZA 3TNQA 1WLWA 2VVDA 4LOSA 4A44A 4FFIA 4ASLA 3JXSA 1U12A 2RL0A 1IS5A 3N3HA 3AJZA 2C4XA 3DECA 2UY9A 4LMFA 5KXEA 4IEVA 3EBRA 4AF9A 1GQPA 5KXDA 4WM8A 2RG4A 1PIV3 1VIWB 3FGRA 2VMDA 3LFIA 3SKVA 3M7PA 1YQ8A 1W3VA 3B02A 2VZVA 4HVRA 4JKLA 2GZWA 5GZFA 4D0QA 1FMD3 2DCKA 2I45A 2P6HA 3D0SA 2RS13 4S2DA 4QM9A 3M3QA 4QPIA 4I02A 3VKNA 1JH5A 1BHGA 3TOJA 2IZWA 4OMDA 1HB3A 2GNTA 1PIV2 1BKZA 1XC6A 2D5HA 2VECA 1FBRA 2Y34A 5FP7A 1GOHA 1SLLA 3O7OA 5JDBA 2C26A 5J7MA 3LF7A 2P3YA 3O1PA 2G9ZA 2VZQA 4L11A 1FMD2 1S0IA 3V0BA 3H8RA 2D3PA 2RS12 4S2GA 5F37A 5DZFA 5IK5A 1OOPA 3LGRA 4AEJA 1POV0 2XB6C 5F3IA 3RJRA 1O59A 5AC91 1TNFA 2GP5A 2K0GA 1E88A 1ULOA 1PGL2 2EA7A 4XQWA 1DGRA 2XKPA 1TEIA 2WNVC 4UYBA 3TEYA 1WBFA 1B35C 4PHZA 1OBNA 2PTMA 4HVQA 1IPKA 3ZFFA 4BJ0A 4NIHA 2OW4A 3VKMA 1QO6A 4INDA 1OPOA 3TEXA 5JCTA 3AMQA 1UMZA 1LGNA 1PM7A 1SEFA 2D44A 1UPSA 2VZSA 3NL1A 3I2DA 2GMMA 4IEOA 3ZXEA 1W6PB 3JQWA 1AZDA 1CAXB 1TMF1 1S0CA 1T6GC 5FFOC 4URTA 4WM8C 2VZTA 3ZYHA 5FXXA 3O12A 3RZJA 1BYHA 4KI5M 1GKGA 4O65A 5FYIA 2W0XA 2R6QA 3RNSA 1ASJ1 1UOGA 1Q3EA 1BQPA 2BFUL 2VMGA 4XFAA 4QPIC 2ZGNA 1TME3 2CWSA 5L9VA 3UJQA 1GNHA 4LA3A 1W2TA 3AFGA 4FPKA 3TVJA 3B69A 1VBD1 3VBUA 2VTXA 4SLIA 2WWJA 5I0DA 2X5IB 1IG0A 5BNNC 3T2PA 1UY0A 4PIZA 3JUUA 1H2QP 1LNSA 1OOPC 4NWVA 4QKNA 1ODNA 1SBFA 1TME2 3ACFA 4UI9L 1DQ0A 4XQDA 1UXXX 5FAXA 5A80A 4Q4W1 1ZZ8A 3ATGA 1Y4WA 3INAA 3WCRA 1LOGA 2EIGA 3GJAA 4CDXB 4RL7A 3ECQA 1TMF3 1GZWB 2YHJA 1BBT1 3R6SA 4DXRA 2LM3A 5A3TA 2FDKA 4AE2A 3ZFFC 1DFQA 4CTEA 2PFWA 1JYTA 3POEA 4NHYA 1W6NB 1MR5A 4UFHA 5FZFA 3RI9A 5EP9A 1ASJ3 1ENXA 1K42A 3S30A 5T52A 1JZ5A 2EHFA 5EJZB 1TMF2 3WG3A 4QAWA 4E27A 3FL7A 3WW1A 4AZZA 1VBD3 1YYNA 2BGCA 2IZ4A 2GC0A 4P02B 5LBCA 1QOSA 4AGVA 1R1A1 4JGZB 3O1OA 5GJ6A 3E6DA 3RPQA 5CG8A 2PMWB 4OHZA 2GC2A 4UFKA 4YVWA 1SFNA 5FUNA 2OIIA 2ZGSA 3OYWB 1VBD2 3VBUC 2Y8RA 1OI6A 4HANA 3SH5A 2PXJA 4GB33 2DUQA 2JX9A 4L92A 5FKCA 5CB7A 1BBT3 1ZZBA 1W6QB 2XWJI 1BLZA 3WV6A 4IL7A 1OUXA
chains in the Genus database with same CATH topology
2B5ID 1PPQA 2EC3A 3KZJA 3POJA 4CSYA 2QQMA 4F4OC 1LY2A 3ZD1A 5HYUB 1E88A 3T5OA 1OJWA 2V8EA 4YNXA 4LORA 2UWNA 1H04P 3L89M 1HCCA 2XQWC 3O8EB 2QQOA 1O9AA 1VVCA 2RLQA 1QO6A 4DJZA 1MD8A 2QQKA 3IU3I 4A5WB 4FXGG 5JPMG 2JGWA 1H2PP 3ZD2A 3EJHA 1NZIA 3POFA 2XRBA 1E5GA 1SRZA 3IX0A 2W80A 2MCZA 3KQ4B 1OK9A 2O39C 1VVDA 2WIIC 1GKGA 2YBYA 5CKNA 5CISA 1OJYA 3POGA 1SPPB 3POBA 5FO8C 5CKQA 1C1ZA 3TVJA 2LOJA 1GPZA 1OK2A 1TPGA 2QQLA 1ZJKA 2KRIA 2BZMA 1TPMA 1NWVA 3POIA 3CALA 3RJ3D 5HZPB 4AYIA 1H2QP 1HFIA 4WJG2 1SS2A 2JGXA 1OJVA 2G7IA 3MQLA 5I0QB 4KKDA 4MUCA 2RLPA 5CKMA 4K12A 1QUBA 4ZH1D 1QGBA 2JRAA 4J38B 3NFPI 2QY0A 2YRAA 1E8BA 1MD7A 2XRDA 4PZ5A 4LOTA 4B2RA 2WNOA 3POEA 4IGDA 1U5MA 1SFPA 1CKLA 4GZ9A 4AYMA 4ONTD 1H03P 1OK1A 2ERJA 2KMSA 3GXEA 4AYDA 1GHQB 2EHFA 1UOTP 2A55A 4LOSA 1SZBA 1GKNA 1ELVA 3KXVA 4JHSA 2RL0A 3OEDC 2IZ4A 1NT0A 5HYTB 2CG6A 4LMFA 3R62A 1Z92B 2IZ3A 1SPPA 1G4GA 3DEMA 3OXUD 3M7PA 1G4FA 2XWBF 2RKZA 3ZRZA 3INBC 3SW0X 2CKUA 1HFHA 3ERBA 5HYPA 1Q3XA 4C16A 2W81A 1TPNA 2RKYA 4B2SA 4AYEA 2CG7A 1OK3A 2MCYA 3OP8A 2XWJI 1FBRA 3GOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5I D;  1PPQ A;  2EC3 A;  3KZJ A;  3POJ A;  4CSY A;  2QQM A;  4F4O C;  1LY2 A;  3ZD1 A;  5HYU B;  1E88 A;  3T5O A;  1OJW A;  2V8E A;  4YNX A;  4LOR A;  2UWN A;  1H04 P;  3L89 M;  1HCC A;  2XQW C;  3O8E B;  2QQO A;  1O9A A;  1VVC A;  2RLQ A;  1QO6 A;  4DJZ A;  1MD8 A;  2QQK A;  3IU3 I;  4A5W B;  4FXG G;  5JPM G;  2JGW A;  1H2P P;  3ZD2 A;  3EJH A;  1NZI A;  3POF A;  2XRB A;  1E5G A;  1SRZ A;  3IX0 A;  2W80 A;  2MCZ A;  3KQ4 B;  1OK9 A;  2O39 C;  1VVD A;  2WII C;  1GKG A;  2YBY A;  5CKN A;  5CIS A;  1OJY A;  3POG A;  1SPP B;  3POB A;  5FO8 C;  5CKQ A;  1C1Z A;  3TVJ A;  2LOJ A;  1GPZ A;  1OK2 A;  1TPG A;  2QQL A;  1ZJK A;  2KRI A;  2BZM A;  1TPM A;  1NWV A;  3POI A;  3CAL A;  3RJ3 D;  5HZP B;  4AYI A;  1H2Q P;  1HFI A;  4WJG 2;  1SS2 A;  2JGX A;  1OJV A;  2G7I A;  3MQL A;  5I0Q B;  4KKD A;  4MUC A;  2RLP A;  5CKM A;  4K12 A;  1QUB A;  4ZH1 D;  1QGB A;  2JRA A;  4J38 B;  3NFP I;  2QY0 A;  2YRA A;  1E8B A;  1MD7 A;  2XRD A;  4PZ5 A;  4LOT A;  4B2R A;  2WNO A;  3POE A;  4IGD A;  1U5M A;  1SFP A;  1CKL A;  4GZ9 A;  4AYM A;  4ONT D;  1H03 P;  1OK1 A;  2ERJ A;  2KMS A;  3GXE A;  4AYD A;  1GHQ B;  2EHF A;  1UOT P;  2A55 A;  4LOS A;  1SZB A;  1GKN A;  1ELV A;  3KXV A;  4JHS A;  2RL0 A;  3OED C;  2IZ4 A;  1NT0 A;  5HYT B;  2CG6 A;  4LMF A;  3R62 A;  1Z92 B;  2IZ3 A;  1SPP A;  1G4G A;  3DEM A;  3OXU D;  3M7P A;  1G4F A;  2XWB F;  2RKZ A;  3ZRZ A;  3INB C;  3SW0 X;  2CKU A;  1HFH A;  3ERB A;  5HYP A;  1Q3X A;  4C16 A;  2W81 A;  1TPN A;  2RKY A;  4B2S A;  4AYE A;  2CG7 A;  1OK3 A;  2MCY A;  3OP8 A;  2XWJ I;  1FBR A;  3GOV A; 
#chains in the Genus database with same CATH topology
 3ZKY A;  2GND A;  4CDW C;  3IAP A;  1Z7S 1;  4HXC A;  4B7K A;  1V6N A;  4H55 A;  2P2K A;  1Q8V A;  5K7P A;  4RR3 B;  3I54 A;  2Z4F A;  3BTA A;  4QHB A;  1LY2 A;  1DYO A;  1DZQ A;  4GB3 2;  5AVP A;  4C8D A;  5CA6 A;  4D8M A;  3RZH A;  2ATF A;  1BBT 2;  3HT1 A;  5F5C A;  2RJ2 A;  1UXZ A;  4GA9 A;  3O0W A;  2J1R A;  1LHO A;  4UBG A;  4QX8 A;  3THD A;  4C1W A;  1VPH A;  3JBG 3;  3KV4 A;  1JN2 P;  1R1A 3;  2AAC A;  2QQI A;  3VBR A;  3BU0 A;  2F4P A;  1REF A;  4ASK A;  4R9D A;  5C9A A;  3ON7 A;  5EYX A;  3WR0 A;  5LK7 B;  4YZ5 A;  1L7L A;  3E6B A;  3OSD A;  4Y1Y A;  3GCW A;  1RC6 A;  3LDB A;  3H50 A;  5GKA C;  4UT5 A;  3VZN A;  3ZFE A;  4Q8K A;  4Z8B A;  4YGE A;  5J96 B;  1US3 A;  1X9P A;  3IZO A;  4ERO A;  1W6M A;  3PVN A;  4YM2 A;  4GWI A;  4BK5 A;  3JBG 2;  3WSO A;  2D98 A;  1UCX A;  3VZM A;  1R1A 2;  5C4W C;  1HB2 A;  5FZ0 A;  2ZTN A;  1OHF A;  5A6Q A;  2E32 A;  4AK3 A;  1CON A;  4YVW C;  4XIO A;  3EYP A;  3FUQ A;  4YM0 A;  4YG3 A;  1OJY A;  1Z7S 3;  3KD4 A;  1H1A A;  4JGY B;  1SLT A;  2JG8 B;  4XF1 A;  4XUP A;  3UYJ A;  3DXU A;  2R04 3;  1CX4 A;  1PO2 1;  4YVS B;  2ERF A;  3U4X A;  1B09 A;  5DG2 A;  4LO5 B;  4FSJ A;  3OPT A;  5LEK A;  1ULE A;  3ZLD A;  4FPY A;  1YQ6 A;  1NKG A;  4W6Y A;  5KXB A;  4QB2 A;  3FFQ A;  4BXF A;  1APN A;  3WQ0 A;  4MZU A;  4NJ4 A;  4QQ2 A;  3AJY A;  5L73 A;  3OTF A;  2R04 2;  2IXC A;  4ZY9 A;  1UYP A;  4EV0 A;  4E4D X;  3FLT A;  2BVV A;  3HR9 A;  1XJA A;  2GMP A;  2B4K A;  2W68 A;  3I49 A;  4YLZ A;  1R09 2;  5KC6 A;  4DRR A;  1UQX A;  1CJP A;  1QGB A;  1QJY 3;  2UU8 A;  3FJS A;  3GBF A;  5F6K A;  5AVA A;  3VBR C;  4XUT A;  2PHR A;  1RIN A;  5C9A C;  1MS0 A;  4P5Y A;  3VLB B;  4QGL A;  2J1V A;  4XOG A;  4RFT 0;  2Y6G A;  3RI8 A;  4MGQ A;  1S0G A;  4DUV A;  1CGP A;  3ZFE C;  1YFU A;  5IVJ A;  3C7H A;  2RM2 1;  1UZ0 A;  4GZ9 A;  4YM1 A;  3VB9 A;  5C3S A;  1E5S A;  5GLU A;  2O1Q A;  5JXJ A;  5JAX A;  3P3N A;  4JQT A;  2OA2 A;  1QJY 2;  1I5P A;  3ZVX A;  4BYY A;  4DY3 A;  2QQP A;  2C5D A;  2Z5W A;  1WUV A;  4IDZ A;  1DZR A;  2DVG A;  4N8M A;  2ZGU A;  4CPB A;  3H7Y A;  3J26 N;  5T5O A;  5LAT A;  4AFD A;  2J1S A;  3BOP A;  3UJO A;  1G4G A;  1DQ1 A;  3LDK A;  1LES A;  1N47 A;  2KD7 A;  1BVV A;  4EZH A;  3BIE A;  2VNV A;  4KGQ A;  4QQP A;  1VRH 1;  5FO9 B;  2XUE A;  3SCH A;  2HBT A;  2BYV E;  2PHW A;  3SIS A;  5JSR A;  2LW8 A;  3WNK A;  3WP5 A;  2VQT A;  1W06 A;  3SH3 A;  3GYD A;  1W8O A;  2W1W A;  5JIA A;  3LWC A;  2B5I D;  1PPQ A;  2ORX A;  2UWA A;  1S55 A;  2RM2 3;  3ZO0 B;  3HNY M;  4R4Z A;  2CHH A;  3PUH A;  4BCU A;  3VL9 A;  2MEV 2;  5A3W A;  2YBS A;  1WD4 A;  4AHX A;  4J6G A;  4E4H A;  1WCQ A;  4CCO A;  3S0M A;  3H3L A;  3HQR A;  4MET A;  5IK4 A;  1O5U A;  4FOW A;  1SBE A;  5GLT A;  4D7Y A;  4LLF A;  1MZE A;  4PO7 A;  1W8U A;  3RMY A;  3GGL A;  1GNZ A;  1PZ8 A;  4CVU A;  2RM2 2;  2WYF A;  5D21 A;  1SDW A;  1JYW A;  3O8E B;  4GQ7 A;  1D2Q A;  4JHT A;  3Q8A A;  3ZSK A;  3KM5 A;  2ZKN A;  1F35 A;  5C5T A;  4UFL A;  4J1X A;  3DYP A;  2JEM A;  3T08 A;  1IS6 A;  2B39 A;  3AP4 A;  1LJ7 A;  3F95 A;  5FYV A;  3ZFG A;  3ZD2 A;  2H6C A;  1KD7 A;  2BOJ A;  5EWS A;  5LBB A;  1CES A;  1RHI 1;  2FCU A;  3CLP A;  1LGB A;  5G05 L;  4AI8 A;  2BJS A;  4DOU A;  2A71 A;  3BOW A;  2VZO A;  4DEV A;  4Q4V 3;  1E57 A;  5GM0 A;  3P5B A;  2Z79 A;  1GAN A;  4AHW A;  2ZMN A;  4TLF A;  2RVA A;  4IER A;  2GN3 A;  1SAC A;  3AZX A;  2AUY A;  2BBV A;  2HYX A;  3J4U H;  2BU9 A;  5JMC A;  2P3I A;  4Z92 B;  3NNF A;  4B4R A;  3BN6 A;  4Q4V 2;  3N9M A;  3WX5 A;  2QQL A;  4XCB A;  3LE0 A;  3WDU A;  5FO8 B;  1OUS A;  1WMF A;  2H6B A;  2OUJ A;  5A3M A;  5DMY A;  3TN9 3;  3THT A;  3KF3 A;  2W52 A;  4XBQ A;  5FP9 A;  1VBE 1;  1OJV A;  1C4R A;  5JOZ A;  2E6V A;  4CU7 A;  4XUO A;  5EXO A;  2ZXQ A;  1CJD A;  2C6S A;  2RHP A;  2WR9 A;  1AYN 3;  3KZ4 C;  2NP0 A;  3MZH A;  2XON A;  1H9P A;  4XYX A;  4E8D A;  2B46 X;  4LBQ B;  1RHI 3;  3OGV A;  3ZSE A;  2YUE A;  5IVF A;  1TE1 B;  4Q4Y 2;  4AVB A;  3WD5 A;  3E6C C;  3TN9 2;  3N7K A;  1JZ2 A;  1MD7 A;  2R49 A;  4DMI A;  3PVB B;  1LHV A;  4B2R A;  1CIW A;  2UWB A;  1PM4 A;  3NNL A;  4YFZ A;  2ZGM A;  4HG6 B;  3ZKU A;  1SLI A;  1ND3 B;  2A3Y A;  3MW4 A;  3ZFG C;  1AYN 2;  1H8T B;  2XVK A;  4BIF A;  1UZY A;  1UOB A;  3BIW E;  2RJK A;  2GC1 A;  1RHI 2;  2XBO 1;  4NIA A;  3H3Z A;  3WF3 A;  1FOD 2;  2D5F A;  2UWC A;  4P14 A;  3ME2 A;  3OED C;  5SV8 A;  1AYM 1;  4CDU A;  1NT0 A;  4XAE A;  4TLG A;  4H7L A;  2CG6 A;  4XE9 A;  2CSG A;  2QZ2 A;  5FYU A;  3UKN A;  1Z92 B;  1ODM A;  1WMD A;  2PQQ A;  2EAA A;  2Z42 A;  3D5O A;  1F5F A;  3GHM A;  4PJY A;  4V1P A;  3VBO A;  5GLV A;  4A42 A;  3RMX A;  2B5H A;  3LSE A;  4Q5O A;  3UL2 A;  5DQ0 A;  2X05 A;  3S7E A;  1EAH 1;  1GSL A;  5HYP A;  4AR2 A;  5BV6 A;  1Q3X A;  3AZV A;  4IV1 A;  2YPJ A;  3H1M A;  1VAL A;  4AOC A;  5JR2 A;  3MF6 A;  3N4M A;  2JIC A;  3O5S A;  2JE8 A;  4PLM A;  1OK3 A;  4HN1 A;  2WJS A;  5CFC A;  2O0O A;  1SLA A;  2GNM A;  4IE6 A;  4C90 A;  2WAA A;  2WQ4 A;  1V70 A;  3HQU A;  1EP0 A;  1IKP A;  1ZBA 3;  5IAT A;  2PQS A;  4W6X A;  1AVB A;  1YO8 A;  5FP3 A;  4H7M A;  3O1R A;  1UMI A;  3GNE A;  4OVE A;  4ES8 A;  1O3S A;  4B7E A;  4BMB A;  5LBE A;  1OJW A;  3DPR B;  1UZZ A;  2VQU A;  4XBN A;  3HMY A;  1UU6 A;  2YB7 A;  3TB0 A;  4N9I A;  3J7H A;  1AL0 G;  1BCX A;  1S0D A;  1ZBA 2;  2YFU A;  4QGN A;  3TYJ A;  2QQO A;  4I30 A;  2YRO A;  2OT7 A;  1N1V A;  1BVP 1;  3RQ0 A;  5FPL A;  1KS4 A;  2QQK A;  2WFP A;  3DXT A;  3H9A A;  4DUX A;  3N7L A;  1EAH 3;  4XTP A;  1N3Q A;  2WT2 A;  5APA A;  1GIC A;  5FXV A;  4OUE A;  4AGR A;  1OLQ A;  3IDA A;  1POQ A;  2XRB A;  1CZS A;  1E5G A;  1V6K A;  2HWB 1;  1WLD A;  2IUW A;  4ZXE A;  5IVY A;  4FXG B;  1CAV B;  2RS3 1;  4BQX A;  2XJU A;  5T54 A;  2MCZ A;  4HK8 A;  1DZT A;  3VBO C;  1W0P A;  3ENR A;  3LAG A;  4IXL A;  4TWT A;  4M3C A;  1JS9 A;  3I59 B;  2R30 A;  4NII A;  1NLS A;  3DYO A;  3O1M A;  2P1B A;  4FTB A;  2XPJ A;  5FZ4 A;  5C33 A;  1W03 A;  2CGO A;  5CFC C;  3CJX A;  4XIK A;  3I3B A;  3IDE A;  2V4V A;  1HQL A;  2ZX2 A;  3UNP A;  1RUN A;  2CV6 A;  1AR6 1;  1RUJ 3;  1FT9 A;  1YCI A;  4LBQ D;  3AFK A;  5ACA 1;  3VZK A;  5FMO L;  2CDO A;  2BGO A;  1SMV A;  4CU6 A;  1YRZ A;  3S5Q A;  4CEY C;  5IVB A;  4AQ6 A;  5I0Q B;  4EYU A;  3O14 A;  2XQX A;  5C8C C;  1V6J A;  4P9X A;  1MPX A;  2AGS A;  3AYC A;  4PF5 A;  3DN7 A;  4K12 A;  4B4P A;  1S1A A;  1RUJ 2;  4NID A;  3I2H A;  1K45 A;  4L8Q A;  4PZ5 A;  3KSC A;  4L0P A;  4LOT A;  5IK7 A;  4IGD A;  3K46 A;  4URA A;  2IXH A;  2V5D A;  4GWM A;  4CP9 B;  2HEY F;  1W6P A;  2KMS A;  1CAX A;  3W59 A;  5F1R A;  2LAL A;  4Q29 A;  3NST A;  5JR7 B;  3WG2 A;  3RZZ A;  4IE5 A;  1LHU A;  5F9T A;  1HB1 A;  1K5M A;  3BKZ A;  1GKN A;  1NY7 2;  2XHK A;  1QNY A;  2VW0 A;  2YU2 A;  3UGH A;  3HNM A;  3UET A;  1IGO A;  4XEZ A;  2JJ6 A;  5C71 A;  5GLW A;  1I1E A;  5A33 A;  2RE9 A;  4A7Z A;  2A6V A;  