4LOSA

C1s cub2-ccp1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
187
structure length
187
Chain Sequence
GVNCSGDVFTALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C1s subcomponent heavy chain
publication title Structural basis of the C1q/C1s interaction and its central role in assembly of the C1 complex of complement activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 37
structure length 187
sequence length 187
ec nomenclature ec 3.4.21.42: Complement subcomponent C1s.
pdb deposition date 2013-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00431 CUB CUB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 4losA02
2.60.120.290 Mainly Beta Sandwich Jelly Rolls Spermadhesin, CUB domain 4losA01
5HYTB 1MD7A 5FO8C 2G7IA 1GHQB 2QQMA 3ERBA 3POIA 2XWJI 3R62A 3ZD1A 4LORA 4WJG2 1OK1A 1E5GA 4LOTA 1ZJKA 2MCZA 2YBYA 1E88A 1G4GA 2O39C 3RJ3D 1TPNA 4AYMA 1G4FA 1PPQA 4B2RA 4J38B 1VVDA 2B5ID 1LY2A 3POJA 2A55A 1GPZA 3POFA 1H2QP 4AYIA 1SZBA 3POBA 3L89M 2CG6A 4AYDA 1HFHA 1OK2A 2W81A 4CSYA 1TPGA 2RKZA 2CG7A 3CALA 4ONTD 3ZD2A 3DEMA 4YNXA 3GOVA 4MUCA 1CKLA 4JHSA 4LOSA 2BZMA 2XQWC 2KMSA 1QGBA 3MQLA 1OJVA 4K12A 2XRDA 4B2SA 4ZH1D 4LMFA 3POGA 2WNOA 2RL0A 2RLQA 4IGDA 3SW0X 5CKNA 3KQ4B 5I0QB 1H2PP 1OK9A 5CISA 4PZ5A 4A5WB 2JGXA 2QQKA 4GZ9A 2RLPA 3IX0A 2JGWA 2RKYA 2YRAA 3T5OA 1O9AA 3IU3I 1C1ZA 4F4OC 2W80A 4KKDA 3TVJA 5JPMG 1SS2A 2JRAA 1TPMA 5HYUB 1UOTP 1NZIA 3KZJA 3EJHA 1QUBA 2KRIA 2V8EA 1HFIA 1MD8A 3KXVA 1H04P 1E8BA 3OEDC 1SPPB 1HCCA 2QQLA 4DJZA 1NWVA 2ERJA 2IZ3A 5CKMA 2QY0A 4FXGG 2EHFA 2XRBA 3GXEA 1FBRA 1Z92B 1QO6A 3OP8A 1GKNA 1OK3A 1OJYA 1U5MA 3NFPI 2EC3A 3INBC 1OJWA 1VVCA 2CKUA 4AYEA 1GKGA 2QQOA 1NT0A 2LOJA 3M7PA 1ELVA 1Q3XA 5CKQA 3OXUD 1H03P 2MCYA 5HZPB 1SRZA 1SFPA 3O8EB 4C16A 1SPPA 3ZRZA 5HYPA 3POEA 2XWBF 2UWNA 2IZ4A 2WIIC
chains in the Genus database with same CATH superfamily
3S0MA 1FI2A 1V6OA 1PZ8A 4FXKB 4XFHA 1US2A 2PAEA 3RQ0A 2XMLA 4AWDA 1J59A 1WZXA 2VECA 3AYEA 4OVEA 1ULDA 4GB33 1RC6A 3L2HA 1O91A 1ONAA 2TEPA 4TZDA 3ZYBA 3M4FA 4A45A 5IJRA 1R1A3 3WG3A 5LK7B 1W9YA 4AVTA 3OUIA 4GMP3 1OKOA 2ZGOA 4FOWA 1E5HA 2WSUA 5DUXA 4WBBA 2DVDA 2Q30A 3SH5A 4JHTA 4AVSA 2CSGA 3GYDA 2WYSA 4Z07A 3E6DA 1OOPC 4YW1A 3POSA 1WLCA 3MPBA 3RZZA 1SZBA 3ZFGB 2GAUA 1PIV3 2VZ1A 4QPWA 3WCRA 5C8CC 1IKQA 2ZS6B 1XRUA 1AYN1 3K3TA 3ZXLA 1HFHA 1JHNA 1OH4A 2XJPA 2BGPA 4X6QB 1QMJA 1D2QA 2E7AA 2NMNA 4XUPA 1POV0 1JZ5A 4COWA 4P00B 3S5AA 2G4IA 5JZGB 1H9PA 4XCBA 4XJ8A 3EB7A 4XF4A 5FLHA 5LK5A 2PAMA 1QJZA 2Q8EA 3VBUB 2VUCA 1H30A 1RUC3 2PLV3 4MV2A 4DMIA 1OLMA 2PHFA 3PMSA 3OD4A 4P9JA 2NQYA 1RVF3 3OUJA 1ASJ1 2GP5A 5FPAA 1REFA 1VLNA 2PHRA 5K7PA 1ZBE1 1BXHA 2RS12 1YHFA 3OY8B 5AC91 4QXHA 5FP7A 1VR3A 1AR63 3PJYA 3CJIC 3IM0A 4CUBA 4EQVA 3ZFEC 1DQ5A 4NWVA 5FLJA 3UJOA 5DUWA 5K0UC 2QDNA 4AL9A 2QQKA 2YMZA 3H3LA 4TLGA 1SDDB 5GLZA 1DGWX 1WCUA 4GAZA 2CGPA 2HWB1 1JYCA 5BNNC 1PX4A 3VD3A 2YFZA 5GM0A 3OGVA 1D0HA 5HCFA 1W2NA 5C8WA 1GKBA 4EN6B 1TMF1 5CBLA 3EJKA 2DCYA 1YQCA 1OA3A 2G1MA 3N7MA 1J83A 3GZAA 3VBFC 1H6XA 4RQPB 3KV5A 4OQ9A 3VDDC 3PTRB 1SPPB 2VZVA 4I2OA 1ST8A 3N9LA 4XJZA 3RZJA 3WT3A 1HRV3 2Y8TA 5JUVA 1S55A 3B00A 2VMFA 3TN93 1SLLA 5EXOA 3LDRA 3MV01 1NUKA 1XE8A 1LU2A 1SLTA 2ADDA 4QPGC 1JYXA 4Q1PA 2P17A 1W6NB 3BPZA 4COVA 3M7AA 5DDJ3 3BVCA 1DGWA 3WUDA 4R4ZA 2JDYA 2D5FA 5C7GA 1VBC1 5L7OC 4BXFA 2LALA 4YW6A 3ZSJA 2WA4A 2VR4A 1Y7BA 3FFQA 2UWNA 1KJLA 5KWRA 2VCCA 1MD7A 2XG3A 2FDKA 1CJPA 5LB6A 3WDYA 5JR2A 5D2AA 2HWE2 4E2GA 2EIBA 2ZZQA 4HN1A 3ECQA 1JI6A 4IGOA 4Q4Y2 1YQ6A 2VTFA 5IK7A 4NHKA 3OF1A 1COV3 3AX4A 4H14A 2R042 5FPVA 5GLWA 3RRDA 5ABJB 1F8VA 4W4ZA 5GZCA 1R081 1SCSA 4QB2A 3GF6A 3LA7A 5BNOC 3RJ3D 5F32A 2R061 2C4XA 5GJ6A 4Q4V3 5B2GB 2BGCA 4OUSA 4ET7A 4JQRA 2UWBA 1MZ6A 3WQ0A 1BMV2 1DQ2A 3HN1A 5FZGA 4HANA 4XUNA 1RUJ3 3FUOA 1OVSA 2QFEA 3IIIA 3POBA 3BTAA 4RHV2 1FNYA 3GALA 2R7EB 3UESA 5FIXA 3KGLA 1OPOA 4JZRA 4H7MA 4XFAA 2VQAA 2W81A 2YBPA 3MZHA 1PK6B 5L36A 4N43A 1HB4A 3WDTA 3VBOC 1I9RA 5C4WA 2A3YA 4M3CB 4B4QA 5IYYA 4MUCA 3PVBB 5FZHA 4C8DA 1NOVA 2H0BA 3LPGA 2VVDA 5F3IA 5F37A 1O4TA 1BEV3 4HKOA 4OI0A 1V70A 4HSLA 1WW7A 4RGAA 2DTYA 3MQLA 4ZH1D 3DYPA 4LMFA 1XNTA 1AL21 3RDIA 1DFQA 1F5JA 2ZMKA 1KQRA 3D0SA 3N4MA 1REDA 2Q5TA 2WNUB 3L2YA 1WLDA 4NRMA 2AACA 3AJZA 3VDCA 5JSRA 1B35B 1H8VA 4Z8BA 5CISA 1UZWA 4YVSA 2G9GA 1F5FA 5FMDA 3T0BA 4AI0A 1PO13 3K48A 3ZYRA 1O7FA 3N7KA 5EPAA 1TME1 1HB2A 2XWJB 1HDKA 1YFWA 3W9AA 3DN7A 1YIFA 2YRAA 3FFZA 4N53B 1MEC1 1VAKA 3UGGA 1CD3G 4YIZA 1O8SA 5JI7A 2WQ4A 3V0AA 4K8RB 3I3QA 1UCXA 3T1MA 3HQUA 2VY0A 3RGBA 1SS2A 5KR7A 1QDOA 4IEVA 3DUIA 4I01A 1NY71 1QUBA 2RV9A 4K6BA 4NVPA 4C0HA 4AW7A 1Y43B 2XKOA 3WSYA 3CHXA 3ON7A 4JKKA 5EJ1B 2C6SA 4OUEA 4FPEA 2VUJA 4IEOA 3QLQA 1E8BA 3ZXDA 3LCPA 4BDVB 2GSYA 4LK7A 2ZCWA 2R071 3OBAA 4AK3A 3N3HA 4TXWA 4CDXA 4ISRA 4CEYA 4WV8A 1SQ4A 1GZWA 3NJAA 1OK3A 2CWSA 1RHI1 1FT9A 4ISQA 3NFPI 4JTOA 2AGSA 4FPJA 1RUF3 1S2BA 4CDWA 3VD5A 3AYDA 4CXXA 5BNPC 1DZTA 3QACA 2WN2A 4GJYA 4F7ZA 1IS4A 2OKXA 3QBQA 1MVEA 2TBVA 3B01A 4B4RA 5A1FA 3J8F2 3WOGA 5FOJB 3MICA 2BZDA 3SCHA 4BU2A 5ABJA 1W2AX 3WG1A 1H8TA 2IXIA 1QEXA 4Q4W2 5A7WA 4YGBA 2ZGUA 1HX6A 3NNMA 4HPKA 4Q0UA 1QDCA 4AI1A 3MIDA 1OD3A 3NJVA 2VZUA 4CPBD 3ZD1A 4WM8A 2V5YA 4PIXA 4XZPA 3OG2A 1H1IA 5JOXA 3ZLEA 4KWUA 2B9VA 4NRQA 5JR7B 3MLLA 5ANQA 2X5IA 3S6PA 4CZSA 1LOGA 4BIFA 5CFCB 4EN7B 5T55A 1W6PA 4L99A 2YU2A 1JBCA 3T3YA 4BQ2A 3ABZA 3NJXA 4CCJA 1SBEA 4LBMA 1IPJA 1GPZA 2J1RA 3AL6A 1HJFA 5FUIA 3ZN6A 2WFPA 1EAH1 3CMGA 4QPIB 3AZWA 3OYWA 3ZXFA 2JWPA 3NL1A 2W9XA 2PQQA 3BN6A 3H0OA 4AYDA 3W20A 5LW9A 2P3KA 5E1RA 5E89A 5GALA 3THTA 