4Q26 A;  5J09 A;  1PZ9 A;  1AR6 3;  2G4I A;  5JXG A;  4I0A A;  3ZSM A;  4CDQ A;  3OXU D;  1LOC A;  2VZU A;  2Q0A A;  3SLI A;  1GUI A;  3ZXK A;  4MYE A;  4CXW A;  5ACA 3;  3V0A B;  2ARE A;  1NCR B;  1D7P M;  2ZAB A;  3AZZ A;  4LIU A;  4XCA A;  1KJL A;  1HB4 A;  3PHM A;  5FYM A;  3HJR A;  1OFS A;  1HV1 A;  4BIS A;  2ADD A;  2X5I A;  4GH4 A;  5F2S A;  3N9P A;  3ZN4 A;  4FAG A;  1JHJ A;  4C91 A;  3VBH B;  4NO4 A;  4CEW B;  3WG4 A;  4XDO A;  1LAJ A;  1GP5 A;  3DF0 A;  1AR6 2;  1YQ2 A;  1N1Y A;  1QF3 A;  2J1A A;  1D4M 1;  2EXJ A;  1W8N A;  1OLM A;  3GCX A;  5ACA 2;  1GLH A;  1GQH A;  2BGP A;  2CTV A;  3GZT B;  4OFG A;  1PVX A;  3AKQ A;  4XF3 A;  2OX0 A;  2WNU A;  1BEV 2;  2RV9 A;  2QFE A;  4CDX A;  3CJI B;  4XJW A;  3VWO A;  2Q1F A;  3OF1 A;  4P9I A;  2JDU A;  3IBM A;  5FMC A;  4OHV A;  3NAP B;  3ZIX A;  1X36 A;  3APB A;  3SHR A;  5FJH A;  5FZA A;  4OZO A;  4LO8 A;  1IQA A;  3VDD A;  5ABJ B;  2ET7 A;  1UU5 A;  1W6N A;  4P08 A;  2ZHL A;  3GBW A;  3T0D A;  1BMV 1;  4N90 A;  5F39 A;  1G9D A;  4K1Z A;  4KG8 A;  3KV6 A;  3FX3 A;  3QH6 A;  3WNN A;  3OUH A;  5A3O A;  3ZR5 A;  2W9X A;  4AFA A;  4QXK A;  1WD3 A;  1RL3 A;  2FDH A;  3OUI A;  2WA3 A;  2Y6F A;  4QU1 A;  4XFI A;  4M3C E;  4XPV A;  2EF6 A;  1UY3 A;  4HON A;  3MLL A;  4OI4 A;  2HBU A;  1Q43 A;  3PUQ A;  5LY1 A;  1HRI 1;  4MG2 A;  3E1F 1;  3OEB A;  4O61 A;  5FK7 A;  4Y5Z 0;  2J1E A;  2W92 A;  4GAZ A;  4WZC A;  3N7M A;  1QXR A;  5IYY A;  5JPM B;  3KGL A;  1DQ4 A;  1D4M 3;  4NRM A;  2CGP A;  3OYW A;  2VE1 A;  1YIF A;  3WIN E;  2AH2 A;  3D0J A;  2PAK A;  4WVM A;  1CVN A;  2X5I C;  1RUC 1;  3T1L A;  2ET1 A;  4XJZ A;  4COZ A;  1SPP B;  2ZX1 A;  1W9W A;  2XDV A;  4BE3 A;  1W6Q A;  1JZ3 A;  1W28 A;  2X29 A;  3U37 A;  1RUO A;  4MSV A;  2XML A;  1D4M 2;  1PNG A;  4FFH A;  3I4I A;  2FMY A;  5DAW A;  5A7W B;  5A3U A;  2JDN A;  3POI A;  2VOW A;  3POY A;  4RR3 A;  4A7K A;  1LOF A;  4JKK A;  5TSW A;  3CO2 A;  3CZJ A;  2G9G A;  1UY4 A;  2YC4 A;  3LDR A;  1LEN A;  3AMP A;  4P9L A;  3IAQ A;  2ZZJ A;  1E5H A;  4HZF A;  5E89 A;  1BMV 2;  3MF9 A;  5CNA A;  5LB6 A;  4LO4 B;  4Y4Y A;  2YG0 A;  2F6B A;  4MH0 E;  5FZB A;  5HV4 A;  2ZX3 A;  2VGD A;  4K20 A;  1PMI A;  3PIJ A;  3MIB A;  3THP A;  3HN1 A;  4YW3 A;  1XE8 A;  1AL2 3;  1H8V A;  1MEC 2;  3BGA A;  3AKS A;  5FZI A;  4DIQ A;  5EYY A;  3K4A A;  4JGZ C;  3VHP A;  5CU1 A;  3ZN6 B;  1Q8Q A;  1YJL A;  3LZZ A;  4OI0 A;  5H9S A;  2RDS A;  2WO1 A;  4HKO A;  5BNP B;  4Y4R A;  1W2A X;  4LEJ A;  3KMH A;  4KG0 A;  2J42 A;  5EJ3 A;  3S6P A;  3LA2 A;  4JGY A;  1QHD A;  4JCK A;  1OF4 A;  2IZ3 A;  1AL2 2;  1YC6 1;  3RYP A;  2ZGR A;  1X9T A;  1RMU 3;  1ONA A;  4YVS A;  3ZDS A;  4LT5 A;  2Q8D A;  3INB C;  3SW0 X;  4JAA A;  5FYY A;  2A7A A;  3QBQ A;  2Y6J A;  3JD7 1;  3LB9 A;  3K3N A;  3LD8 A;  4KU8 A;  1B35 A;  1ZM1 A;  2E26 A;  1CAW B;  2Y26 A;  3CZU A;  4N7E A;  2R07 1;  4QQO A;  5FCC A;  1CQ9 A;  1DQ6 A;  4RR3 C;  2JDK A;  2C0Z A;  1RMU 2;  2P3K A;  1Y9G A;  1IPJ A;  5FY7 A;  1V9U 1;  1ENQ A;  2W95 A;  3KT1 A;  1OKO A;  3NO8 A;  2KM2 A;  4LKD A;  4Y1Z A;  4Y1V A;  4K3U A;  2VUC A;  1OUR A;  5A6X A;  5GZC A;  2HWC 1;  1NA1 B;  1N1S A;  2DCY A;  5FY8 A;  5FMD A;  4EWD A;  1OLR A;  5L19 A;  1XSR A;  3KLS A;  2BZD A;  4RGG A;  4QD2 A;  3MGU A;  3WDT A;  2V8E A;  1K12 A;  1Y3T A;  3WP6 A;  1RUF 2;  1QJU 1;  1WME A;  3K2O A;  1IQD C;  2WN3 A;  4W50 A;  1UX6 A;  2B42 B;  3H0O A;  1HCC A;  4YW4 A;  3WY6 A;  2HLE A;  4LO6 B;  4NPL A;  1QEX A;  3B93 A;  2A6X A;  2V73 A;  2CAU A;  2VM9 A;  4XFC A;  3VDA A;  1VVC A;  1YJK A;  2B9V A;  1Y7B A;  1SLC A;  2FCT A;  3T4V A;  4QHZ A;  4DEQ A;  5FZE A;  5IFT A;  1REE A;  4XAA A;  4MUV A;  3AL5 A;  2W08 A;  3WEZ A;  4ITC A;  3JD7 3;  1RVF 3;  4BWO A;  4EJR A;  2CL2 A;  1S2B A;  1DGR N;  5BNO B;  1KGY A;  3MIF A;  3OGG A;  5BNN A;  4EN6 B;  4JGY C;  3M3E A;  1R1Z A;  1TQ5 A;  4LTA A;  2JG8 C;  5A7O A;  5L36 A;  3DGT A;  1XNB A;  2Y6L A;  2HWD 3;  5HCF A;  3URF A;  1GNY A;  4GMP 3;  1PGW 2;  1PNF A;  2FMD A;  1V9U 3;  2G9F A;  2RDQ A;  3KT4 A;  4YVS C;  1AR7 1;  1TZO A;  3RVH A;  2V5Y A;  5CBL A;  4X8P A;  3HOB A;  3POG A;  1N3P A;  3KB5 A;  5F32 A;  3JD7 2;  1RVF 2;  2HWC 3;  2WZP P;  3ZYF A;  1R64 A;  4HOO A;  4NPR A;  3ZSJ A;  2IVI B;  3ACL A;  1IG3 A;  2A70 A;  4MV2 A;  1VJ2 A;  1AF9 A;  2ZJC A;  1ZZ6 A;  2HWD 2;  3H3U A;  1V9U 2;  3NV4 A;  3PVO A;  3M1H A;  1YUD A;  1NYW A;  4NN0 A;  3H8X A;  1H4G A;  1QNW A;  2BZM A;  2I2S A;  1NWV A;  2VMI A;  4NAM A;  4PLN A;  2VW1 A;  3V56 A;  5JLV A;  1XE0 A;  3ZN5 A;  5HZP B;  2HWC 2;  5B2G B;  4MSL A;  3K48 A;  3DKW A;  5A6Z A;  1COV 1;  1TVG A;  2JGX A;  5CG9 A;  4OI2 A;  4AEK A;  4QWN A;  5LK5 A;  3CL1 A;  5DUV A;  5FZD A;  3RSJ A;  2OXB A;  3FWE A;  5HBA A;  3VKL A;  3G7D A;  3UES A;  3A23 A;  4XUQ A;  2XVG A;  2OZ6 A;  2VU9 A;  1LRH A;  3HQX A;  2QY0 A;  1UY2 A;  2JB8 A;  1E5I A;  2VCM A;  1WA4 A;  3NJV A;  1HW5 A;  4L99 A;  3FN9 A;  5AC9 3;  5J1X A;  2PHU A;  2WL1 A;  5E6H A;  5FY5 A;  4HSJ A;  4ZHN A;  1AR7 3;  4KH9 A;  3KGZ A;  5SV5 A;  4BB3 A;  3G6J B;  3I8T A;  2QVS B;  3I3E A;  4UBH A;  4A2U A;  1UNB A;  2JDP A;  4JV4 A;  3PUA A;  3VHN A;  2YGM A;  3MFC A;  2JDA A;  4X6Q B;  2ZEW A;  1H0B A;  1UOT P;  1WCS A;  4QPG B;  5FZH A;  3FLR A;  5FZK A;  1LU1 A;  1Q8P A;  2XG3 A;  1UW8 A;  3Q8B A;  1V0A A;  2DBI A;  2JIJ A;  3L2H A;  1DGW A;  5AC9 2;  3D82 A;  4FAH A;  2AEN A;  4Q4X 1;  1V6L A;  2VOK A;  4GAL A;  3ES4 A;  4CDW A;  5DAQ A;  1MS3 A;  3DEM A;  2XUM A;  1UAI A;  4GXL A;  5CZK A;  1COV 3;  3R4S A;  2ZHN A;  4E2G A;  5IT6 A;  1OD5 A;  2TEP A;  1W6O B;  2P6C A;  4KWK A;  5FZ7 A;  4ONU A;  5IJR A;  3ZYI B;  2V72 A;  1OSG A;  1WCK A;  4NHX A;  1JYV A;  4TN7 A;  2CG7 A;  2MCY A;  1GWL A;  3CIH A;  4K6B A;  4LHL A;  4LKS A;  4Y22 B;  3M3I A;  5CVR A;  3W5M A;  1COV 2;  1JU3 A;  2A6Y A;  1FYU A;  3C7O A;  5IAV A;  5A32 B;  4V2W A;  4L9B A;  4LBQ A;  1FV2 A;  2VTF A;  3LOI A;  1W9S A;  3NV2 A;  3VD4 A;  5HYU B;  5C4W A;  4E4S A;  2J1T A;  4LJH A;  1ASJ 2;  1MS5 A;  1H2K A;  1YQ5 A;  1H6X A;  3DCQ A;  3LA3 A;  1H6Y A;  3FBM A;  2YY1 A;  4DXS A;  1L7Q A;  1HJF A;  4HLT A;  1H8T A;  4MGS A;  1NG0 A;  4Q4W 3;  4FPO B;  1QJE A;  5JSP A;  3VD5 A;  3AZW A;  1MD8 A;  3RWN A;  3B94 A;  1JOJ A;  4GUL A;  3WNM A;  3BTZ A;  2Z69 A;  2CU5 A;  3DYM A;  3POF A;  1JOD A;  1WGP A;  5KHG A;  1AR9 1;  3T4H B;  2ZKL A;  1O3T A;  3PJQ A;  2RJL A;  1QKQ A;  1W9F A;  5HCA A;  4Q4W 2;  3NKT A;  2ZPX A;  4IW3 A;  5JXI A;  5KR7 A;  1QDO A;  1QDC A;  1LUL A;  3VD3 A;  3POW A;  2HKX A;  2Q8O A;  1WLC A;  4KWU A;  3VDB A;  1DLL A;  5C5U A;  5EV7 A;  5CEH A;  2XKO A;  3I2O A;  1CAU B;  5EIY B;  5FO8 C;  3ORJ A;  2W87 A;  2D3R A;  2PLV 1;  3A22 A;  2ID4 A;  5FZ8 A;  4GMP 0;  4LE3 A;  3ZPY A;  4OLL A;  1TPG A;  2XGX A;  2A3X A;  4LIT A;  1UN1 A;  4QX0 A;  3LA7 A;  3WQ1 A;  3ACG A;  1YI7 A;  2VBD A;  5E8A A;  4AYI A;  3ZYB A;  1DQ5 A;  2FQP A;  5J36 A;  3PLQ A;  2ZHM A;  4QX3 A;  4ZZ8 A;  3DPR A;  1JTZ X;  1W39 A;  3PU3 A;  2YMZ A;  3O0X A;  1VB2 A;  1PK6 B;  4IE7 A;  3P1I A;  5A70 A;  2QCS B;  4OUM A;  5CFD B;  2KXL A;  3JZV A;  1H8T C;  3NFP I;  1NCQ B;  4QQL A;  3VBF B;  3VDC A;  3A0K A;  3QLQ A;  2NQY A;  5FUI A;  4FQZ A;  2XWJ B;  4QU2 A;  1QJX 1;  2PN5 A;  1CD3 G;  3V65 A;  3PTR B;  3I2F A;  2JKX A;  4JDO A;  1W05 A;  2VOX A;  1GYK A;  3VZO A;  1KEX A;  1P8J A;  1CAV A;  5F5A A;  1AR8 1;  4YZ1 A;  1KFU L;  1WA6 X;  5FY0 A;  1ZBE 1;  4RFR B;  2E63 A;  1Z7S 2;  4JDM A;  2FD8 A;  4JHS A;  3WNL A;  4NHK A;  2BPA 2;  3WSX A;  3MYX A;  4WZF A;  3I59 A;  1XNT A;  3ZPO A;  2XVL A;  2ZAH A;  2OUH A;  4BK4 A;  5JI9 A;  1AX1 A;  1XPW A;  3FHQ A;  3HBZ A;  2W39 A;  1URX A;  2R0F A;  1W9T A;  5FZM A;  4Q8L A;  2JDH A;  1AJK A;  1QH7 A;  3LQC A;  1CIY A;  2QQU A;  3F2Z A;  4XIL A;  3KS7 A;  1MQT B;  4YW7 A;  2X53 S;  3P6B A;  5EZW A;  5L7O A;  4C16 A;  4QX2 A;  4Y20 B;  2ENR A;  1UYY A;  4R52 A;  3GZU C;  3WF2 A;  1TPN A;  2RKY A;  3HBK A;  4YAR A;  2FHR A;  3QH7 A;  3T1M A;  5DN5 A;  3WSY A;  3PTY A;  1QIQ A;  4M01 A;  2Y0I A;  4N7U A;  4OUS A;  1XXN A;  2EC3 A;  1WMX A;  3DPR C;  4LUM A;  3KZJ A;  3POJ A;  1PO2 3;  1V6I A;  3TBD A;  2DVA A;  4DRV A;  3HT2 A;  4CSY A;  4D94 A;  1UZW A;  2D93 A;  2WS9 1;  4EWE A;  2QJV A;  4F4O C;  3BOD A;  4BQ5 A;  2ETE A;  3K3O A;  1AR8 3;  2UYA A;  2YXS A;  3NNG A;  4K9S A;  2WA4 A;  3OD4 A;  2GH2 A;  2QDR A;  1J3Q A;  4LNV A;  1S4C A;  1JI6 A;  1U5X A;  3JQX A;  4EN8 B;  4P9Y A;  5H9R A;  3I97 A;  1QJF A;  1PO2 2;  3HD8 B;  4IE0 A;  3WG1 A;  1UKR A;  1GBG A;  2W1Q A;  1A34 A;  1VLN A;  1Y43 B;  2RDN A;  2XWB B;  5B4X A;  1US2 A;  2GAL A;  4MHU A;  1IOA A;  4AW7 A;  4OUL A;  4QB1 A;  2O8O A;  3B9I A;  3ZIW A;  1H2P P;  2Y0O A;  3IWZ A;  3EJH A;  2JDM A;  2ZEZ A;  3M7A A;  2HWF 1;  4FCA A;  4PI2 A;  4QPW A;  4W6W A;  2CAV A;  5DUW A;  5IW0 A;  4AFC A;  3LOB A;  3T30 A;  5A7N A;  1F4H A;  4XAB A;  2UYB A;  5C3Q A;  2WKK A;  3AMH A;  4J1W A;  2BBA A;  3HN3 A;  3VBS B;  4PF1 A;  4UOJ A;  3IMM A;  1MVE A;  2AEY A;  5DG1 A;  3H8O A;  1O5L A;  3VBH A;  1RYY A;  2JEC A;  4CEW A;  4JDN A;  5FMB A;  5FP4 A;  5J98 B;  2W5F A;  3AM2 A;  3POB A;  4DFS A;  2FBE A;  2YDE A;  4MXW A;  1WW4 A;  3H42 B;  3BAL A;  1IS3 A;  5LA0 A;  2ZS6 B;  4O7X A;  1C8M 1;  1QU0 A;  1VAK A;  2SLI A;  3OY8 A;  1ST8 A;  5FPX A;  3CJI A;  1YWK A;  4LUL A;  1SBD A;  1VRH 3;  2TNF A;  1CN1 A;  3GJB A;  3R0R A;  5D8A B;  1IS4 A;  2VH9 A;  4LR4 A;  1GR3 A;  1ENS A;  1SFY A;  5FZG A;  1SG3 A;  1PO1 1;  2FDJ A;  4ZZ5 A;  5ABJ A;  3ZOI A;  4XET A;  2EIC A;  2VNR A;  4CCC A;  1YHF A;  4HKW A;  4BH9 A;  5IWF A;  1PMH X;  1J58 A;  2HWF 3;  4C1X A;  1D4V B;  1C3H A;  1MS4 A;  2XJT A;  1VRH 2;  2DCZ A;  2W3J A;  2O14 A;  2WSU A;  4ZS3 A;  3SCG A;  4BOW A;  3OGS A;  4CXX A;  2VUL A;  3LEI A;  1T6B X;  1CKL A;  4AWD A;  3RRD A;  2W2I A;  3Q8E A;  4FPG A;  3HNB M;  2VG9 A;  3CKH A;  2HWF 2;  1JU4 A;  2ZAA A;  4FVV A;  3IT8 A;  2E7T A;  2JD9 A;  4EN9 B;  4BQY A;  1C5H A;  1NCR C;  3AMM A;  4UFM A;  2J7M A;  1Z78 A;  1C8M 3;  1DGW X;  4W8J A;  3C7E A;  1NOV A;  2O8Q A;  4ZU4 A;  3M3C A;  4WBB A;  1SPP A;  2DF7 A;  4K7J A;  3VBH C;  2VXR A;  4CEW C;  4TXW A;  1ZYB A;  5I0U A;  1OVP A;  1PO1 3;  1UZV A;  1X8M A;  2GDF A;  4AQT A;  2VOV A;  2CKU A;  4JKM A;  1D0H A;  1W0N A;  1R08 1;  4COY A;  3GAL A;  2I07 B;  2VW2 A;  5EPA A;  4QDQ A;  5BUV A;  1KS5 A;  4FPF A;  1STM A;  2DTY A;  3CJI C;  5CYY A;  3O1U A;  4B2S A;  3BVC A;  4H2A A;  1LHW A;  3N9Q A;  4EZ4 A;  5KHK A;  3D4K A;  1WW5 A;  4BDV B;  3NAP C;  5LCW L;  5ABJ C;  5FLH A;  1O4T A;  5FPV A;  3I7D A;  3ZXA C;  4YZ3 A;  2WO7 A;  4NRQ A;  2YZ4 A;  1F2N A;  5B4N A;  4A41 A;  2Q8E A;  3T5O A;  4DY5 A;  4COW A;  2E7Q A;  2Q1M A;  5D1I A;  2QQW A;  1JOB A;  5IUQ A;  2VVF A;  3WF0 A;  5JZG B;  1VBE 3;  3RJ2 X;  2FZ2 A;  1OH4 A;  3OBA A;  5FLI A;  1DCS A;  3I2I A;  4S2H A;  4COV A;  2Y6K A;  1W8Z A;  4W65 A;  1WCD J;  3E97 A;  4RN5 A;  1EV1 1;  4DZG A;  1J1L A;  1R08 3;  5BPX A;  3WXP A;  1NLQ A;  1DU3 D;  4QXH A;  3ZMO A;  1VBE 2;  2RDR A;  5F7U A;  2D6N A;  3IX0 A;  5FKB A;  2QBX A;  2IFR A;  1OH3 A;  3U75 A;  3VN4 A;  1E5R A;  4DPN A;  4YZ4 A;  4CEY A;  3PNA A;  2XBO 3;  2YBY A;  3SCF A;  5FJK A;  1DIW A;  3NW4 A;  1GZ9 A;  5C8C A;  1AYM 3;  1R08 2;  4R9A A;  1XRU A;  4NPM A;  5HXV A;  3USU B;  3ILF A;  3IDB B;  1ND2 B;  2B9U A;  1G9F A;  1L7R A;  2WYS A;  3NNM A;  4PIY A;  3SXW A;  3TAY A;  4K21 A;  3VZL A;  4AEM A;  1YEW A;  1OK2 A;  4AQ2 A;  2P3J A;  4ET7 A;  5H9Q A;  2VZP A;  4AVV A;  4F7Z A;  2Y8K A;  4QKB A;  2XBO 2;  2KRI A;  1W3X A;  1NA1 A;  2ARX A;  4XVH A;  3IDC B;  1AYM 2;  5F5Q A;  2BEO