1UOJA 3I2HA 2VH9A 1US3A 1W6OA 4XMIA 1KEXA 2WZR2 1S2KA 3V0BA 2FMYA 2WABA 1YRZA 4QM8A 1PVC2 5IAVA 1DG6A 3PDQA 2EXHA 1XNAA 5D1IA 4J25A 4AHZA 3BPSA 1JUHA 4K12A 1OJVA 4B2SA 1H0BA 3AYCA 1JS9A 3H8UA 5IAXA 1UXXX 1O3RA 1E57A 1C8NA 1CIYA 3W5NA 4AEKA 3NKTA 1WW4A 3KV4A 5FJHA 3RWKX 3FLPA 5CKNA 4P9GA 5IVVA 1ZA4A 5FZ0A 4JAAA 3A0KA 3KWVA 5KHJA 3I49A 4HN0A 3Q9OA 5FP9A 2IFRA 2GNBA 4A5WB 2XQXA 5I91A 4KGGA 4CDQB 3I7DA 4IV3A 5FP3A 1W0PA 5FK8A 3O5SA 1ODMA 1WW5A 1FOD1 3QH6A 1G7YA 5LRSA 1WCKA 2XLGA 2WQZC 1QJY3 1RITA 5T5PA 2EF6A 4L2NA 4HVOA 2ZJCA 2WLPA 1BK1A 3I2FA 4LKSA 1NE4A 1I6XA 1YNAA 2O1QA 3RG0A 4EWAA 1F9KA 3AMQA 4MXVA 2RVAA 1W03A 1CONA 4N43C 5LBCA 4FQZA 1KFUL 3GM8A 1UMIA 5C4WC 4R9AA 3UKVA 5DUUA 1YFYA 5J37A 2ERFA 1CR7A 3U4XA 3BOPA 2J7MA 2TUNA 4IE7A 4LBJA 4LR4A 1IQAA 3VDAA 2XL7A 2BU9A 1RGSA 1SBDA 3ZLIA 2WS92 3OPTA 3O0WA 2P2KA 3ETQA 4JX0A 5FKBA 3M70A 3U78A 4NOTA 4PF5A 5FYUA 1MQTA 1RMU1 3VHOA 3MLJA 4JGZB 4UT5A 1IZ3A 3B3QE 4FP2A 3VLBB 1O5UA 4LPLA 1DU3D 1HIXA 3WF4A 4P5YA 4Y20B 1OUSA 2DUOA 1DYKA 1Z7S2 1HQNA 3H50A 4YVSC 5ACA3 1Q3XA 2WO7A 4Q1RA 4UFLA 1AR92 1G9FA 1VBD3 5DABA 2BERA 1ND3B 2PN5A 2QJVA 2XWBB 2A3XA 3AKSA 1H6YA 3D82A 3JD71 4QDRA 1S0BA 4MUVA 4RR3B 1EUUA 3D3AA 4Y22B 1D2SA 1FMD3 4ES9A 5HYTB 1YI7A 3JBG1 4R52A 1SDWA 4BJ0A 2VD7A 1G9CA 5JXJA 3N35A 2AEYA 1W99A 1AF9A 1YEWA 2VBDA 3H3ZA 2CGOA 2F17A 5IVJA 3USUA 1WMDA 1K5MB 5LCWL 1UW8A 1Y3TA 2V4AA 3BTYA 3OBRA 4HKWA 4DRRA 2YG0A 2JE7A 1REEA 3O7OA 3SISA 1NE6A 1DLCA 3WD5A 1AXKA 2P37A 5JSOA 1RUD2 1C8M2 1LHOA 4BQ3A 5GKAC 1YI9A 4CDXC 3P5BA 3ZFGA 5A1AA 4CEYC 3U37A 2R041 3VD4A 5EYXA 4UFJA 4YW2A 4LEJA 3A23A 5A1LA 1H2QP 4JRAA 3W59A 3C7OA 3HR9A 2EVXA 4QQPA 1VRH1 2FD8A 1WD4A 3F95A 5IATA 2Q1ZB 1NCRB 4BA6A 2C26A 4IEYA 2AZ5A 1PNGA 1YQ2A 2DUPA 3LZZA 3VKFC 2CG7A 4AFMA 1MZ5A 3I2KA 5J1XA 1K5JA 3GOVA 2C0ZA 4IE6A 5ABJC 3RVHA 1H8TC 2RM21 1W8NA 1QNWA 2RDRA 2DV9A 2XJVA 2VXJA 2X8KA 3A21A 3NV1A 4NHXA 2CTVA 4ONUA 2VM9A 3VBSB 1CX1A 5DN4A 1C4RA 2WIIB 3OEBA 1JN2P 4K1YA 4J6GA 3CZJA 4UWDA 1NG0A 2HKXA 3SEPA 4NIGA 5IVYA 1HQLA 4XHBA 1LU1A 4DB5A 2WJSA 4WM8C 5JMOA 1O6UA 1W8UA 4ATEA 1N3PA 4YZ3A 5A6YA 1UPSA 2X5IC 2B8MA 3QCWA 3B5LB 4URTA 4DOUA 4Z2AA 4FT8A 2E51A 1VBB3 3VBHA 2GC3A 1HJGA 4B4PA 5JLVA 1YO8A 2RS51 1CAXA 1XE0A 1YFXA 2VOTA 3T4VA 1ASJ2 1OVPA 4YZ2A 1JTZX 4Z92B 1UU5A 1ZBE2 2Y0IA 4AQ6A 3FBYA 5AC92 5KC6A 1ZZ6A 3JQXA 5IWFA 3POWA 4FOVA 4WVMB 1UU6A 4CP0A 5HYUB 1HRI1 3TB0A 1POV3 1EY2A 5T3NA 3VZLA 2EXKA 3K46A 2ES3A 4KBBA 1SCRA 4GWMA 1CJDA 1DGRN 4GH4B 1F2NA 2JEMA 4IEZA 4XPVA 4XUOA 5BPXA 4QQ2A 2XLFA 2X29A 2ZGMA 4N9IA 2OZ6A 4QGLA 2HWB2 2G9FA 2XBO3 2QQLA 3J4UH 1W0OA 4YZ4A 3I4IA 2ERJA 2QZ3A 3I3DA 3T0AA 4FXGG 5FR3A 2ZHLA 4AFBA 1R091 3N9QA 4FOYA 2GC0A 3ST7A 1GKNA 1W6NA 1QKQA 2WZR3 5H9QA 4P08A 3EYPA 4PIYA 3UK9A 1PVC3 3OGJA 1OJWA 3VHNA 3M3OA 3OTFA 3FLTA 4XW3A 5DZEA 1OBNA 3O14A 3LWCA 2NYYA 4XYXA 2D6NA 1TNFA 4IV3C 5HZPB 3NQHA 2QVSB 4WZFA 5F2SA 5LZ6A 1VMHA 2VCAA 1NCQC 2W94A 2GNDA 4Y1VA 2EALA 4C16A 3NAPA 4PO7A 1N1TA 3MI8A 3WDUA 2YBKA 2VNRA 1GHQB 4FPFA 2RR13 3F6KA 3GGLA 3WUCA 1UU4A 1XXNA 2KXLA 1OLQA 3WNMA 3R62A 2K0GA 4PLOA 2DDUA 1H9WA 4QD2A 1QHDA 5F7UA 3NVCA 3AMHA 4BXSV 1VBC2 4ATFA 3NNFA 5FREA 3AXEA 3LB9A 1ZRRA 1UYZA 1PPQA 4PCRA 2QKDA 3T30A 5F3EA 2ZTNA 4YG0A 5EP9A 1GP5A 4LBOA 1F15A 1ND2B 1GU3A 4RFT0 1S0CA 2HWC3 4GWNA 3MFAA 5SV5A 1MQTC 5FZDA 2N7GA 4FTBA 2VVEA 2PHXA 4YNIA 1UXZA 3BYWA 1UN1A 1WCQA 3L89M 1R082 2VXRA 4X8NA 5J96B 1HXS1 3H1WA 5FP8A 4AHXA 2R062 3O1TA 4M0NA 1AYM1 3TNQA 5A3TA 4HLTA 5F5QA 1W8HA 3E5UA 1KDMA 1ZNPA 4FPLA 4V2VA 3N36A 4DNYA 3RZGA 2VUDA 1R64A 2FZ2A 1PMIA 2HLEA 1BYHA 2WSVA 3VHRA 2WAAA 3J26N 1RUI1 4YRDA 3WDVA 4XXAA 2XRDA 1RUG1 2QQJA 5J98B 5BY5A 3MYXA 4XF9A 2OYZA 2OZJA 1AUYA 3H3UA 3KLSA 3ZO0B 3AYAA 1QY4A 1HN0A 2W08A 1LAJA 4KWLA 3RPQA 1LODA 2AC1A 1RINA 3E5QA 1N3OA 1VAVA 3KCYA 4KI5M 2BNNA 4N53A 2JDHA 3WSXA 5FJKA 5DQ0A 1AL22 2VMIA 3WDWA 2HEVF 4URAA 2DVFA 4PLMA 4BCUA 2WT1A 3JXSA 4QQHA 2FCUA 4ZXKA 3PTYA 1SBFA 1RUOA 3CLPA 1UZVA 3KZJA 2BRTA 2XHKA 2Z69A 3LIGA 1H4HA 2JDNA 4UW5A 5FK7A 5FZ8A 3W5MA 2ZAAA 1TME2 1VBA1 1MD8A 2LUWA 1CN1A 1PGW1 3KXVA 2NM1A 3N9OA 5A33B 1GBGA 1QNYA 4O61A 4UBGA 3KF3A 1MEC2 4Y1UA 4K40A 4NIIA 3RZLA 3R05A 4HT1T 4D6SA 1DIWA 2D43A 4DJZA 2XVLA 2UWAA 4PI2A 4F8AA 5FYIA 4LBQD 5J36A 1AZDA 4XBNA 5DG2A 3U1XA 3U14A 2RMU1 5I93A 2BEOA 1NY72 1OA4A 1I5PA 2ETEA 3KSCA 4MSVA 5FPBA 1V6NA 4NRPA 1PNFA 3C7EA 5BUVA 3PU3A 1NKGA 3INBC 1RJ8A 3K4DA 3T2OA 3VBHC 2Q4SA 4MADA 2BNMA 4JHZA 1AYN3 1XPWA 2E6VA 3IPVB 5L73A 3D5OA 1QH7A 2R072 3Q8BA 5FY0A 5C9AB 3ZIXA 1FX5A 3HT2A 5E16A 1LJ7A 2XJQA 4IXLA 2UURA 1CAVA 2ZEZA 3E6BA 5GLVA 1G9DA 3FGTA 1RHI2 2BWCA 4YW7A 3WF1A 3N9PA 5DUVA 2I74A 2BPA2 1Z7S1 4BQ1A 2CAUA 1MS9A 5FO7B 2XWJI 4MGKE 2LROA 1GZ9A 1ASJ3 3N9NA 3E97A 2ZX4A 1W2TA 2ZABA 3HPNA 4IDZA 3AMNA 5FZ9A 5I0TA 4CPBA 4COYA 5AC93 4Y1ZA 1D0GA 1A8MA 4B29A 1QJU1 4PQ9A 1WCDJ 4AFCA 4B2RA 3NV3A 2ZGQA 3DPRB 5GZFA 1VVDA 1ZZ7A 2C9AA 5HXMA 4JGYB 1VBE3 5CB7A 2XKPA 2BP6A 1YCIA 3P3NA 5AFEA 1ULOA 5IVBA 2QQUA 1RUD1 5LASA 1C8M1 1LGCA 1QQP1 1TMF3 1UO9A 4FI9A 4P9YA 2VO5A 3OGGA 5LBEA 4XC9A 4OQ8A 3NAPC 4R9CA 1MZFA 3TAYA 1UY4A 2ZGLA 3CBNA 3FLRA 1EAH2 2H6BA 2ZHKA 1N47A 4M3CF 1KXGA 4CP9A 2BZMA 4QM9A 1YWKA 2W3JA 3IDAA 4XMAA 1AR82 5C6CA 5FO8B 2Q1FA 1PO22 2D3SA 5JXIA 2D6OX 4IGDA 3H1YA 1N3QA 2JE8A 4IW3A 2CYFA 5CIRA 5CFDA 1UZZA 3VB9A 2IXLA 4QU2A 1Z0HA 1GUIA 4BOWA 2WFF3 3OEAA 1HKDA 1CAUB 2I07B 2V5DA 2BQPA 1QXPA 3O0XA 4U36A 5JPNB 2PYTA 5FLIA 3BI3A 1VB2A 3VBRB 5DAXA 2FQPA 4A42A 4NIDA 2VMDA 4YW5A 3WG2A 1OF3A 2AH2A 1GZCA 4FQ4A 4CEWB 4B3NA 4LO7A 3RYRA 5JPMB 2LTNA 2VZOA 3ZR5A 1C1ZA 1L7RA 3VUOA 5FTTC 4Y3OA 3RS6A 5HXVA 3WLUA 3DXUA 4OZOA 1NZIA 4XHXA 1OFNA 3SXWA 2RJKA 4DXSA 5F2WA 4XQDA 1QJX1 1WGPA 3VN4A 2DF7A 3VV1A 3HIFA 5CZKA 2CAVA 2ZEXA 5LA0A 1FOD2 4KG0A 5F1RA 4MH0E 3VZJA 4QX8A 3BCWA 1R083 2ZYCA 4CTEA 1V0AA 1Q8PA 1V6KA 2JDZA 3POYA 1GLHA 3AFGA 1EP0A 3ZSKA 2VMGA 1FBRA 1G86A 3AKTA 1TZOA 4XE9A 1PX3A 1W8TA 1S0EA 4EV0A 5JIAA 5GZGA 4CCKA 3LOBA 2HEYF 4AQTA 2EC3A 1BKZA 4FFFA 2FZ1A 1NT0A 4LHNA 3SKJE 1JW6A 3WX5A 2VTXA 1RUE3 1FPN1 1KDKA 4XFGA 1OQ1A 3PJQA 3R4DB 1N1VA 1MS0A 2EIEA 5CEHA 3ZLDA 1RMU2 5HYPA 1I5ZA 4HXCA 4Q4X3 1ZZCA 4X6RB 2WNVB 5L19A 3AC0A 3ZXGA 5A3LA 2KR2A 3C8XA 2Y60A 1XC6A 4N7UA 5DG1A 5FY4A 3RZMA 1RIRA 5F6KA 1J3RA 4LORA 5FZ7A 4QPIA 5F5IA 4Q8LA 5FYHA 2NLRA 4JC1A 3JD72 4AHWA 4HZFA 2MCZA 1H2MA 2E53A 4JCKA 2YBYA 4UF0A 1A34A 1TNRA 2Y6JA 4CDUB 3E6CC 1C1LA 1CZVA 3JBG2 4M4RA 4XQ4A 1NA1A 2A6YA 4NJ4A 1SACA 3BALA 1D4M3 1DZQA 3LDKA 2JENA 3EMRA 4RN5A 1ZVFA 4WM7B 4CCLA 4KU8A 2VNOA 4NE9A 4N90A 5IW0A 5D8AA 4P14A 3T4HB 4AEDB 3I2GA 3RSJA 4MG2A 1DGRA 2K9ZA 4AGGA 1GFF2 3PL0A 3WNOA 4A7YA 4CP2A 5HI0A 3FBMA 1AJOA 1NLSA 1V9U3 2JG9A 1OC1A 3MHZA 4TYSA 5EV7A 3ZFFA 4XJ9A 3TBDA 2DTWA 1PGL1 5A3OA 5CG9A 4KBZA 4CCEA 2GNMA 5I8YA 5KBFA 1BMV1 1LESA 2UYAA 1Y9QA 4YZ5A 1BJQA 1PIV1 3LPFA 3NV4A 4K1ZA 1W3XA 1QH6A 5EJ3A 2JG8B 1H2LA 3TEXA 1FATA 5LY1A 3D8CA 3HAGA 4LLOA 1STMA 2EAAA 2OS2A 2DBNA 1VRH2 3MV11 2R073 4M3CE 2WNEA 2YGMA 2RLQA 1ZBA1 2OA2A 2ZKLA 3AP9A 3HJRA 4IEPA 4CSWA 2YBSA 2OW4A 1ALYA 4K21A 1RUC1 3MDPA 2BGOA 3AM2A 4EZHA 2RM22 3HBZA 2XJTA 1UAIA 2ZGRA 4IERA 2PHLA 1NYWA 4YPJA 1GNHA 4GWJA 4BQWA 3AP7A 4MGQA 3OB8A 1QOTA 4LQRA 5FPXA 2A3WA 1W6MA 2JD9A 4MXWB 4YM2A 4MYEA 1QWRA 3MGUA 2R0FA 2ZX0A 3T5OA 1AR61 1FV3A 4DZGA 3IU3I 2J22A 1OOPB 2CHHA 3KV9A 1BCXA 2Y64A 2SBAA 3I3MA 2WRAA 4BIOA 5GZEA 2BUKA 4GH4A 1YQ5A 2ARBA 2JIGA 2RS52 4BISA 4ZKTB 5C8CB 3IT8A 4RS5A 5FYVA 2EXIA 1AJKA 2UY9A 3SITA 4Y5Z0 1B09A 1J3QA 1S0JA 1UMHA 1A78A 1IPSA 2IWGB 5JVVA 1C5HA 2BW8A 2VMCA 3WEZA 1OHFA 3IDBB 3JCIA 4MOAA 4XUQA 5FQ0B 1WKYA 3RI8A 2Y6GA 1HRI2 4AQ2A 2XRBA 4XOGA 2VPVA 1IQDC 4OMCA 4Q0SA 1Q43A 4FAGA 4ZS2A 3OP8A 3S30A 4DY5A 4OFGA 4EN0A 2DBIA 5CFDC 3IDCB 3WNLA 5JMCA 1W05A 4XDQA 5F39A 1EAH3 2CKUA 1D4VB 1HRV1 3BTZA 1ZRFA 3O1RA 1H1MA 3DV8A 4ZU7A 4LBLA 1JH5A 3CJIB 4FBFA 5KXCA 2GC1A 3GDBA 4ZXEA 2MPFA 2XJRA 1AR71 3ZFEB 3PIJA 3O8EB 1UIKA 3WG4A 1R092 4IEWA 5K0UB 2QQIA 2WT0A 2XWBF 1CAWB 3KVBA 4QAWA 3VZMA 1UL9A 1DP0A 1RUH1 2D3PA 4DO0A 2FCVA 2JB4A 5DDJ1 4FTEA 1QJEA 1U5IA 3M1HA 5BNNB 2QQMA 4TTGA 4A7ZA 4GQ7A 3S7EA 5KXBA 4ZU4A 1ZJKA 2A70A 3VBFB 4XQWA 1UX6A 1WWYA 4RYDA 2P6HA 4DUVA 3T2PA 5L9VA 4YM1A 3VDDB 1YJLA 4YGDA 1EYBA 1ZREA 2W92A 4QX7A 1MPXA 4DQAA 2XONA 2XVKA 3I2DA 3LGRA 4V2WA 1COV1 4Q0VA 1KJRA 3EO6A 5T5OA 1MS4A 1T6GC 3WHTA 3DKWA 3C7FA 1FOD3 2RS13 4AAPA 4BLIA 3ZDVA 3U10A 5DAVA 3NNGA 1GV9A 1W9WA 3K4ZA 3MIFA 3KS7A 4Q4V1 4QX0A 1OK2A 4HFSA 4QPGB 1G9AA 4OULA 1H4GA 4N7EA 3SMHA 4K3UA 2DURA 2DUQA 4YVWA 3CALA 2ZA9A 1K45A 4YNXA 5A6ZA 2JIJA 3NNJA 1VALA 4L0PA 4O65A 2VVFA 1PM4A 2JB8A 1RLHA 5L7OB 2I2LA 4LOSA 4HONA 3ZKYA 1AVBA 2FMDA 2QNKA 3Q8AA 1HXS2 3I59A 1PVXA 5K8SA 1AYM2 3WF0A 3VKNA 4LA3A 3LEKA 4QMAA 3H42B 4QPIC 1KS4A 4ARYA 5IFTA 2DYCA 1VPHA 1WUVA 2P6CA 2ZGKA 3RWNA 4CU8A 1F35A 3LQCA 1BEV1 2BV4A 1W6QA 3U11A 4LNVA 1NA1C 1DDLA 2XGXA 5BNOB 3RZHA 1IOAA 1AR81 2EIDA 4BYYA 2JGXA 1RUI2 5A3UA 2ZX2A 2X2ZA 1PO21 5D8AC 1RUG2 4Y1XA 4E8DA 2RLPA 3IX0A 2V4VA 2BFUL 3JD73 4MVTA 2CGNA 1DQ0A 4IV1A 5EFUA 1SLCA 3O1VA 2JG9C 4QQLA 3ZFFC 4HK9A 1FV2A 3HWJA 4AHYA 1PO11 5K9YA 2Q0AA 1VB4A 3H8RA 2C1FA 4HMZA 1H2KA 3LEIA 4AF9A 4WZCA 5A33A 4J1WA 2KM2A 1DGLA 2Y6FA 3ZPOA 4AG4A 3MIBA 1YUDA 3KGZA 3VBOB 3ZVXA 1NZCA 4EE2A 1X82A 2R30A 2ZX3A 2ZZJA 3H8OA 2E26A 4YARA 1JUIA 3IN9A 2YYOA 2HWE3 4I30A 3Q8EA 1GWLA 2R32A 3IDEA 4LBQA 4Q4Y3 2WZPP 4Z1VA 1MS1A 1VBA2 2R043 4K9SA 4LK6A 1KGYA 2E63A 3D6EA 1PGW2 4R9BA 1CPNA 2BJSA 4H3WA 3BOWA 5A80A 3RFRA 3UGFA 3TEZA 2MEV2 3O1SA 2EA7A 1LEMA 2QQOA 4XJWA 1LKNA 1F31A 3UKNA 4PDWA 5CKQA 1DBNA 3KCXA 4OI1A 1H03P 1NQJA 2JE9A 4AI8A 5FZCA 4EJRA 2BDRA 2RMU2 2WUHA 5FBZA 3BGAA 1F4AA 3PUHA 4NPLA 5C5TA 1RUF1 2FDIA 3T2TA 5DXDA 3AB0A 4ZZ8A 2H0VA 3HQXA 2ZMLA 4QKFA 4RHV3 1C1FA 3LA2A 3PIGA 5DN5A 4ZS3A 4AAXA 4RS5C 2HBUA 5LRRA 2JKXA 1ZZBA 5T54A 4DXZA 1T6BX 1Q8VA 3NSTA 5KXEA 1PZ9A 1S0DA 4GA9A 4GJZA 3ZYIB 3WW2A 2QDRA 2VMEA 1JOJA 3DPRA 3OBZA 4PJYA 5DAWA 2DCTA 4OHZA 4XBLA 4XF0A 4B1MA 4K8FA 4OMDA 4JDMA 4FAHA 5E8AA 4HKLA 5A7PA 1PMJX 4JGYA 2OX0A 2WZ8A 4LITA 4D3WA 5T5LA 1LB2A 4GXLA 3HEIA 2D3RA 3NKGA 1CGPA 4LT5A 2GC2A 1XBFA 2D5HA 3ZM8A 1VP6A 4CXWA 3PUAA 3ACLA 5FZMA 4CUAA 4AFAA 4SBVA 5FBJA 1XOYA 3FZ3A 4QX3A 2DFBA 2VTXJ 4XF1A 3UETA 4Q0PA 1QJU2 2ZOEB 1OMIA 3DL3A 3FWEA 5IK5A 4K7JA 5FZ4A 5JWPA 4YGCA 1JYWA 3IWZA 3KZ4C 5H9PA 1TPGA 3ZN5A 5BNPB 3U0ZA 3ROUA 3ZMNA 1XYPA 1O8PA 4LO8A 4AEJA 3M3CA 3WP3A 1WW6A 1WA4A 2PFWA 3WDXA 2HYXA 1FYUA 2BOIA 4FCAA 2IVIB 2KMSA 2WT2A 2X09A 4IL7A 4NAOA 1QQP2 1W9TA 4KU7A 1GOHA 3ATGA 4DEQA 4OI4A 4I09A 5IFPA 5FY1A 4LHSA 2BWAA 3KT4A 1W28A 4J1XA 3DYOA 3HT1A 1ENXA 2Z4FA 4CDWC 3ZX7A 2C9KA 5DN2A 4XZUG 5FZ3A 2ZGTA 5JZGA 1Y4WA 4CEWA 2ATFA 4LUKA 3T0DA 3VBUA 2WZEA 4NHMA 4AVCA 4LKEA 4MGSA 4RSUA 1IG0A 1W8WA 4KKDA 5APAA 2B4KA 4I02A 4FPYA 4COZA 3GHNA 3BKZA 4XACA 3UT0A 3OY8A 4YG3A 1HB3A 4YVWC 2A6XA 3DKQA 1QJY1 3J8F3 3FMGA 3NJYA 5FMOL 4ARXA 2Y33A 1MS8A 3ZXJA 3PUSA 4Q4W3 3UV9A 1O3SA 3UGHA 4LE3A 5CKMA 1OFSA 5A7NA 4TLFA 4FPGA 2QY0A 2HWF1 3OGRA 3FX3A 1Z92B 4IEXA 2G19A 5FDBA 4RGGA 1QJX2 1UWWA 4C1XA 3TEWA 3SLIA 2QUOA 2VQUA 1DCSA 5EYYA 1WLTA 4HVQA 4Q29A 2Y8RA 3S5QA 3GCXA 3LKJA 4NN0A 4BM8A 4IETA 1RB8G 3MF6A 1V00A 4RQPA 4AGVA 2BNOA 3PNAA 5CADA 1X8MA 1SHWB 1SPPA 4IV1C 3THCA 4IGPA 3EHKA 1H2NA 2RJLA 4AYIA 4TN7A 5LA2A 1KD7A 3FGRA 3ZSLA 5C3OA 2R6QA 2B46X 1URXA 1VBD1 5F3CA 2Z42A 3ACHA 4D69A 1UY0A 1FPN2 2D6MA 3POIA 5A3PA 4CXYA 1YFUA 4I0WB 2VZPA 2W2IA 4N43B 2ILMA 2B42B 2YUEA 2VZ3A 1V6MA 1GNZA 2V09A 3MEPA 4XEZA 1G4GA 1G6NA 2WC2A 1MS3A 1UOGA 4FPOB 4YYOA 5C4WB 5JI9A 2XPJA 2IVJA 4GKYA 1GQHA 1LNSA 2PHDA 1UF2C 2GALA 3KHBA 4B7EA 4D7SA 3CL1A 4W50A 3SH4A 3SCFA 1J84A 5FY7A 1LY2A 1DHKB 1UIJA 2HJIA 2P3JA 2P34A 3JB4C 5H9SA 3R0RA 1X8EA 2CU5A 5FXWA 4KL1A 1JZ8A 1CWPA 1DZRA 2UWCA 5G04L 5C3QA 4DFSA 5IVEA 4UFIA 4GB32 4PDWC 4CSYA 1GSLA 3ALQA 4Y26A 5ANNA 5FKCA 3VGIA 4YVSB 4I0BA 3ILFA 1R1A2 2E32A 1PM7A 3GXUA 5EZWA 3WINE 3WQ1A 5HCAA 4UFHA 3UKTA 5C71A 4XF3A 1CKLA 2QZ2A 1GWKA 2RS31 1LHWA 4OHXA 1PGL2 3CDZB 3RMXA 3FHIB 3V0AB 5FZKA 2PMWB 1HW5A 2RG4A 2QQVA 4ZONA 4CP1A 1QXJA 1LHVA 1PIV2 4QX1A 4BQ5A 4AXOA 5E6HA 3V65A 1PK6A 1GANA 1R1ZA 1I3HA 3CZUA 3D4KA 1E5SA 2WS93 1LRHA 2YPJA 3K77A 4M3CA 4NPMA 4Q8KA 3WF2A 4WVWA 4CDXB 2JGWA 1ZBA2 2DCJA 3ZYGA 4CEYB 1VBB1 1W9SA 1GZWB 1RUC2 2VNGA 2FBEA 2QQNA 2PLV2 3NJZA 3THPA 5KHKA 4F4OC 3WQ7A 1UY2A 1SLIA 1W2OA 2JJ6A 1GQGA 1UOTP 1Z7S3 2IXHA 4K20A 4Y1YA 4MX3A 1AR93 1JZ3A 2WNUA 4A41A 1SLAA 4XJAA 3D0JA 1B35A 5FYTA 2YU1A 1AR62 4EN8B 1WA6X 2VOXA 4OLLA 2YB7A 5EJZB 4A3ZA 1H8TB 4KGQA 3WP5A 1LENA 2YHJA 4Q5OA 2ZHMA 5A7WB 2VULA 4HPKB 3PUQA 1N1SA 4M0HA 2ADEA 1Y9MA 4FFGA 1QO6A 3ZFGC 1AL0G 5FYMA 4C90A 4DXRA 4LIVA 4WM8B 4Y24A 1JZ6A 1JYNA 1U5MA 4OHWA 5KHIA 4ZHNA 1ZRDA 2XBO1 2E31A 5FFOC 3AL5A 1JXNA 1GQPA 2X5IB 3GNEA 3DECA 3ZKUA 4NROA 2JDPA 3S7IA 1KS5A 3HQRA 3PU8A 1RUD3 5JZGC 1C8M3 1DQ1A 1W6PB 3GCWA 3ACIA 5A6QA 3WXPA 1OSGA 2VOKA 4KNCA 4B8EA 3VBUC 3AKQA 4NR1A 1ZRCA 2OUHA 3CO2A 2NN8A 3CIHA 5F9TA 3TRSB 4LO4B 4A3XA 2MEV1 4Y4YA 3ZN6B 2WAOA 3ZN4A 4AI2A 1HRV2 1X50A 3OYWB 4YW3A 2FDFA 3ERBA 4E9KA 1HQWA 4CCNA 1LTEA 3TN92 5IVCA 1OK1A 2J42A 3NW4A 2D97A 1J58A 2ZGSA 1AR72 2VMHA 2IC1A 2W52A 3ES4A 4Y5TA 3SC7X 3WW3A 1UZ0A 1T2XA 1LULA 3HVDA 3B9IA 1MS5A 2O39C 5HBAA 3ILRA 5DMYA 1RUH2 3V0BB 1UKRA 2ZEYA 4HG6B 5DDJ2 4W8JA 3NV2A 4M4PA 1N1YA 2P4EA 1XU1A 1PHMA 1F4HA 2EXJA 3LAGA 2XL9A 4QKNA 2A55A 1DYOA 2GMPA 3MW4A 3POFA 3WZ1A 4DPNA 1JZ4A 1V6LA 3OOXA 4INDA 4YZ1A 2CG6A 2SLIA 4LO6B 3WSOA 3ETPA 5A70A 2HWC1 1W04A 3KQRA 4RQPC 1IS3A 1COV2 3ILNA 3AK0A 4IV3B 5CFCA 2E7TA 1BBT1 4KQ7A 1ZBE3 3ZSMA 1NCQB 1YC61 2P3IA 5TSWA 4ASKA 4C1WA 4ASLA 3AMMA 4A44A 3ZYJB 4YGEA 1SFYA 4Q4V2 5FAXA 2OQ7A 2VNVA 4BH9A 1LOCA 2EICA 2VZRA 3M3IA 4NWWA 2B45X 4QWNA 5FRAA 1EPZA 5LBFA 2QTWB 5L9RA 1PZ7A 5KHHA 1FNZA 1OQDA 4XTPA 1Q8QA 1RUJ2 3AMPA 4XETA 1JODA 3BB6A 3ACGA 3GZEA 5FWJA 2BBAA 1S4CA 2FDJA 2ID4A 1OK9A 2HWB3 2Y6KA 3NWKA 3LDBA 3R6SA 1OXCA 1QOOA 1LGNA 2ORZA 2IUWA 3MO4A 2GNTA 4NIHA 3HD8B 1C5IA 3CF6E 4LULA 2TNFA 2VQTA 1UPIA 3IAPA 4R8HA 2XVGA 4E8CA 1OUXA 5FV3A 3PURA 5JXHA 4ORFA 2XJSA 3MIGA 2PTMA 3MFCA 4AR2A 5HPOA 1MQTB 1M4WA 4YWAA 1OH3A 4LJHA 1BHGA 1S1AA 1BEV2 2QBXA 2W1WA 3AP6A 3PVEA 1HV0A 2HWD1 2JRAA 1TPMA 4XABA 4ITCA 4LBNA 2WINB 3LFIA 3B94A 2V8EA 5CA6A 2ARAA 4L9BA 4OUMA 4ZPIA 5FOBB 5FZ1A 2VZTA 2X10A 3AKPA 4A7KA 5JCTA 2ZBJA 2R1DA 2YC2A 4CDQA 5LA1A 3O1PA 2IXCA 1NWVA 1PO12 2HBTA 2L9LA 4FO9A 4XIOA 1AX0A 1WD3A 2BOJA 2GDFA 3KT7A 4HETA 4XXPA 4ZU5A 2R0HA 2F6BA 1ULGA 2OUJA 3NO8A 1ZRIA 5FXVA 2O8QA 2W95A 2VCBA 3TNPB 3USUB 1GWMA 4XFCA 2BFUS 1VBC3 1CIWA 2D40A 4LHKA 1RXFA 3AVRA 4FVVA 1PK6C 2LOJA 3HBKA 1XNDA 5FYSA 3WNPA 4AVBA 2AUYA 4PI0A 1UNBA 1VAMA 2VW0A 4L97A 2B5HA 3ZRZA 1XNBA 1AXYA 2FDHA 4PBPA 5F5AA 1GICA 4E4ZA 1FXZA 3IIAA 4W6WA 4UAPA 4XTMA 3I3EA 4GD4A 2VC9A 2R063 1E5IA 1YIPA 5C3SA 2C5DA 1BLZA 2XB6C 4JGZA 2WNUC 5EHDA 1MR5A 4LOTA 1ZBA3 4NHLA 1B35C 2WR9A 2ZPXA 1J1LA 2E33A 3OCPA 1RUF2 3B93A 4XVHA 1TVGA 4Y20A 3I3BA 4XJUA 3RI9A 2VQ0A 3U75A 3ZXEA 1XYOA 1VMJA 5JSPA 1ND3A 4BHPA 1V6JA 2CV6A 3B7MA 3ACFA 3EBRA 4JRLA 4L11A 4RR3A 1WCSA 1O3QA 4PIZA 4Y22A 1ULPA 4N53C 3LE0A 2UYBA 3FL7A 3WNXA 3U4SA 3K3OA 5IK8A 1MVQA 5A32B 2HH9A 2VBPA 4AVAA 2JICA 2P5BA 3U07A 1HV1A 1KFXL 3O1OA 2NPIA 1W39A 4YSFA 1RUNA 3FE5A 2Q8DA 4ES8A 5BNPA 1EV11 2KA3A 4L92A 2Q8OA 4JKLA 1ACCA 5GZDA 2VE1A 3VBHB 5LY2A 4DUWA 5JOYA 1K5MA 3GHMA 3OGSA 4IQPA 4KWKA 1OQEA 4QHBA 5I0SA 1CAXB 3TYJA 1VBE1 2K2SA 3DEMA 5AVAA 1AL23 3ME2A 2D93A 2RDNA 3ENRA 5F8PA 5A7OA 4IUGA 4JHSA 4AE2A 4MSLA 4E2SA 4OYUA 1HLCA 3P6BA 3GBFA 2DCKA 3O0VA 2KD7A 3AVSA 4GB31 4YFZA 2Y38A 3K51A 1R1A1 1JYIA 4LBKA 3SW0X 3I97A 1TME3 1XSQA 4GMP1 4PQQA 4QQOA 4QT6A 1P8JA 4WVVA 3X29B 2VBBA 1WMXA 3HNMA 1OURA 3I54A 2PHWA 1MEC3 4E4HA 2ARXA 1MZEA 1NCRA 2Y26A 1M06G 4A6OA 1A6CA 1DQ4A 3BODA 4BK4A 4C91A 4GIQA 1UYYA 4XDPA 1AR73 4XIKA 2AREA 3FUQA 4W6XA 1UOFA 4FPKA 2WFF1 5GLUA 3CI0J 3VBSA 2A1XA 4XFBA 5I0DA 2JDAA 1RUH3 3AJYA 4LXLA 4Q0QA 4XDOA 2A6ZA 5ERLA 4CRQA 2XOMA 3O1MA 3V64A 4QU1A 3EJHA 3T2QA 1JHJA 3B9CA 5FYCA 2KRIA 1G8WA 4HSJA 1OF4A 4QDSA 2I45A 4RFRB 4QX5A 5CFCC 5JIUA 4NUBA 4S2DA 5IHRA 3NAPB 2PLV1 4UBHA 1RJ7A 1HCCA 1RHI3 5F3GA 3THDA 4E4SA 3MW2A 4IE0A 4V1PA 1RVF1 2CY6A 2NMOA 2XLAA 3AZXA 3ES1A 1G9BA 4QKDA 1ZYBA 5BV6A 1RL3A 1ULCA 1QJY2 2PHTA 2CDPA 4MLOA 4WVMA 2A75A 2J1TA 2CDOA 3LIHA 4XCAA 3IMNA 4BK5A 3C2UA 2OPKA 4LUMA 5GLTA 2DU1A 2AYHA 2Z79A 4BE3A 5EIYB 1W0NA 1W2UA 4CCMA 2LM3A 3QH7A 2JECA 2DVBA 1W8FA 2HWF2 1X9TA 5A3MA 1CPMA 4D7TA 1JZ7A 3POEA 1LOBA 5FMOS 3N7JA 1UD1A 2IZ4A 2IZWA 4DS0A 4NHYA 2J1EA 1RUE1 4ZZ5A 3WQBA 4O9GA 4B1LA 2J1SA 3JUUA 3VWOA 3M3QA 5LATA 1L7QA 1SFNA 3AZZA 5EWSA 4WJG2 2DVAA 5J7MA 3DGTA 4Q4X1 1SG3A 2D44A 3A0NA 5C70A 3BU0A 3FHAA 2FDGA 3V56A 3CU7A 1UQXA 5JAXA 5FPLA 5LWBA 1QU0A 1O4YA 4CDQC 4EROA 1RXGA 4R4XA 5ACA2 3JZVA 5D21A 1VBD2 2Y34A 3WNKA 3GJBA 2EAKA 1AR83 2UY8A 4Z2WA 3K75B 3TN91 1EUTA 