A;  1H2N A;  3MID A;  4WJG 2;  3NJZ A;  4PQ9 A;  1EV1 3;  1W6M B;  2OZJ A;  1H1I A;  2XR4 A;  4FPJ A;  3D3A A;  3RWK X;  2RLP A;  1GP6 A;  2E33 A;  2BVB A;  2HWE 1;  2HH9 A;  4RQP B;  3U78 A;  4DNY A;  1K5J A;  5C6C A;  1EAH 2;  1SHW B;  2BQP A;  4KMQ A;  1OXC A;  4RHV 1;  4B1M A;  1G6N A;  2EXI A;  5BNP C;  4LLO A;  2WN2 A;  1EV1 2;  2IXK A;  4LUK A;  2W1U A;  3OBZ A;  1FPN 1;  4P9J A;  4XF4 A;  1DYP A;  5BNO A;  3A0N A;  3SIT A;  2A75 A;  2RR1 1;  4CP1 A;  3KHC A;  4AED B;  4LO7 A;  1CX1 A;  4WV8 A;  3AP7 A;  4DQA A;  4AYU A;  2BWA A;  1DDL A;  1SZB A;  2YPD A;  2VMC A;  3RZG A;  5FYC A;  4MLO A;  4MO3 M;  4LPL A;  5HYT B;  4OYU A;  3R62 A;  2Y8S A;  2J1U A;  2LRO A;  2XLG A;  2ZGK A;  3MW3 A;  4D7S A;  3WUD A;  5K9Y A;  3WW3 A;  1H2L A;  4QDR A;  5E88 A;  2XWB F;  1G9A A;  2HWB 3;  3RFR A;  4D69 A;  1GMM A;  2IWG B;  4LHN A;  4E9K A;  4Y24 A;  2RS3 3;  3IKW A;  4JQR A;  1X8E A;  3KT7 A;  4HSL A;  1XNA A;  1UY1 A;  3NV3 A;  3K3T A;  3NWK A;  3ACH A;  5I0R A;  2W1S A;  1RJ8 A;  1O4Y A;  2OPW A;  4I09 A;  2JE9 A;  1NA1 C;  2XJQ A;  2GME A;  3I2G A;  4RGK A;  5FZO B;  3SC7 X;  4AI9 A;  2AEZ A;  4RHV 3;  3DKQ A;  2DUP A;  5FZ9 A;  3RYK A;  3WNP A;  2HWB 2;  4Z2A A;  2QQJ A;  2WZR 1;  4WM7 B;  3U14 A;  5IAX A;  1HLC A;  2TUN A;  2WLP A;  5HCH A;  2BV4 A;  2ZOE B;  3HPN A;  3AZY A;  2RS3 2;  1QQP 1;  2X2Z A;  1FPN 3;  3W58 A;  3CU7 A;  4ES9 A;  4HFS A;  4OHX A;  3S57 A;  3ZXL A;  4YNI A;  3CNA A;  3ZXG A;  4NHM A;  1A8M A;  1AJO A;  4PT6 A;  3WF4 A;  2I2L A;  2P17 A;  2OS2 A;  4YNX A;  3ZDV A;  1JZ8 A;  4HK9 A;  4PDW B;  4RHV 2;  1AX0 A;  1QH6 A;  4UW5 A;  1VAV A;  1M4W A;  2FCV A;  2JWP A;  1F4A A;  1UWW A;  1TG7 A;  2Q30 A;  5JWP A;  2JKB A;  4XAC A;  1H1M A;  1LEC A;  2JD4 A;  2BNO A;  1V6M A;  1O9A A;  5GZE A;  4QPG A;  5BNO C;  3VD9 A;  4NMI A;  1EYB A;  4IGQ A;  1XNK A;  3AP5 A;  1C5I A;  3KCX A;  2QZ3 A;  1TNR A;  2X09 A;  4A5W B;  2JGW A;  1Y9M A;  4JHZ A;  4MHR A;  4RS5 B;  3WNO A;  1O7F A;  3RZL A;  3U0Z A;  5I91 A;  4YWA A;  2DFC A;  2IXL A;  3III A;  3IM0 A;  1PMJ X;  4K1Y A;  4DXT A;  4D6S A;  2PHX A;  5JI7 A;  3EXU A;  1GZW A;  3M3O A;  1POV 1;  4IQP A;  4YGD A;  4A45 A;  3ST7 A;  4AQS A;  1W6O A;  5IVC A;  4UXA A;  3E5X A;  3EJK A;  2DCJ A;  4NIG A;  3NMB A;  1X7N A;  1XU1 A;  1EPW A;  5FY1 A;  4IEW A;  4YGC A;  5FBZ A;  3QOP A;  3ZXJ A;  2D43 A;  4R9B A;  3S7I A;  1JYX A;  2VUA A;  1Q5O A;  2WII B;  4Y22 A;  2IC1 A;  4YFW A;  1DQ2 A;  2GSY A;  5FY4 A;  3K4D A;  3OBR A;  5A32 A;  3CF6 E;  5I93 A;  4EN0 A;  4KBB A;  2YFZ A;  3GBG A;  3OGR A;  1ZRC A;  2IVJ A;  1ZA4 A;  5JOX A;  3LSD A;  3VHO A;  1U5Z A;  3R4D B;  1G9B A;  4JGZ A;  4K8R B;  5FQ0 B;  3O1V A;  2XJV A;  2FDI A;  3SEP A;  2QUO A;  4BQ4 A;  3D8C A;  1HXS 1;  2F17 A;  2ZZQ A;  2BNM A;  4X6R B;  3IPV B;  2D7F A;  4XFB A;  1QOT A;  2JXA A;  1GWK A;  2VD7 A;  2C9A A;  4KNC A;  4XF0 A;  2JRA A;  4J38 B;  1AXZ A;  1LOA A;  4AAP A;  5I0T A;  3VV1 A;  1GKB A;  2PA7 A;  4IUG A;  5FRA A;  4TZD A;  4QPG C;  2BFU S;  4HPK B;  3FMG A;  4KU7 A;  1ZRD A;  2XL7 A;  1CWP A;  4XMI A;  2EAK A;  4XJA A;  3J8F 1;  3PUI A;  5L9B A;  4B4Q A;  5A3N A;  1S2K A;  2XHN A;  2CWM A;  3WUC A;  4Z07 A;  1CZV A;  3ILN A;  3BTX A;  3AP6 A;  3SKJ E;  4FFG A;  1I3H A;  1GU3 A;  1RIT A;  2MPF A;  4AVA A;  2DV9 A;  4RGA A;  5C7G A;  1GWM A;  4PI0 A;  1HRI 3;  3CHX A;  3ZX7 A;  1G4F A;  4B8E A;  4AFB A;  1XBF A;  2D40 A;  1HFH A;  1RXF A;  4Q0S A;  1CZT A;  3AP9 A;  3WCS A;  3C7G A;  5A1F A;  4XHX A;  2JB4 A;  4DIN B;  1AXY A;  1FX5 A;  3AVR A;  4Y33 A;  1XYO A;  3O0V A;  4F8A A;  5L7O B;  1JMU B;  3ELN A;  1HRI 2;  4QMA A;  1RUC 3;  3LEK A;  1RUI 1;  2PAE A;  4C0B A;  2VQ0 A;  4KQ7 A;  1YXW A;  3ZMN A;  1MS1 A;  1PK6 A;  1QOO A;  4OQ8 A;  4JVA A;  3MDP A;  5A7P A;  5IVE A;  2UUR A;  4QQH A;  5F6L B;  5J3U A;  2HEW F;  5CFD A;  1MS8 A;  4IEU A;  1LTE A;  4CDU B;  2RMU 1;  3PMS A;  4R9C A;  5K4L A;  2JG8 A;  5EQU A;  1OLM E;  5F3C A;  1RUC 2;  4LK6 A;  2ARA A;  2L9L A;  4YW5 A;  1LB2 A;  4OCT A;  2ZML A;  1ULC A;  2EIB A;  3FBY A;  5FBJ A;  5KWR A;  3FHI B;  5KC5 A;  4Y1U A;  4H14 A;  2PHD A;  4XZP A;  1BXH A;  1FI2 A;  4IV1 B;  4HET A;  2J22 A;  4UFI A;  2X8K A;  4IV3 B;  1GFF 2;  5LW9 A;  2EAL A;  1PIV 1;  2JDY A;  2D6M A;  4MGT A;  4PLO A;  4KL1 A;  3PME A;  5FPU A;  3TEW A;  4I3P A;  3HAG A;  2RS1 1;  1UL9 A;  4IEY A;  3ZYJ B;  2DYC A;  1RUI 3;  2WLQ A;  4BLJ A;  4P00 B;  4NRO A;  2XJR A;  4BQW A;  1MQT A;  4FXK B;  3KVA A;  1O91 A;  4CYD A;  4LKF A;  4Y20 A;  4QM8 A;  5LEJ A;  2CYF A;  5CIS A;  1PGL 1;  3BUC A;  3VGI A;  2FZ1 A;  2ORZ A;  3D6E A;  1WKY A;  5ANN A;  1RUH 1;  4UAP A;  2A6W A;  2N7G A;  2K9Z A;  4Y3O A;  5T5J A;  3WHU A;  2I74 A;  2RMU 3;  2VXJ A;  5C3R A;  3RGB A;  3N7J A;  3OJB A;  5ERL A;  1GQG A;  3N36 A;  1O6U A;  1ZZ7 A;  3GZA A;  3MLJ A;  3JB4 C;  3NQH A;  4ZS2 A;  5KHH A;  1LCL A;  4DXZ A;  4BWC A;  4CU8 A;  1QMJ A;  1LKN A;  2MNG A;  3BPS A;  4IEZ A;  1PK6 C;  2WO3 A;  4QXC A;  4CUG A;  3MUZ 1;  1AHS A;  4FTS A;  2WAO A;  1CPM A;  1DLC A;  1X82 A;  5CFD C;  1NCQ C;  3IMN A;  3VBF C;  1OMI A;  2ZGP A;  3HEI A;  3ILR A;  4YRD A;  5A1A A;  2G7I A;  2RMU 2;  1LU2 A;  2HEV F;  2R07 3;  4L2N A;  3MQL A;  1C57 A;  1CR7 A;  2YGL A;  3KV5 A;  2GAU A;  1H30 A;  4M4R A;  4YPJ A;  1KDK A;  4I0W B;  3UT0 A;  4LBJ A;  2YRA A;  1H2M A;  1ZRR A;  2KA3 A;  3PUS A;  4BZ4 A;  4M3C B;  3C7F A;  5FPA A;  1O3Q A;  4BQ3 A;  2XLF A;  1A3K A;  1FV3 A;  2R07 2;  4N43 B;  4QGM A;  1H03 P;  3MBW A;  3GZE A;  4NAO A;  1PHM A;  1QJU 3;  4L97 A;  4CCK A;  2WAB A;  1RUH 3;  3POS A;  3QAC A;  4FQ4 A;  5DAB A;  3SQO A;  2NMN A;  2XXZ A;  3IN9 A;  4MVT A;  3U4S A;  3USS A;  1GOF A;  3JB8 A;  3VBS A;  4P9G A;  3I3Q A;  1YI9 A;  4G3Y C;  3T3Y A;  3KCC A;  4UF0 B;  4S2F A;  1TME 1;  4CCD A;  