1PO23 1QIQA 2GN7A 1NXMA 1FMD2 4DINB 2YY1A 4M00A 1ULFA 2W1QA 3WY6A 2B7YA 2W68A 5HCBA 1D4M1 2RJ2A 3AFKA 1IS5A 4O7XA 4XAEA 3PHMA 4YM0A 5C3PA 4E27A 3ITQA 3SH3A 2YDEA 2XR4A 5FYZA 2ENRA 2VAUA 3ZYPA 4AEMA 4ONTD 2IFWA 3A22A 4Q26A 1V9U1 2DVGA 1UKGA 1J1TA 3MLKA 4N9HA 4BZ4A 4M01A 5FZOA 4QGMA 1ND2A 2XQWC 3MW3A 2GZWA 3GZTB 1H1AA 2A6WA 1QGBA 3TEYA 2NZ9A 4JGZC 2PA7A 4FPHA 5FPUA 5FZLA 1CESA 4XBQA 2WNOA 2Q1MA 4QKBA 2W91A 4IEQA 5I0UA 2O14A 5I0QB 3OJBA 2OQ6A 4PF1A 2R49A 3B69A 5FUNA 2JD4A 5FUPA 1ND3C 2RS32 4RR3C 1XQNA 3WW4A 5M0TA 1K12A 4AYUA 4EN9B 4BMEA 3ZXAC 1UY1A 3CEWA 4GZ9A 4RL7A 1TE1B 3NRUA 2O8OA 1RUJ1 4UW6A 1D7PM 2VU9A 4LHLA 4COUA 1S2EA 4HVRA 4MHRA 3RZKA 5H9RA 4F3JA 1AX2A 2W80A 5FP4A 2Z5WA 1LOEA 3O12A 4BQ4A 5JPMG 1HN1A 2YGLA 2AEZA 3K4AA 4Y33A 3UJQA 4P9LA 1K5MC 4CUGA 4HBNA 3KCCA 3GZUC 3T09A 2PHUA 1RMU3 3G6JB 4GMP0 1APNA 1UYPA 3LEMA 4TWTA 1VBB2 3OEDC 2RDQA 3VZKA 3H8XA 4JVAA 1CAVB 3M3EA 4PT6A 4FXGB 5DPNA 5FCCA 3VKLA 1BK0A 1NLRA 1S0GA 2IZ3A 1XSRA 3T1LA 5KC5A 4UFKA 3K3NA 2W5FA 3IZOA 2BTVC 2EHFA 3AZYA 2R1BA 4EYUA 3A4UA 4UYBA 1OI6A 5E88A 3PVNA 3KHCA 1X36A 4OI2A 3VL9A 4LA2A 1U5ZA 4CU9A 1JYTA 1XYNA 3KVAA 5CAZA 5IVFA 2XDVA 4XILA 2VL4A 4U2AA 5T5JA 1NCRC 1XE7A 1O4ZA 2YC0A 3JBG3 2WQ8A 4QXCA 3DYMA 3TOJA 2B39A 2LRPA 1LOFA 1GNYA 2UU8A 2GMMA 2RE9A 4KWJA 3OXUD 3IB3A 5FMCA 1RTVA 2XQRA 2HEWF 5C33A 5J48A 1SRZA 2XXZA 4GWIA 4XFIA 1O5LA 1U12A 3KF5A 3VBSC 5FZEA 3WCSA 2IXKA 1S0IA 2OPWA 1WBFA 2WIIC 2WKKA 3PMEA 2XBO2 1X7NA 5LA9A 4UI9L 5B4XA 2G7IA 5I8TA 2JXAA 4XUTA 4GALA 1UY3A 3SCGA 4LKDA 4AZZA 1ZZ9A 1UZYA 4FSJA 3I8TA 1S0FA 1W3VA 4CCDA 3LA3A 3Q8FA 1ENQA 3KT1A 4CCCA 1UYXA 1KITA 3IPVA 1G4FA 4JQTA 5C9AA 2YFUA 4HL0A 5CVRA 2X53S 5C5UA 3RJ2X 4S2FA 4N8MA 4CP9B 1VRH3 4CE8A 2ZKNA 2WWUA 3N9MA 4P5HA 3AZVA 4MGIE 4QXKA 3RNSA 2V73A 2VOVA 4DRVA 1AX1A 3HMYA 2GP3A 3OPZA 2DU0A 4FPCA 1IPKA 2XHNA 4XAAA 5CFDB 1OLME 2RM23 2ZGNA 2RR12 3QOPA 2K46A 4QDQA 3UYJA 3J7HA 2XUMA 2ZEWA 4GH4C 4Y5SA 4CCOA 1YQ8A 4RGKA 1NCQA 2ZACA 3AP4A 3OPWA 4JTNA 3ZD2A 2RS11 5A3WA 2Q8CA 3BIEA 3BUCA 1WLWA 5IT6A 2Y8KA 4QGNA 1WBLA 2BVBA 2F4PA 2IXJA 4IE5A 5B4NA 2X05A 5CG8A 2VG9A 1LHUA 4PLNA 4AOCA 2CNAA 2YV8A 2ET7A 5FY9A 2RS53 1IHMA 2A6VA 2HWC2 3AXDA 3CQOA 3LFMA 3POGA 4QB6A 2HWF3 3JQWA 1CX4A 2RL0A 1DF0A 1OKQA 4QB1A 4HK8A 5FPZA 1Q8SA 2P3YA 3SEEA 4D7YA 4FFHA 4NPRA 1BBT2 1VE0A 2WWJA 2YZ4A 1K42A 2XJUA 4BLJA 4P02B 3JB8A 3LOIA 1W90A 3QD6A 1GMMA 4RD7A 5IK4A 3ZXKA 4CA9A 5AFBA 1UX7A 4FP3A 1PGSA 2AENA 1HRI3 2W1UA 2YPDA 4PBOA 5FZOB 1Q3EA 1Q5OA 3MIEA 2I2SA 5C3RA 1CZSA 3WV6A 3LF7A 3ZIWA 4MO3M 2Y8SA 2WO3A 3I2IA 3ZPYA 3B02A 4D94A 5CNAA 1GR3A 1LCLA 4R9DA 5F5CA 4CVUA 4DY3A 5FZFA 1W9FA 2A5ZA 5A7SA 4FTSA 4ASMB 2J1AA 1LHNA 3LSEA 1ZM1A 1UOBA 1R093 3P3PA 1CAUA 3KV6A 4D6RA 5JDBA 1SLBA 2CL2A 1LR5A 3MIHA 1GYKA 1ND2C 5FXZA 3VBRA 2WO1A 1EPWA 2HWD2 3M2MA 5FZAA 4AI9A 2DFCA 3SKVA 4L8QA 2E7QA 4JDOA 5FMBA 2ORXA 1TQ5A 4UFMA 3SHRA 3MF9A 3VD7A 4A6SA 1OJYA 3H7JA 2NP0A 1YYNA 2JDMA 1L7LA 2W1SA 3OSDA 4FFIA 4H7LA 2WL1A 4LE4A 4N7IA 1VVCA 5F6LB 4AYEA 1GKGA 1IG3A 3SNMA 4YM3A 3VKOA 4UF0B 3R4SA 4B7KA 2HWE1 1VJ2A 1ELVA 1XNKA 4Q4Y1 3N7LA 1NA1B 4S2HA 3SQOA 2RHPA 4QHOA 4BPZA 3CNAA 2G9ZA 1ENRA 2XUEA 5D8AB 5G05L 1JZ2A 1IS6A 1VIWB 3C3VA 1BVP1 1QJFA 4IESA 1C28A 2JG9B 3IBMA 1ZX5A 2RS33 1NLQA 2VW1A 3NNLA 4HOOA 4Y4RA 5FYYA 3VZOA 3ZFFB 2E9QA 3G7DA 4LTAA 4EWDA 3APBA 4KMQA 1E5GA 1RYYA 5FXXA 3ZR6A 1PMHX 3E5XA 1X9PA 4CU6A 3UNPA 3VL8A 4OZXA 5J3UA 1JU4A 2B9UA 2JDKA 2GH8A 3P1IA 4RHV1 1I1EA 2ET1A 1KRIA 1TPNA 4AYMA 1JMUB 3OD0A 1AYN2 4FOQA 4DUXA 5FO9B 4GKXA 5FZIA 4AQSA 1HXS3 4J38B 1GOFA 2QCSB 1AYM3 5A32A 3GBWA 4BWOA 3WNNA 1O59A 3POJA 5FZBA 2W47A 2WNVA 3UL2A 4G4FA 1OLRA 4H55A 2JDUA 1C57A 2XH6A 3VDBA 1GP6A 5BNQA 4OHYA 4APLA 5ACA1 2WBKA 3KM5A 2QQWA 1LOFC 1QGLA 4MGTA 1RUI3 3WHUA 4I3GA 4NIAA 1RUG3 1U5XA 1W6MB 3WP6A 1FMD1 3NMBA 3J9SA 2W46A 2JX9A 4CDUA 1QOSA 5KXDA 1L3JA 3VD9A 1XJAA 4O9EA 2J1UA 2WDBA 2GN3A 2YXSA 5DAPA 4A2UA 4WM7A 5J09A 4AFDA 2WWSA 4BB3A 1EV12 4AEDA 1NXD1 4C0BA 2OIIA 4UOJA 5FWEA 4MZUA 4LLFA 1W8ZA 5A3NA 2GU9A 1VBE2 4RS5B 1NX9A 1CZTA 1Y9GA 3WW1A 2D98A 5HCHA 2J1VA 3BIWE 1H2PP 1IGOA 1K3IA 3HOBA 3HN3A 4JV4A 5CYYA 2RDSA 5EQUA 5T52A 5C9AC 5DZFA 4PZ5A 1FAYA 1DYPA 2PQSA 4G3YC 1TMF2 4NMIA 1GZTA 1TEIA 1IKPA 1SMVA 5T50A 4SLIA 1U5YA 1XNCA 3I2JA 1BZWA 1W8OA 5A7QA 3OUHA 3URFA 2JG8A 4P9IA 4AVVA 5L9BA 1VBA3 1O9AA 5IUQA 2WYFA 3MUY1 3MPPG 5SV8A 1GP4A 2MEV3 3H1MA 3MUZ1 2VCMA 1XU2A 2D6PA 2R16A 2LW8A 3T08A 3OBTA 3IAQA 4YW4A 4E2QA 2RMU3 1NAEA 2ZXQA 3HNBM 3RMYA 3WF3A 1YJKA 1H04P 2OVUA 2WFF2 4WVZA 4UXAA 3DPRC 4MGYE 1A8DA 2ZHNA 3EXUA 4MXWA 4F83A 5BYNA 2PAKA 4S2GA 4JGYC 3J8F1 4JKMA 2FCTA 4I0AA 5DAQA 2A7AA 1A3KA 4D6QA 1OT5A 4PHZA 3RYPA 1JYVA 1OOPA 3J7NA 3J7MA 4W6YA 4Q4W1 4YG6A 2WLQA 4G9SB 2QQPA 2A71A 3FJSA 5JOZA 4E4DX 5C8CA 4UW3A 5LEJA 2V72A 4LO5B 2QE3A 4AI3A 2P1BA 4CDWB 2VOWA 1RVF2 2D6KA 2VJXA 4Z82A 4CUCA 4KH9A 1BBT3 2F4LA 2ZAHA 3AKRA 1JOBA 2WA3A 3F2ZA 5FQ0A 2VZQA 2FHRA 5HV0A 5FO8C 2ZX1A 2Y6HA 3GJAA 1VRBA 4XURA 3ZDSA 1QJU3 4P9WA 3ZYHA 5ISLA 1POV1 1SEFA 1POQA 2WN3A 3ELNA 1GOGA 1OA2A 2C24A 2DCZA 2GMEA 2PXJA 4RA0A 3IKWA 4BWCA 1MACA 3M8LA 1ULEA 1DLLA 4I3PA 2Z2SB 2A73B 3PUIA 4YVWB 1E88A 1UMZA 3J7LA 3CJIA 1NQDA 3INAA 3VBRC 2MHFA 1RUE2 4MHUA 4BMBA 2W87A 1YXWA 3H9AA 3ZFEA 3ASIA 3DXTA 1JOPA 3I59B 5K0UA 5FZ6A 2B5ID 4BQYA 4CEWC 2DWRA 4TSVA 1CAWA 1QQP3 2YROA 3PVOA 1TG7A 2WZR1 4Q4X2 5LBBA 4IEUA 1PVC1 3LSDA 3VHPA 5BNNA 4BQXA 3W58A 1V6IA 5JXGA 3VKMA 3O1UA 1VMFA 2HWD3 4CU7A 1AHSA 1W6QB 1OD5A 1DQ6A 2BVVA 1Z78A 4ZY9A 4AGRA 1QXRA 2RKZA 1Q56A 3VBFA 4MGZE 4UW4A 2GH2A 3PLQA 5AVPA 5BXXA 1ZZ8A 4D0QA 4DEVA 3USSA 4YLZA 2VGDA 2MNGA 2OXBA 3VDDA 1W06A 1LEDA 5DZGA 4IV1B 1BQPA 1WMEA 1W6OB 2RR11 1WMFA 1D4M2 2Y0OA 1J3PA 3C7HA 1CVNA 3KD4A 3RJRA 4EWEA 3S57A 2BYVE 1Q8OA 2OT7A 4META 4Q27A 2CWMA 3K2OA 4KG8A 5FYBA 3TWIA 4QXBA 2Y6LA 3L9JT 1YLLA 2H6CA 4QHZA 1ZA7A 3WR0A 5CU1A 5LEKA 3A7QA 1V9U2 3KQ4B 4NAMA 1E5RA 4QPGA 5HV4A 2PELA 1OPMA 5I8SA 1O3TA 3I2OA 3DCQA 3E1F1 3R4UA 4LIUA 4Q2FA 1HB1A 3JU9A 3LD8A 1CQ9A 5L7OA 2YC4A 2RKYA 4DIQA 2WNVC 1QJX3 3ORJA 4LBQB 2ARCA 3H7YA 4GULA 4OCTA 2D7FA 4OHVA 3VZNA 3ZOIA 2BBVA 3W21A 3TVJA 3Q8CA 5I0RA 1ODNA 2WS91 3FN9A 3WP4A 1LECA 4D8MA 4CYDA 3DF0A 5K4LA 3WVJA 2AR6A 2VUAA 4PDWB 1HFIA 2ZMNA 4CDUC 4IE4A 2D6LX 1ENSA 3CJXA 4JDNA 1QF3A 4QPYA 5BNOA 3BU7A 2W39A 4WM7C 2ZGPA 2W0XA 3ZYFA 4AEDC 5JOWA 1AR91 5KHGA 1LOAA 4QX2A 1LGBA 3ZSEA 3GXEA 1FPN3 4P9XA 3BTXA 2O0OA 3LEGA 4IGQA 4X8PA 2JKBA 3KMHA 5A6XA 1U0AA 3FC0A 4A4AA 5FY5A 2WO2A 3C7GA 3ZMOA 3HNYM 3KB5A 4DXTA 1C3HA 3FHQA 1X33A 2HYKA 3M7PA 1EV13 2LS6A 2VW2A 2VZSA 3MBWA 4H2AA 4W65A 4YFWA 5FY8A 3RYKA 4EZ4A 1XB9A 2MCYA 4LKFA 4XFFA 3EQEA 3VBOA 1SFPA 4NO4A 3IMMA 1BVVA 1JU3A 2JG8C 3AP5A 1AXZA 3CKHA 2EIGA 3GBGA
chains in the Genus database with same CATH topology
5HYTB 1MD7A 5FO8C 2G7IA 1GHQB 2QQMA 3ERBA 3POIA 2XWJI 3R62A 3ZD1A 4LORA 4WJG2 1OK1A 1E5GA 4LOTA 1ZJKA 2MCZA 2YBYA 1E88A 1G4GA 2O39C 3RJ3D 1TPNA 4AYMA 1G4FA 1PPQA 4B2RA 4J38B 1VVDA 2B5ID 1LY2A 3POJA 2A55A 1GPZA 3POFA 1H2QP 4AYIA 1SZBA 3POBA 3L89M 2CG6A 4AYDA 1HFHA 1OK2A 2W81A 4CSYA 1TPGA 2RKZA 2CG7A 3CALA 4ONTD 3ZD2A 3DEMA 4YNXA 3GOVA 4MUCA 1CKLA 4JHSA 4LOSA 2BZMA 2XQWC 2KMSA 1QGBA 3MQLA 1OJVA 4K12A 2XRDA 4B2SA 4ZH1D 4LMFA 3POGA 2WNOA 2RL0A 2RLQA 4IGDA 3SW0X 5CKNA 3KQ4B 5I0QB 1H2PP 1OK9A 5CISA 4PZ5A 4A5WB 2JGXA 2QQKA 4GZ9A 2RLPA 3IX0A 2JGWA 2RKYA 2YRAA 3T5OA 1O9AA 3IU3I 1C1ZA 4F4OC 2W80A 4KKDA 3TVJA 5JPMG 1SS2A 2JRAA 1TPMA 5HYUB 1UOTP 1NZIA 3KZJA 3EJHA 1QUBA 2KRIA 2V8EA 1HFIA 1MD8A 3KXVA 1H04P 1E8BA 3OEDC 1SPPB 1HCCA 2QQLA 4DJZA 1NWVA 2ERJA 2IZ3A 5CKMA 2QY0A 4FXGG 2EHFA 2XRBA 3GXEA 1FBRA 1Z92B 1QO6A 3OP8A 1GKNA 1OK3A 1OJYA 1U5MA 3NFPI 2EC3A 3INBC 1OJWA 1VVCA 2CKUA 4AYEA 1GKGA 2QQOA 1NT0A 2LOJA 3M7PA 1ELVA 1Q3XA 5CKQA 3OXUD 1H03P 2MCYA 5HZPB 1SRZA 1SFPA 3O8EB 4C16A 1SPPA 3ZRZA 5HYPA 3POEA 2XWBF 2UWNA 2IZ4A 2WIIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYT B;  1MD7 A;  5FO8 C;  2G7I A;  1GHQ B;  2QQM A;  3ERB A;  3POI A;  2XWJ I;  3R62 A;  3ZD1 A;  4LOR A;  4WJG 2;  1OK1 A;  1E5G A;  4LOT A;  1ZJK A;  2MCZ A;  2YBY A;  1E88 A;  1G4G A;  2O39 C;  3RJ3 D;  1TPN A;  4AYM A;  1G4F A;  1PPQ A;  4B2R A;  4J38 B;  1VVD A;  2B5I D;  1LY2 A;  3POJ A;  2A55 A;  1GPZ A;  3POF A;  1H2Q P;  4AYI A;  1SZB A;  3POB A;  3L89 M;  2CG6 A;  4AYD A;  1HFH A;  1OK2 A;  2W81 A;  4CSY A;  1TPG A;  2RKZ A;  2CG7 A;  3CAL A;  4ONT D;  3ZD2 A;  3DEM A;  4YNX A;  3GOV A;  4MUC A;  1CKL A;  4JHS A;  4LOS A;  2BZM A;  2XQW C;  2KMS A;  1QGB A;  3MQL A;  1OJV A;  4K12 A;  2XRD A;  4B2S A;  4ZH1 D;  4LMF A;  3POG A;  2WNO A;  2RL0 A;  2RLQ A;  4IGD A;  3SW0 X;  5CKN A;  3KQ4 B;  5I0Q B;  1H2P P;  1OK9 A;  5CIS A;  4PZ5 A;  4A5W B;  2JGX A;  2QQK A;  4GZ9 A;  2RLP A;  3IX0 A;  2JGW A;  2RKY A;  2YRA A;  3T5O A;  1O9A A;  3IU3 I;  1C1Z A;  4F4O C;  2W80 A;  4KKD A;  3TVJ A;  5JPM G;  1SS2 A;  2JRA A;  1TPM A;  5HYU B;  1UOT P;  1NZI A;  3KZJ A;  3EJH A;  1QUB A;  2KRI A;  2V8E A;  1HFI A;  1MD8 A;  3KXV A;  1H04 P;  1E8B A;  3OED C;  1SPP B;  1HCC A;  2QQL A;  4DJZ A;  1NWV A;  2ERJ A;  2IZ3 A;  5CKM A;  2QY0 A;  4FXG G;  2EHF A;  2XRB A;  3GXE A;  1FBR A;  1Z92 B;  1QO6 A;  3OP8 A;  1GKN A;  1OK3 A;  1OJY A;  1U5M A;  3NFP I;  2EC3 A;  3INB C;  1OJW A;  1VVC A;  2CKU A;  4AYE A;  1GKG A;  2QQO A;  1NT0 A;  2LOJ A;  3M7P A;  1ELV A;  1Q3X A;  5CKQ A;  3OXU D;  1H03 P;  2MCY A;  5HZP B;  1SRZ A;  1SFP A;  3O8E B;  4C16 A;  1SPP A;  3ZRZ A;  5HYP A;  3POE A;  2XWB F;  2UWN A;  2IZ4 A;  2WII C; 
#chains in the Genus database with same CATH topology
 3S0M A;  1FI2 A;  1V6O A;  1PZ8 A;  4FXK B;  4XFH A;  1US2 A;  2PAE A;  3RQ0 A;  2XML A;  4AWD A;  1J59 A;  1WZX A;  2VEC A;  3AYE A;  4OVE A;  1ULD A;  4GB3 3;  1RC6 A;  3L2H A;  1O91 A;  1ONA A;  2TEP A;  4TZD A;  3ZYB A;  3M4F A;  4A45 A;  5IJR A;  1R1A 3;  3WG3 A;  5LK7 B;  1W9Y A;  4AVT A;  3OUI A;  4GMP 3;  1OKO A;  2ZGO A;  4FOW A;  1E5H A;  2WSU A;  5DUX A;  4WBB A;  2DVD A;  2Q30 A;  3SH5 A;  4JHT A;  4AVS A;  2CSG A;  3GYD A;  2WYS A;  4Z07 A;  3E6D A;  1OOP C;  4YW1 A;  3POS A;  1WLC A;  3MPB A;  3RZZ A;  1SZB A;  3ZFG B;  2GAU A;  1PIV 3;  2VZ1 A;  4QPW A;  3WCR A;  5C8C C;  1IKQ A;  2ZS6 B;  1XRU A;  1AYN 1;  3K3T A;  3ZXL A;  1HFH A;  1JHN A;  1OH4 A;  2XJP A;  2BGP A;  4X6Q B;  1QMJ A;  1D2Q A;  2E7A A;  2NMN A;  4XUP A;  1POV 0;  1JZ5 A;  4COW A;  4P00 B;  3S5A A;  2G4I A;  5JZG B;  1H9P A;  4XCB A;  4XJ8 A;  3EB7 A;  4XF4 A;  5FLH A;  5LK5 A;  2PAM A;  1QJZ A;  2Q8E A;  3VBU B;  2VUC A;  1H30 A;  1RUC 3;  2PLV 3;  4MV2 A;  4DMI A;  1OLM A;  2PHF A;  3PMS A;  3OD4 A;  4P9J A;  2NQY A;  1RVF 3;  3OUJ A;  1ASJ 1;  2GP5 A;  5FPA A;  1REF A;  1VLN A;  2PHR A;  5K7P A;  1ZBE 1;  1BXH A;  2RS1 2;  1YHF A;  3OY8 B;  5AC9 1;  4QXH A;  5FP7 A;  1VR3 A;  1AR6 3;  3PJY A;  3CJI C;  3IM0 A;  4CUB A;  4EQV A;  3ZFE C;  1DQ5 A;  4NWV A;  5FLJ A;  3UJO A;  5DUW A;  5K0U C;  2QDN A;  4AL9 A;  2QQK A;  2YMZ A;  3H3L A;  4TLG A;  1SDD B;  5GLZ A;  1DGW X;  1WCU A;  4GAZ A;  2CGP A;  2HWB 1;  1JYC A;  5BNN C;  1PX4 A;  3VD3 A;  2YFZ A;  5GM0 A;  3OGV A;  1D0H A;  5HCF A;  1W2N A;  5C8W A;  1GKB A;  4EN6 B;  1TMF 1;  5CBL A;  