4QX7 A;  1MQT C;  5A7Q A;  1OPM A;  1WWY A;  3N9N A;  1NAE A;  4AG4 A;  1A78 A;  2AR6 A;  2YC2 A;  3NJX A;  2VL4 A;  5DAX A;  5BY5 A;  1QJU 2;  3IIA A;  3M4F A;  4GKY A;  4B3N A;  5K8S A;  1RUH 2;  3BB6 A;  5LRS A;  4CRQ A;  2E9Q A;  2VUJ A;  3W9A A;  2NLR A;  2A6Z A;  2W81 A;  4XDP A;  4ZON A;  5C70 A;  3WVJ A;  5D8A A;  4XJ9 A;  2P37 A;  3N9O A;  4AYE A;  2IXJ A;  3NVC A;  1F9K A;  3OP8 A;  1KQR A;  4QDS A;  5FO7 B;  3WHT A;  5ANQ A;  2BER A;  2XQR A;  3WQB A;  5I8S A;  2WFF 1;  2BRT A;  3I3M A;  5J37 A;  3RZM A;  4FP2 A;  4LQR A;  3ZLI A;  4OMC A;  1W99 A;  1K5M B;  1S0J A;  4FI9 A;  3VKO A;  4DO0 A;  5KHJ A;  1IZ3 A;  1XSQ A;  3LEM A;  1AR7 2;  2VCA A;  4RD7 A;  3SMH A;  2LTN A;  3B9C A;  3KF5 A;  5A33 B;  5K0U B;  1DYK A;  4LOR A;  1OD3 A;  3BCW A;  4O9E A;  3WW2 A;  2R0H A;  4CDQ B;  5IFP A;  1NLR A;  5I0S A;  2BW8 A;  3MI8 A;  3QCW A;  4ISR A;  2HYK A;  5A7S A;  4CCE A;  1VMH A;  4E2S A;  3Q8C A;  2WBK A;  2Y8T A;  1H4H A;  1G9C A;  2Y38 A;  4DJZ A;  3KHB A;  4FPC A;  4GH4 B;  5FIX A;  5JIU A;  1GP4 A;  1UD1 A;  3CMG A;  4LBN A;  1UX7 A;  2IFW A;  3EQE A;  1VRB A;  4TYS A;  3VBS C;  1C1F A;  1NZI A;  4ORF A;  4XJU A;  5CAZ A;  1F15 A;  1XQN A;  2E51 A;  5KBF A;  1FAY A;  1N1T A;  4MGK E;  2VZR A;  1SRZ A;  3DL3 A;  1FNZ A;  3ZXD A;  4X8N A;  1BK1 A;  4K8F A;  2JG9 B;  3H1W A;  2GH8 A;  3MW2 A;  4HBN A;  1KXG A;  2WNU B;  3PVE A;  5DZE A;  5I8T A;  4YSF A;  1OK9 A;  1KDM A;  4GB3 1;  1C8N A;  1VP6 A;  4SBV A;  2WFF 3;  5J48 A;  2YYO A;  3AKP A;  5DAV A;  3AYA A;  4FOV A;  1GOG A;  4LE4 A;  1UYX A;  2OQ6 A;  5FUP A;  3MV1 1;  4YW6 A;  2VOT A;  1JHN A;  1ND3 A;  2JE7 A;  2Q5T A;  2ZGL A;  3VDD B;  1NQD A;  1QY4 A;  2ES3 A;  2WZE A;  4Q4X 3;  4IE4 A;  5D8A C;  1JYN A;  4QPY A;  1JZ6 A;  1LOB A;  4IEP A;  3TEZ A;  2WFF 2;  5DPN A;  2ZYC A;  2DWR A;  1OA3 A;  3AX4 A;  5FLJ A;  5FPZ A;  1YLL A;  3W21 A;  2PHF A;  3W5N A;  2WSV A;  3AL6 A;  1HQN A;  3CQO A;  3ABZ A;  3FZ3 A;  3JBG 1;  4FPH A;  4JRL A;  4Q0V A;  3HWJ A;  3NJY A;  4Q4X 2;  2W46 A;  3WW4 A;  4CZS A;  1HIX A;  1KIT A;  2WT0 A;  4B29 A;  4B1L A;  5JZG A;  1QXP A;  4GIQ A;  5CKM A;  5ISL A;  3ZR6 A;  4EWA A;  4XTM A;  5G04 L;  1S0B A;  3CEW A;  3AXD A;  1OF3 A;  4U36 A;  3OEA A;  1J83 A;  4CCM A;  3AK0 A;  1O4Z A;  2XRD A;  3KV9 A;  4FP3 A;  2W91 A;  4WVM B;  1MZF A;  2VJX A;  4JTN A;  4N53 B;  1HRV 1;  4I01 A;  3DV8 A;  3GXE A;  2BP6 A;  2AC1 A;  4LA2 A;  3CBN A;  4YW2 A;  4AL9 A;  5EFU A;  1W2N A;  5FXW A;  4FT8 A;  4CUA A;  1OQD A;  4QX1 A;  2A55 A;  2XH6 A;  3B3Q E;  1I6X A;  4NUB A;  4D7T A;  2NZ9 A;  4YG6 A;  1S2E A;  5AFB A;  1OC1 A;  5C8W A;  3LIG A;  5JOW A;  1PX3 A;  4GD4 A;  1OKQ A;  1UU4 A;  1VMJ A;  3WQ7 A;  1O8P A;  1UKG A;  2R04 1;  2WDB A;  2EXH A;  1ZNP A;  2CDP A;  2B7Y A;  2Z2S B;  1JUI A;  2LRP A;  4G9S B;  3PL0 A;  5BXX A;  2Y60 A;  3USU A;  1W8F A;  5IVV A;  2OVU A;  4FTE A;  1ND2 A;  1AR9 3;  1ND3 C;  1R09 1;  3AMN A;  5F3G A;  4QB6 A;  4OQ9 A;  2RKZ A;  4BME A;  1ULD A;  3ERB A;  2WRA A;  4BPZ A;  3AC0 A;  3LPG A;  4BLI A;  1J1T A;  2VO5 A;  3DUI A;  4ZKT B;  3H7J A;  4IEQ A;  1IKQ A;  5D2A A;  4QKF A;  3VUO A;  1PVC 1;  1W9Y A;  2D3S A;  1AR9 2;  4NRP A;  2DVF A;  4XZU G;  5FRE A;  2AYH A;  1QJY 1;  2PLV 3;  1HRV 3;  1VB4 A;  2G1M A;  2MHF A;  3LEG A;  5JZG C;  4RQP A;  4RYD A;  3ZD1 A;  2R32 A;  2WWU A;  2JDZ A;  3GDB A;  4W4Z A;  1X33 A;  2C1F A;  4AI0 A;  3VZJ A;  3ZYG A;  3NNJ A;  3I2J A;  4AI3 A;  4R8H A;  4QHO A;  3L89 M;  2W94 A;  4Z2W A;  2XQW C;  2A5Z A;  1UOJ A;  1UYZ A;  2PLV 2;  3U10 A;  1HRV 2;  4BQ1 A;  3RZK A;  2ILM A;  3OGJ A;  4GWJ A;  4AED A;  1Z0H A;  3KCY A;  5C3O A;  1NXD 1;  4M00 A;  1R09 3;  1HJG A;  2WNV B;  2P34 A;  5FK8 A;  4AVC A;  1AX2 A;  1B35 B;  2BDR A;  4BXS V;  5JPN B;  2VMH A;  3OCP A;  4Q0U A;  4UFJ A;  4CP0 A;  4ASM B;  1WZX A;  4Z1V A;  1OA4 A;  1EUT A;  1QJX 3;  4G4F A;  4ATF A;  2H0V A;  1PVC 3;  4NOT A;  4N7I A;  1ND2 C;  2MEV 1;  3KQ4 B;  2O39 C;  4M3C F;  4XC9 A;  1VVD A;  3SEE A;  1UMH A;  5T55 A;  1ZBE 3;  2RS5 1;  1IHM A;  3L2Y A;  5CKN A;  4TSV A;  5T3N A;  3VHR A;  5FZ6 A;  5IK8 A;  4XXP A;  3OBT A;  4WM8 B;  4CP9 A;  2ADE A;  4MGY E;  4NE9 A;  4QXB A;  1QJX 2;  1XB9 A;  5FZO A;  5H9P A;  3T2O A;  3WDX A;  2VCC A;  4PBO A;  4EE2 A;  3FFZ A;  2VR4 A;  1I9R A;  1PVC 2;  1YQC A;  3ZYR A;  2FDG A;  4WM7 A;  1GPZ A;  3MO4 A;  5JMO A;  1U0A A;  1YNA A;  2DUR A;  3AXE A;  1O3R A;  3CDZ B;  1AR8 2;  2OPK A;  4QPI B;  4Q0P A;  1JZ4 A;  1ZBE 2;  1RTV A;  2P5B A;  4CU9 A;  4DUW A;  1NE4 A;  3H1Y A;  3ZLE A;  2E53 A;  2EXK A;  1HFI A;  2GU9 A;  3BYW A;  4RQP C;  5JSO A;  2Q1Z B;  2E7A A;  4PDW A;  1NX9 A;  2JEN A;  2A3W A;  4KWL A;  5BNN B;  3FLP A;  3J7N A;  4MUC A;  3V0A A;  3V0B B;  1NCR A;  3M70 A;  1HKD A;  4A6O A;  3O1T A;  1DBN A;  2X10 A;  1W0O A;  4XHB A;  3RYR A;  2YBP A;  1W8T A;  1OOP B;  1JYC A;  1YFW A;  3K51 A;  5FYT A;  3K77 A;  2NN8 A;  4FPE A;  2NM1 A;  1FXZ A;  3ZYP A;  4I2O A;  2WS9 3;  2WQZ C;  4AED C;  1RUD 1;  3OB8 A;  2YU1 A;  2WNO A;  2MEV 3;  5E16 A;  3AKT A;  4RS5 A;  2TBV A;  2JIG A;  3J7L A;  4LBK A;  1RXG A;  2RS5 3;  1OFN A;  1IPS A;  1YIP A;  4ATE A;  4MXV A;  3JCI A;  3ZFF B;  4Q4V 1;  4XUR A;  4NR1 A;  4LXL A;  2PYT A;  4YM3 A;  2WS9 2;  3GXU A;  3NAP A;  4A7Y A;  3TNP B;  4MAD A;  1W04 A;  5FMO S;  4M0N A;  3PIG A;  2RS5 2;  3B7M A;  5FR3 A;  3Q8F A;  4PIX A;  1FNY A;  1PZ7 A;  2ZGO A;  3VKF C;  2D6L X;  1WLT A;  3AYD A;  2VBP A;  3R4U A;  5IHR A;  1JYI A;  3ZRZ A;  3LIH A;  1NXM A;  2W47 A;  4MOA A;  4LBL A;  4Q4Y 1;  4YGB A;  1L3J A;  2B45 X;  3TN9 1;  3ASI A;  1ACC A;  4WM7 C;  1VBC 1;  1SQ4 A;  2DVB A;  3PUR A;  1RB8 G;  1DGL A;  4RSU A;  2VNG A;  3TWI A;  4J25 A;  1XYP A;  3LKJ A;  1SCS A;  2BOI A;  2Y6H A;  4U2A A;  1ZRF A;  3ALQ A;  1W2U A;  4ZU7 A;  4XDQ A;  1AYN 1;  5FQ0 A;  1LR5 A;  1RUD 3;  1OA2 A;  2ZGT A;  3A7Q A;  4EQV A;  5JUV A;  3VBU B;  4Q1R A;  5LBF A;  2QNK A;  4PDW C;  1FOD 1;  2QTW B;  3IPV A;  3MPB A;  4E8C A;  1JZ7 A;  3AB0 A;  2CGN A;  4LHS A;  2WC2 A;  3MIE A;  2K46 A;  4JTO A;  3U1X A;  3ES1 A;  5LA1 A;  2ZHK A;  5KHI A;  4HPK A;  4BU2 A;  1KRI A;  2UWN A;  3PU8 A;  1H04 P;  4V2V A;  1RUD 2;  4NHL A;  1G8W A;  4Q27 A;  4YYO A;  4CCL A;  4CDW B;  4JRA A;  4RS5 C;  2XJS A;  2DU1 A;  5FDB A;  4FOY A;  4KWJ A;  1W2O A;  4HMZ A;  4CP2 A;  1W90 A;  1X50 A;  1C8M 2;  5A7W A;  3N35 A;  2WWS A;  5BNQ A;  4BHP A;  3AKR A;  4CCN A;  2WT1 A;  1W8W A;  3A21 A;  4BA6 A;  3IU3 I;  1GV9 A;  3SH4 A;  4FXG G;  4CSW A;  4Q4Y 3;  5FWE A;  4Q2F A;  5FZC A;  2ZX4 A;  4E4Z A;  2YV8 A;  3UK9 A;  5FOJ B;  1VBC 3;  3WNX A;  4ARY A;  1PO1 2;  2DBN A;  4LBM A;  2DDU A;  1RED A;  5LWB A;  2Q8C A;  1VR3 A;  4AFM A;  3NJA A;  2ZEX A;  3MHZ A;  4AI2 A;  3GF6 A;  2WII C;  4XW3 A;  1ULF A;  1UPI A;  4COU A;  3EO6 A;  1FOD 3;  2R1B A;  3FGT A;  4IEX A;  5C4W B;  1VBC 2;  2G19 A;  2ZMK A;  3O1S A;  2LUW A;  1SCR A;  1AXK A;  1C28 A;  2ZBJ A;  3OPZ A;  5E1R A;  4D3W A;  4FO9 A;  4HL0 A;  4GWN A;  1C1Z A;  1ZBA 1;  2A1X A;  4FPL A;  4ISQ A;  4UW3 A;  1PX4 A;  4Y26 A;  4YVW B;  5FZ3 A;  3V64 A;  3H8U A;  1EPZ A;  2C9K A;  3ZN6 A;  4A6S A;  5BNP A;  2P4E A;  1NUK A;  2VC9 A;  3BPZ A;  5DZG A;  1DG6 A;  1U5Y A;  1XE7 A;  1MAC A;  2DU0 A;  3MIG A;  5LAS A;  5EHD A;  2VME A;  1SS2 A;  2CNA A;  3PDQ A;  4MGZ E;  4F3J A;  5JOY A;  4CCJ A;  4IES A;  4XMA A;  5LY2 A;  3HIF A;  4KKD A;  4LIV A;  1LED A;  4XFF A;  4CDX C;  5HV0 A;  1YFX A;  2R06 1;  3C3V A;  4JX0 A;  5DUX A;  3WLU A;  2PAM A;  2EIE A;  5FYS A;  2Y64 A;  3WDW A;  1E8B A;  3TRS B;  2GC3 A;  1CAW A;  5FYB A;  1LOE A;  1LEM A;  4IV3 A;  4OHW A;  5GAL A;  1U5M A;  1QJZ A;  2Y33 A;  1SFP A;  1WBL A;  2A73 B;  3AYE A;  2AZ5 A;  4Q1P A;  3VBR B;  4HVO A;  3OG2 A;  5LRR A;  2VMF A;  3MIH A;  1J3P A;  3MV0 1;  3Q9O A;  3WF1 A;  5C9A B;  1LHN A;  4UW6 A;  5FP8 A;  4H3W A;  3KXV A;  1UOF A;  4XFG A;  3ZFE B;  3RS6 A;  2BUK A;  4FFF A;  3ZXF A;  4IET A;  1RJ7 A;  1HX6 A;  4Y1X A;  1A6C A;  4PCR A;  3ITQ A;  1OT5 A;  3IB3 A;  3OOX A;  5LA2 A;  1GZT A;  1F31 A;  2WO2 A;  2ZGQ A;  5F8P A;  2PHT A;  4XF9 A;  5L7O C;  1RUJ 1;  4NVP A;  5F5I A;  1WW6 A;  3R05 A;  2R06 3;  4HKL A;  4WVW A;  2VZ1 A;  4YIZ A;  4UW4 A;  5LA9 A;  4CE8 A;  1QWR A;  2VY0 A;  2D6O X;  3C8X A;  3LFM A;  2OKX A;  1F8V A;  3GOV A;  2R16 A;  3RG0 A;  4CDU C;  3MLK A;  2DCT A;  1ZZ9 A;  2QE3 A;  4F83 A;  4MX3 A;  4ZU5 A;  2WUH A;  1NY7 1;  2QQM A;  1RLH A;  2SBA A;  4Y5S A;  2PHL A;  3U11 A;  4BM8 A;  1HQW A;  2R06 2;  3E5Q A;  3K4Z A;  2OYZ A;  1UO9 A;  1UIJ A;  2WQ8 A;  3KWV A;  4D6R A;  1V00 A;  2VCB A;  5DN4 A;  2BTV C;  2R7E B;  2ZAC A;  3UKT A;  4BQ2 A;  4WVZ A;  3P3P A;  4APL A;  3M2M A;  4IV1 C;  5A6Y A;  4IV3 C;  4N43 A;  5C3P A;  3VD7 A;  1VBA 1;  3FHA A;  1PGS A;  3L9J T;  1M06 G;  1RUE 1;  2WIN B;  2ZX0 A;  1Q8O A;  5CAD A;  3OD0 A;  2RLQ A;  4RA0 A;  2HWE 3;  3ETP A;  4M0H A;  5DN2 A;  5A1L A;  2Q4S A;  3K75 B;  4A3Z A;  1K3I A;  1S0E A;  3M8L A;  4UF0 A;  5JPM G;  2K2S A;  4C0H A;  1HDK A;  4CXY A;  1EY2 A;  4GJZ A;  2E31 A;  4QKD A;  5DUU A;  1BEV 1;  3SNM A;  1MZ5 A;  5T5L A;  2W80 A;  3MEP A;  1FAT A;  3T2Q A;  3BI3 A;  2HJI A;  2HWE 2;  3ZM8 A;  2RR1 3;  4CUC A;  4TTG A;  4XJ8 A;  4Y5T A;  3MPP G;  3THC A;  3W20 A;  2NYY A;  4DS0 A;  3J9S A;  2BWC A;  5FWJ A;  5HI0 A;  2VVE A;  3MFA A;  4PQQ A;  5DXD A;  3VL8 A;  4Z82 A;  1SDD B;  3UGG A;  3WDV A;  3EMR A;  3WOG A;  1MZ6 A;  2DTW A;  2D97 A;  5LZ6 A;  3WDY A;  1ZZC A;  3B00 A;  1FPN 2;  4XBL A;  2LOJ A;  1D2S A;  1ZRI A;  1H9W A;  2RR1 2;  3UV9 A;  2FDF A;  4M4P A;  4LKE A;  1DP0 A;  1OQE A;  1VBA 3;  2XLA A;  3QD6 A;  5FV3 A;  1RUE 3;  4E2Q A;  2VZ3 A;  3RJ3 D;  1XU2 A;  2WZ8 A;  1JUH A;  2ARC A;  4IGO A;  5T50 A;  4OZX A;  3T0B A;  4AHY A;  3WZ1 A;  4BIO A;  3WP3 A;  4A4A A;  4AGG A;  2GP3 A;  1ZRE A;  1W8H A;  4XQ4 A;  5FTT C;  5K0U A;  4AAX A;  2DFB A;  1AUY A;  3WP4 A;  1BK0 A;  2XOM A;  1NZC A;  5GZD A;  4N43 C;  2ZCW A;  2VAU A;  1ULG A;  2WZR 3;  1VBA 2;  1QUB A;  4ZH1 D;  2ZEY A;  5T5P A;  1HN0 A;  1RUE 2;  2NPI A;  4EN7 B;  1BEV 3;  1VMF A;  3A4U A;  1QQP 3;  1J59 A;  1I5Z A;  2VTX J;  2PEL A;  1HN1 A;  1Y9Q A;  3ACI A;  5FOB B;  1NE6 A;  4JZR A;  4I0B A;  3MUY 1;  3KVB A;  1F5J A;  4AYM A;  5GZG A;  4ONT D;  3GM8 A;  4K40 A;  4Q0Q A;  4HN0 A;  4MXW B;  3U07 A;  3B5L B;  5KXC A;  4AYD A;  4AXO A;  4FBF A;  2R1D A;  5CIR A;  2YC0 A;  1S0F A;  5FXZ A;  2WZR 2;  2JG9 A;  5FZL A;  4OI1 A;  4YG0 A;  3KQR A;  3OY8 B;  1ELV A;  1QQP 2;  2VQA A;  3T09 A;  4N9H A;  2V4A A;  3UKV A;  1XND A;  3ZFG B;  4AVS A;  5A3L A;  3T0A A;  4I3G A;  5AFE A;  3PJY A;  1JOP A;  5FPB A;  3X29 B;  3GHN A;  3I2K A;  1UIK A;  3FE5 A;  5F2W A;  1OQ1 A;  2QQN A;  1WCU A;  1WW7 A;  2WNE A;  5F3E A;  2D6K A;  1GZC A;  1KJR A;  1Q56 A;  1V6O A;  2OQ7 A;  2ZA9 A;  4A3X A;  3EHK A;  1POV 3;  4YZ2 A;  4P9W A;  3EB7 A;  1CPN A;  1O8S A;  1K5M C;  1MEC 1;  5FYH A;  1VAM A;  3S5A A;  2UY8 A;  4XUN A;  1C1L A;  3FC0 A;  5K0U C;  4QT6 A;  2EID A;  1RUG 1;  4GJY A;  4AVT A;  4ZXK A;  4CDQ C;  1J3R A;  1EUU A;  2NMO A;  3NV1 A;  1T2X A;  3OUJ A;  3E5U A;  5DDJ 1;  4AHZ A;  3CI0 J;  3I3D A;  4LK7 A;  4YW1 A;  5M0T A;  1AL2 1;  1CAU A;  5FYZ A;  4CA9 A;  1ENR A;  5A3P A;  4GH4 C;  4XXA A;  3ETQ A;  2VUD A;  2H0B A;  4N53 A;  5FY9 A;  3BTY A;  1XNC A;  3NRU A;  1OVS A;  1HXS 3;  1RGS A;  1VBB 1;  2QDN A;  1NQJ A;  1ZX5 A;  1QGL A;  2ARB A;  2JG9 C;  1G86 A;  2WNU C;  2XJP A;  1ZA7 A;  1G7Y A;  4FOQ A;  1RMU 1;  1D0G A;  4CPB D;  1SLB A;  4IGP A;  1A8D A;  2B8M A;  4ZPI A;  1XYN A;  5HCB A;  1XOY A;  3FUO A;  3J8F 3;  1ALY A;  3VDD C;  1HXS 2;  