3EJK A;  2DCY A;  1YQC A;  1OA3 A;  2G1M A;  3N7M A;  1J83 A;  3GZA A;  3VBF C;  1H6X A;  4RQP B;  3KV5 A;  4OQ9 A;  3VDD C;  3PTR B;  1SPP B;  2VZV A;  4I2O A;  1ST8 A;  3N9L A;  4XJZ A;  3RZJ A;  3WT3 A;  1HRV 3;  2Y8T A;  5JUV A;  1S55 A;  3B00 A;  2VMF A;  3TN9 3;  1SLL A;  5EXO A;  3LDR A;  3MV0 1;  1NUK A;  1XE8 A;  1LU2 A;  1SLT A;  2ADD A;  4QPG C;  1JYX A;  4Q1P A;  2P17 A;  1W6N B;  3BPZ A;  4COV A;  3M7A A;  5DDJ 3;  3BVC A;  1DGW A;  3WUD A;  4R4Z A;  2JDY A;  2D5F A;  5C7G A;  1VBC 1;  5L7O C;  4BXF A;  2LAL A;  4YW6 A;  3ZSJ A;  2WA4 A;  2VR4 A;  1Y7B A;  3FFQ A;  2UWN A;  1KJL A;  5KWR A;  2VCC A;  1MD7 A;  2XG3 A;  2FDK A;  1CJP A;  5LB6 A;  3WDY A;  5JR2 A;  5D2A A;  2HWE 2;  4E2G A;  2EIB A;  2ZZQ A;  4HN1 A;  3ECQ A;  1JI6 A;  4IGO A;  4Q4Y 2;  1YQ6 A;  2VTF A;  5IK7 A;  4NHK A;  3OF1 A;  1COV 3;  3AX4 A;  4H14 A;  2R04 2;  5FPV A;  5GLW A;  3RRD A;  5ABJ B;  1F8V A;  4W4Z A;  5GZC A;  1R08 1;  1SCS A;  4QB2 A;  3GF6 A;  3LA7 A;  5BNO C;  3RJ3 D;  5F32 A;  2R06 1;  2C4X A;  5GJ6 A;  4Q4V 3;  5B2G B;  2BGC A;  4OUS A;  4ET7 A;  4JQR A;  2UWB A;  1MZ6 A;  3WQ0 A;  1BMV 2;  1DQ2 A;  3HN1 A;  5FZG A;  4HAN A;  4XUN A;  1RUJ 3;  3FUO A;  1OVS A;  2QFE A;  3III A;  3POB A;  3BTA A;  4RHV 2;  1FNY A;  3GAL A;  2R7E B;  3UES A;  5FIX A;  3KGL A;  1OPO A;  4JZR A;  4H7M A;  4XFA A;  2VQA A;  2W81 A;  2YBP A;  3MZH A;  1PK6 B;  5L36 A;  4N43 A;  1HB4 A;  3WDT A;  3VBO C;  1I9R A;  5C4W A;  2A3Y A;  4M3C B;  4B4Q A;  5IYY A;  4MUC A;  3PVB B;  5FZH A;  4C8D A;  1NOV A;  2H0B A;  3LPG A;  2VVD A;  5F3I A;  5F37 A;  1O4T A;  1BEV 3;  4HKO A;  4OI0 A;  1V70 A;  4HSL A;  1WW7 A;  4RGA A;  2DTY A;  3MQL A;  4ZH1 D;  3DYP A;  4LMF A;  1XNT A;  1AL2 1;  3RDI A;  1DFQ A;  1F5J A;  2ZMK A;  1KQR A;  3D0S A;  3N4M A;  1RED A;  2Q5T A;  2WNU B;  3L2Y A;  1WLD A;  4NRM A;  2AAC A;  3AJZ A;  3VDC A;  5JSR A;  1B35 B;  1H8V A;  4Z8B A;  5CIS A;  1UZW A;  4YVS A;  2G9G A;  1F5F A;  5FMD A;  3T0B A;  4AI0 A;  1PO1 3;  3K48 A;  3ZYR A;  1O7F A;  3N7K A;  5EPA A;  1TME 1;  1HB2 A;  2XWJ B;  1HDK A;  1YFW A;  3W9A A;  3DN7 A;  1YIF A;  2YRA A;  3FFZ A;  4N53 B;  1MEC 1;  1VAK A;  3UGG A;  1CD3 G;  4YIZ A;  1O8S A;  5JI7 A;  2WQ4 A;  3V0A A;  4K8R B;  3I3Q A;  1UCX A;  3T1M A;  3HQU A;  2VY0 A;  3RGB A;  1SS2 A;  5KR7 A;  1QDO A;  4IEV A;  3DUI A;  4I01 A;  1NY7 1;  1QUB A;  2RV9 A;  4K6B A;  4NVP A;  4C0H A;  4AW7 A;  1Y43 B;  2XKO A;  3WSY A;  3CHX A;  3ON7 A;  4JKK A;  5EJ1 B;  2C6S A;  4OUE A;  4FPE A;  2VUJ A;  4IEO A;  3QLQ A;  1E8B A;  3ZXD A;  3LCP A;  4BDV B;  2GSY A;  4LK7 A;  2ZCW A;  2R07 1;  3OBA A;  4AK3 A;  3N3H A;  4TXW A;  4CDX A;  4ISR A;  4CEY A;  4WV8 A;  1SQ4 A;  1GZW A;  3NJA A;  1OK3 A;  2CWS A;  1RHI 1;  1FT9 A;  4ISQ A;  3NFP I;  4JTO A;  2AGS A;  4FPJ A;  1RUF 3;  1S2B A;  4CDW A;  3VD5 A;  3AYD A;  4CXX A;  5BNP C;  1DZT A;  3QAC A;  2WN2 A;  4GJY A;  4F7Z A;  1IS4 A;  2OKX A;  3QBQ A;  1MVE A;  2TBV A;  3B01 A;  4B4R A;  5A1F A;  3J8F 2;  3WOG A;  5FOJ B;  3MIC A;  2BZD A;  3SCH A;  4BU2 A;  5ABJ A;  1W2A X;  3WG1 A;  1H8T A;  2IXI A;  1QEX A;  4Q4W 2;  5A7W A;  4YGB A;  2ZGU A;  1HX6 A;  3NNM A;  4HPK A;  4Q0U A;  1QDC A;  4AI1 A;  3MID A;  1OD3 A;  3NJV A;  2VZU A;  4CPB D;  3ZD1 A;  4WM8 A;  2V5Y A;  4PIX A;  4XZP A;  3OG2 A;  1H1I A;  5JOX A;  3ZLE A;  4KWU A;  2B9V A;  4NRQ A;  5JR7 B;  3MLL A;  5ANQ A;  2X5I A;  3S6P A;  4CZS A;  1LOG A;  4BIF A;  5CFC B;  4EN7 B;  5T55 A;  1W6P A;  4L99 A;  2YU2 A;  1JBC A;  3T3Y A;  4BQ2 A;  3ABZ A;  3NJX A;  4CCJ A;  1SBE A;  4LBM A;  1IPJ A;  1GPZ A;  2J1R A;  3AL6 A;  1HJF A;  5FUI A;  3ZN6 A;  2WFP A;  1EAH 1;  3CMG A;  4QPI B;  3AZW A;  3OYW A;  3ZXF A;  2JWP A;  3NL1 A;  2W9X A;  2PQQ A;  3BN6 A;  3H0O A;  4AYD A;  3W20 A;  5LW9 A;  2P3K A;  5E1R A;  5E89 A;  5GAL A;  3THT A;  1UOJ A;  3I2H A;  2VH9 A;  1US3 A;  1W6O A;  4XMI A;  1KEX A;  2WZR 2;  1S2K A;  3V0B A;  2FMY A;  2WAB A;  1YRZ A;  4QM8 A;  1PVC 2;  5IAV A;  1DG6 A;  3PDQ A;  2EXH A;  1XNA A;  5D1I A;  4J25 A;  4AHZ A;  3BPS A;  1JUH A;  4K12 A;  1OJV A;  4B2S A;  1H0B A;  3AYC A;  1JS9 A;  3H8U A;  5IAX A;  1UXX X;  1O3R A;  1E57 A;  1C8N A;  1CIY A;  3W5N A;  4AEK A;  3NKT A;  1WW4 A;  3KV4 A;  5FJH A;  3RWK X;  3FLP A;  5CKN A;  4P9G A;  5IVV A;  1ZA4 A;  5FZ0 A;  4JAA A;  3A0K A;  3KWV A;  5KHJ A;  3I49 A;  4HN0 A;  3Q9O A;  5FP9 A;  2IFR A;  2GNB A;  4A5W B;  2XQX A;  5I91 A;  4KGG A;  4CDQ B;  3I7D A;  4IV3 A;  5FP3 A;  1W0P A;  5FK8 A;  3O5S A;  1ODM A;  1WW5 A;  1FOD 1;  3QH6 A;  1G7Y A;  5LRS A;  1WCK A;  2XLG A;  2WQZ C;  1QJY 3;  1RIT A;  5T5P A;  2EF6 A;  4L2N A;  4HVO A;  2ZJC A;  2WLP A;  1BK1 A;  3I2F A;  4LKS A;  1NE4 A;  1I6X A;  1YNA A;  2O1Q A;  3RG0 A;  4EWA A;  1F9K A;  3AMQ A;  4MXV A;  2RVA A;  1W03 A;  1CON A;  4N43 C;  5LBC A;  4FQZ A;  1KFU L;  3GM8 A;  1UMI A;  5C4W C;  4R9A A;  3UKV A;  5DUU A;  1YFY A;  5J37 A;  2ERF A;  1CR7 A;  3U4X A;  3BOP A;  2J7M A;  2TUN A;  4IE7 A;  4LBJ A;  4LR4 A;  1IQA A;  3VDA A;  2XL7 A;  2BU9 A;  1RGS A;  1SBD A;  3ZLI A;  2WS9 2;  3OPT A;  3O0W A;  2P2K A;  3ETQ A;  4JX0 A;  5FKB A;  3M70 A;  3U78 A;  4NOT A;  4PF5 A;  5FYU A;  1MQT A;  1RMU 1;  3VHO A;  3MLJ A;  4JGZ B;  4UT5 A;  1IZ3 A;  3B3Q E;  4FP2 A;  3VLB B;  1O5U A;  4LPL A;  1DU3 D;  1HIX A;  3WF4 A;  4P5Y A;  4Y20 B;  1OUS A;  2DUO A;  1DYK A;  1Z7S 2;  1HQN A;  3H50 A;  4YVS C;  5ACA 3;  1Q3X A;  2WO7 A;  4Q1R A;  4UFL A;  1AR9 2;  1G9F A;  1VBD 3;  5DAB A;  2BER A;  1ND3 B;  