3T2T A;  5L9R A;  1MEC 3;  4P5H A;  4OHY A;  2VBB A;  1JW6 A;  1NCQ A;  2QQV A;  3N9L A;  3VBF A;  5HXM A;  2QKD A;  2VNO A;  5BYN A;  2LS6 A;  4D6Q A;  4XFH A;  4GKX A;  1RUG 3;  5DAP A;  1RUF 1;  5JXH A;  1DHK B;  2DUO A;  1Q8S A;  2EVX A;  5DDJ 3;  1BJQ A;  3OPW A;  5CKQ A;  3VBO B;  2V09 A;  1JXN A;  3ZSL A;  3HVD A;  3J8F 2;  1U5I A;  4PBP A;  4MGI E;  4R4X A;  4UWD A;  1N3O A;  3B01 A;  1MVQ A;  1J84 A;  1DF0 A;  4O9G A;  1ZJK A;  5JVV A;  1TPM A;  2GN7 A;  1RUG 2;  3CAL A;  1VE0 A;  2KR2 A;  1LOD A;  2BNN A;  1VBB 3;  2XL9 A;  3C2U A;  5DDJ 2;  5CFC B;  1BZW A;  2IXI A;  3UGF A;  4DB5 A;  3AVS A;  1FMD 1;  1ZVF A;  5EJ1 B;  1LGC A;  5FZ1 A;  1PGW 1;  1RIR A;  3ROU A;  4N53 C;  4QX5 A;  2GNB A;  2F4L A;  4WVV A;  2DVD A;  5I8Y A;  1KFX L;  2D6P A;  4NWW A;  3WT3 A;  4AI1 A;  4CEY B;  3NKG A;  2CY6 A;  2WNV A;  4ARX A;  1RVF 1;  3F6K A;  1VBB 2;  3LPF A;  4LBO A;  3MIC A;  1HV0 A;  1QXJ A;  4JC1 A;  3RDI A;  1YFY A;  4HT1 T;  5C8C B;  1MS9 A;  4KBZ A;  5HPO A;  3JU9 A;  2C24 A;  3J7M A;  4CUB A;  1ULP A;  1OK1 A;  2VPV A;  2ERJ A;  1JBC A;  1UF2 C;  3BU7 A;  1LOF C;  1RUI 2;  2HWD 1;  1RUF 3;  3LCP A;  1GHQ B;  2YBK A;  4GMP 1;  4KGG A;  4LHK A;  5GLZ A;  3TNQ A;  1WLW A;  2VVD A;  4LOS A;  4A44 A;  4FFI A;  4ASL A;  3JXS A;  1U12 A;  2RL0 A;  1IS5 A;  3N3H A;  3AJZ A;  2C4X A;  3DEC A;  2UY9 A;  4LMF A;  5KXE A;  4IEV A;  3EBR A;  4AF9 A;  1GQP A;  5KXD A;  4WM8 A;  2RG4 A;  1PIV 3;  1VIW B;  3FGR A;  2VMD A;  3LFI A;  3SKV A;  3M7P A;  1YQ8 A;  1W3V A;  3B02 A;  2VZV A;  4HVR A;  4JKL A;  2GZW A;  5GZF A;  4D0Q A;  1FMD 3;  2DCK A;  2I45 A;  2P6H A;  3D0S A;  2RS1 3;  4S2D A;  4QM9 A;  3M3Q A;  4QPI A;  4I02 A;  3VKN A;  1JH5 A;  1BHG A;  3TOJ A;  2IZW A;  4OMD A;  1HB3 A;  2GNT A;  1PIV 2;  1BKZ A;  1XC6 A;  2D5H A;  2VEC A;  1FBR A;  2Y34 A;  5FP7 A;  1GOH A;  1SLL A;  3O7O A;  5JDB A;  2C26 A;  5J7M A;  3LF7 A;  2P3Y A;  3O1P A;  2G9Z A;  2VZQ A;  4L11 A;  1FMD 2;  1S0I A;  3V0B A;  3H8R A;  2D3P A;  2RS1 2;  4S2G A;  5F37 A;  5DZF A;  5IK5 A;  1OOP A;  3LGR A;  4AEJ A;  1POV 0;  2XB6 C;  5F3I A;  3RJR A;  1O59 A;  5AC9 1;  1TNF A;  2GP5 A;  2K0G A;  1E88 A;  1ULO A;  1PGL 2;  2EA7 A;  4XQW A;  1DGR A;  2XKP A;  1TEI A;  2WNV C;  4UYB A;  3TEY A;  1WBF A;  1B35 C;  4PHZ A;  1OBN A;  2PTM A;  4HVQ A;  1IPK A;  3ZFF A;  4BJ0 A;  4NIH A;  2OW4 A;  3VKM A;  1QO6 A;  4IND A;  1OPO A;  3TEX A;  5JCT A;  3AMQ A;  1UMZ A;  1LGN A;  1PM7 A;  1SEF A;  2D44 A;  1UPS A;  2VZS A;  3NL1 A;  3I2D A;  2GMM A;  4IEO A;  3ZXE A;  1W6P B;  3JQW A;  1AZD A;  1CAX B;  1TMF 1;  1S0C A;  1T6G C;  5FFO C;  4URT A;  4WM8 C;  2VZT A;  3ZYH A;  5FXX A;  3O12 A;  3RZJ A;  1BYH A;  4KI5 M;  1GKG A;  4O65 A;  5FYI A;  2W0X A;  2R6Q A;  3RNS A;  1ASJ 1;  1UOG A;  1Q3E A;  1BQP A;  2BFU L;  2VMG A;  4XFA A;  4QPI C;  2ZGN A;  1TME 3;  2CWS A;  5L9V A;  3UJQ A;  1GNH A;  4LA3 A;  1W2T A;  3AFG A;  4FPK A;  3TVJ A;  3B69 A;  1VBD 1;  3VBU A;  2VTX A;  4SLI A;  2WWJ A;  5I0D A;  2X5I B;  1IG0 A;  5BNN C;  3T2P A;  1UY0 A;  4PIZ A;  3JUU A;  1H2Q P;  1LNS A;  1OOP C;  4NWV A;  4QKN A;  1ODN A;  1SBF A;  1TME 2;  3ACF A;  4UI9 L;  1DQ0 A;  4XQD A;  1UXX X;  5FAX A;  5A80 A;  4Q4W 1;  1ZZ8 A;  3ATG A;  1Y4W A;  3INA A;  3WCR A;  1LOG A;  2EIG A;  3GJA A;  4CDX B;  4RL7 A;  3ECQ A;  1TMF 3;  1GZW B;  2YHJ A;  1BBT 1;  3R6S A;  4DXR A;  2LM3 A;  5A3T A;  2FDK A;  4AE2 A;  3ZFF C;  1DFQ A;  4CTE A;  2PFW A;  1JYT A;  3POE A;  4NHY A;  1W6N B;  1MR5 A;  4UFH A;  5FZF A;  3RI9 A;  5EP9 A;  1ASJ 3;  1ENX A;  1K42 A;  3S30 A;  5T52 A;  1JZ5 A;  2EHF A;  5EJZ B;  1TMF 2;  3WG3 A;  4QAW A;  4E27 A;  3FL7 A;  3WW1 A;  4AZZ A;  1VBD 3;  1YYN A;  2BGC A;  2IZ4 A;  2GC0 A;  4P02 B;  5LBC A;  1QOS A;  4AGV A;  1R1A 1;  4JGZ B;  3O1O A;  5GJ6 A;  3E6D A;  3RPQ A;  5CG8 A;  2PMW B;  4OHZ A;  2GC2 A;  4UFK A;  4YVW A;  1SFN A;  5FUN A;  2OII A;  2ZGS A;  3OYW B;  1VBD 2;  3VBU C;  2Y8R A;  1OI6 A;  4HAN A;  3SH5 A;  2PXJ A;  4GB3 3;  2DUQ A;  2JX9 A;  4L92 A;  5FKC A;  5CB7 A;  1BBT 3;  1ZZB A;  1W6Q B;  2XWJ I;  1BLZ A;  3WV6 A;  4IL7 A;  1OUX A; 
#chains in the Genus database with same CATH homology
 2B5I D;  1PPQ A;  2EC3 A;  3KZJ A;  3POJ A;  4CSY A;  2QQM A;  4F4O C;  1LY2 A;  3ZD1 A;  5HYU B;  1E88 A;  3T5O A;  1OJW A;  2V8E A;  4YNX A;  4LOR A;  2UWN A;  1H04 P;  3L89 M;  1HCC A;  2XQW C;  3O8E B;  2QQO A;  1O9A A;  1VVC A;  2RLQ A;  1QO6 A;  4DJZ A;  1MD8 A;  2QQK A;  3IU3 I;  4A5W B;  4FXG G;  5JPM G;  2JGW A;  1H2P P;  3ZD2 A;  3EJH A;  1NZI A;  3POF A;  2XRB A;  1E5G A;  1SRZ A;  3IX0 A;  2W80 A;  2MCZ A;  3KQ4 B;  1OK9 A;  2O39 C;  1VVD A;  2WII C;  1GKG A;  2YBY A;  5CKN A;  5CIS A;  1OJY A;  3POG A;  1SPP B;  3POB A;  5FO8 C;  5CKQ A;  1C1Z A;  3TVJ A;  2LOJ A;  1GPZ A;  1OK2 A;  1TPG A;  2QQL A;  1ZJK A;  2KRI A;  2BZM A;  1TPM A;  1NWV A;  3POI A;  3CAL A;  3RJ3 D;  5HZP B;  4AYI A;  1H2Q P;  1HFI A;  4WJG 2;  1SS2 A;  2JGX A;  1OJV A;  2G7I A;  3MQL A;  5I0Q B;  4KKD A;  4MUC A;  2RLP A;  5CKM A;  4K12 A;  1QUB A;  4ZH1 D;  1QGB A;  2JRA A;  4J38 B;  3NFP I;  2QY0 A;  2YRA A;  1E8B A;  1MD7 A;  2XRD A;  4PZ5 A;  4LOT A;  4B2R A;  2WNO A;  3POE A;  4IGD A;  1U5M A;  1SFP A;  1CKL A;  4GZ9 A;  4AYM A;  4ONT D;  1H03 P;  1OK1 A;  2ERJ A;  2KMS A;  3GXE A;  4AYD A;  1GHQ B;  2EHF A;  1UOT P;  2A55 A;  4LOS A;  1SZB A;  1GKN A;  1ELV A;  3KXV A;  4JHS A;  2RL0 A;  3OED C;  2IZ4 A;  1NT0 A;  5HYT B;  2CG6 A;  4LMF A;  3R62 A;  1Z92 B;  2IZ3 A;  1SPP A;  1G4G A;  3DEM A;  3OXU D;  3M7P A;  1G4F A;  2XWB F;  2RKZ A;  3ZRZ A;  3INB C;  3SW0 X;  2CKU A;  1HFH A;  3ERB A;  5HYP A;  1Q3X A;  4C16 A;  2W81 A;  1TPN A;  2RKY A;  4B2S A;  4AYE A;  2CG7 A;  1OK3 A;  2MCY A;  3OP8 A;  2XWJ I;  1FBR A;  3GOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...