2PN5 A;  2QJV A;  2XWB B;  2A3X A;  3AKS A;  1H6Y A;  3D82 A;  3JD7 1;  4QDR A;  1S0B A;  4MUV A;  4RR3 B;  1EUU A;  3D3A A;  4Y22 B;  1D2S A;  1FMD 3;  4ES9 A;  5HYT B;  1YI7 A;  3JBG 1;  4R52 A;  1SDW A;  4BJ0 A;  2VD7 A;  1G9C A;  5JXJ A;  3N35 A;  2AEY A;  1W99 A;  1AF9 A;  1YEW A;  2VBD A;  3H3Z A;  2CGO A;  2F17 A;  5IVJ A;  3USU A;  1WMD A;  1K5M B;  5LCW L;  1UW8 A;  1Y3T A;  2V4A A;  3BTY A;  3OBR A;  4HKW A;  4DRR A;  2YG0 A;  2JE7 A;  1REE A;  3O7O A;  3SIS A;  1NE6 A;  1DLC A;  3WD5 A;  1AXK A;  2P37 A;  5JSO A;  1RUD 2;  1C8M 2;  1LHO A;  4BQ3 A;  5GKA C;  1YI9 A;  4CDX C;  3P5B A;  3ZFG A;  5A1A A;  4CEY C;  3U37 A;  2R04 1;  3VD4 A;  5EYX A;  4UFJ A;  4YW2 A;  4LEJ A;  3A23 A;  5A1L A;  1H2Q P;  4JRA A;  3W59 A;  3C7O A;  3HR9 A;  2EVX A;  4QQP A;  1VRH 1;  2FD8 A;  1WD4 A;  3F95 A;  5IAT A;  2Q1Z B;  1NCR B;  4BA6 A;  2C26 A;  4IEY A;  2AZ5 A;  1PNG A;  1YQ2 A;  2DUP A;  3LZZ A;  3VKF C;  2CG7 A;  4AFM A;  1MZ5 A;  3I2K A;  5J1X A;  1K5J A;  3GOV A;  2C0Z A;  4IE6 A;  5ABJ C;  3RVH A;  1H8T C;  2RM2 1;  1W8N A;  1QNW A;  2RDR A;  2DV9 A;  2XJV A;  2VXJ A;  2X8K A;  3A21 A;  3NV1 A;  4NHX A;  2CTV A;  4ONU A;  2VM9 A;  3VBS B;  1CX1 A;  5DN4 A;  1C4R A;  2WII B;  3OEB A;  1JN2 P;  4K1Y A;  4J6G A;  3CZJ A;  4UWD A;  1NG0 A;  2HKX A;  3SEP A;  4NIG A;  5IVY A;  1HQL A;  4XHB A;  1LU1 A;  4DB5 A;  2WJS A;  4WM8 C;  5JMO A;  1O6U A;  1W8U A;  4ATE A;  1N3P A;  4YZ3 A;  5A6Y A;  1UPS A;  2X5I C;  2B8M A;  3QCW A;  3B5L B;  4URT A;  4DOU A;  4Z2A A;  4FT8 A;  2E51 A;  1VBB 3;  3VBH A;  2GC3 A;  1HJG A;  4B4P A;  5JLV A;  1YO8 A;  2RS5 1;  1CAX A;  1XE0 A;  1YFX A;  2VOT A;  3T4V A;  1ASJ 2;  1OVP A;  4YZ2 A;  1JTZ X;  4Z92 B;  1UU5 A;  1ZBE 2;  2Y0I A;  4AQ6 A;  3FBY A;  5AC9 2;  5KC6 A;  1ZZ6 A;  3JQX A;  5IWF A;  3POW A;  4FOV A;  4WVM B;  1UU6 A;  4CP0 A;  5HYU B;  1HRI 1;  3TB0 A;  1POV 3;  1EY2 A;  5T3N A;  3VZL A;  2EXK A;  3K46 A;  2ES3 A;  4KBB A;  1SCR A;  4GWM A;  1CJD A;  1DGR N;  4GH4 B;  1F2N A;  2JEM A;  4IEZ A;  4XPV A;  4XUO A;  5BPX A;  4QQ2 A;  2XLF A;  2X29 A;  2ZGM A;  4N9I A;  2OZ6 A;  4QGL A;  2HWB 2;  2G9F A;  2XBO 3;  2QQL A;  3J4U H;  1W0O A;  4YZ4 A;  3I4I A;  2ERJ A;  2QZ3 A;  3I3D A;  3T0A A;  4FXG G;  5FR3 A;  2ZHL A;  4AFB A;  1R09 1;  3N9Q A;  4FOY A;  2GC0 A;  3ST7 A;  1GKN A;  1W6N A;  1QKQ A;  2WZR 3;  5H9Q A;  4P08 A;  3EYP A;  4PIY A;  3UK9 A;  1PVC 3;  3OGJ A;  1OJW A;  3VHN A;  3M3O A;  3OTF A;  3FLT A;  4XW3 A;  5DZE A;  1OBN A;  3O14 A;  3LWC A;  2NYY A;  4XYX A;  2D6N A;  1TNF A;  4IV3 C;  5HZP B;  3NQH A;  2QVS B;  4WZF A;  5F2S A;  5LZ6 A;  1VMH A;  2VCA A;  1NCQ C;  2W94 A;  2GND A;  4Y1V A;  2EAL A;  4C16 A;  3NAP A;  4PO7 A;  1N1T A;  3MI8 A;  3WDU A;  2YBK A;  2VNR A;  1GHQ B;  4FPF A;  2RR1 3;  3F6K A;  3GGL A;  3WUC A;  1UU4 A;  1XXN A;  2KXL A;  1OLQ A;  3WNM A;  3R62 A;  2K0G A;  4PLO A;  2DDU A;  1H9W A;  4QD2 A;  1QHD A;  5F7U A;  3NVC A;  3AMH A;  4BXS V;  1VBC 2;  4ATF A;  3NNF A;  5FRE A;  3AXE A;  3LB9 A;  1ZRR A;  1UYZ A;  1PPQ A;  4PCR A;  2QKD A;  3T30 A;  5F3E A;  2ZTN A;  4YG0 A;  5EP9 A;  1GP5 A;  4LBO A;  1F15 A;  1ND2 B;  1GU3 A;  4RFT 0;  1S0C A;  2HWC 3;  4GWN A;  3MFA A;  5SV5 A;  1MQT C;  5FZD A;  2N7G A;  4FTB A;  2VVE A;  2PHX A;  4YNI A;  1UXZ A;  3BYW A;  1UN1 A;  1WCQ A;  3L89 M;  1R08 2;  2VXR A;  4X8N A;  5J96 B;  1HXS 1;  3H1W A;  5FP8 A;  4AHX A;  2R06 2;  3O1T A;  4M0N A;  1AYM 1;  3TNQ A;  5A3T A;  4HLT A;  5F5Q A;  1W8H A;  3E5U A;  1KDM A;  1ZNP A;  4FPL A;  4V2V A;  3N36 A;  4DNY A;  3RZG A;  2VUD A;  1R64 A;  2FZ2 A;  1PMI A;  2HLE A;  1BYH A;  2WSV A;  3VHR A;  2WAA A;  3J26 N;  1RUI 1;  4YRD A;  3WDV A;  4XXA A;  2XRD A;  1RUG 1;  2QQJ A;  5J98 B;  5BY5 A;  3MYX A;  4XF9 A;  2OYZ A;  2OZJ A;  1AUY A;  3H3U A;  3KLS A;  3ZO0 B;  3AYA A;  1QY4 A;  1HN0 A;  2W08 A;  1LAJ A;  4KWL A;  3RPQ A;  1LOD A;  2AC1 A;  1RIN A;  3E5Q A;  1N3O A;  1VAV A;  3KCY A;  4KI5 M;  2BNN A;  4N53 A;  2JDH A;  3WSX A;  5FJK A;  5DQ0 A;  1AL2 2;  2VMI A;  3WDW A;  2HEV F;  4URA A;  2DVF A;  4PLM A;  4BCU A;  2WT1 A;  3JXS A;  4QQH A;  2FCU A;  4ZXK A;  3PTY A;  1SBF A;  1RUO A;  3CLP A;  1UZV A;  3KZJ A;  2BRT A;  2XHK A;  2Z69 A;  3LIG A;  1H4H A;  2JDN A;  4UW5 A;  5FK7 A;  5FZ8 A;  3W5M A;  2ZAA A;  1TME 2;  1VBA 1;  1MD8 A;  2LUW A;  1CN1 A;  1PGW 1;  3KXV A;  2NM1 A;  3N9O A;  5A33 B;  1GBG A;  1QNY A;  4O61 A;  4UBG A;  3KF3 A;  1MEC 2;  4Y1U A;  4K40 A;  4NII A;  3RZL A;  3R05 A;  4HT1 T;  4D6S A;  1DIW A;  2D43 A;  4DJZ A;  2XVL A;  2UWA A;  4PI2 A;  4F8A A;  5FYI A;  4LBQ D;  5J36 A;  1AZD A;  4XBN A;  5DG2 A;  3U1X A;  3U14 A;  2RMU 1;  5I93 A;  2BEO A;  1NY7 2;  1OA4 A;  1I5P A;  2ETE A;  3KSC A;  4MSV A;  5FPB A;  1V6N A;  4NRP A;  1PNF A;  3C7E A;  5BUV A;  3PU3 A;  1NKG A;  3INB C;  1RJ8 A;  3K4D A;  3T2O A;  3VBH C;  2Q4S A;  4MAD A;  2BNM A;  4JHZ A;  1AYN 3;  1XPW A;  2E6V A;  3IPV B;  5L73 A;  3D5O A;  1QH7 A;  2R07 2;  3Q8B A;  5FY0 A;  5C9A B;  3ZIX A;  1FX5 A;  3HT2 A;  5E16 A;  1LJ7 A;  2XJQ A;  4IXL A;  2UUR A;  1CAV A;  2ZEZ A;  3E6B A;  5GLV A;  1G9D A;  3FGT A;  1RHI 2;  2BWC A;  4YW7 A;  3WF1 A;  3N9P A;  5DUV A;  2I74 A;  2BPA 2;  1Z7S 1;  4BQ1 A;  2CAU A;  1MS9 A;  5FO7 B;  2XWJ I;  4MGK E;  2LRO A;  1GZ9 A;  1ASJ 3;  3N9N A;  3E97 A;  2ZX4 A;  1W2T A;  2ZAB A;  3HPN A;  4IDZ A;  3AMN A;  5FZ9 A;  5I0T A;  4CPB A;  4COY A;  5AC9 3;  4Y1Z A;  1D0G A;  1A8M A;  4B29 A;  1QJU 1;  4PQ9 A;  1WCD J;  4AFC A;  4B2R A;  3NV3 A;  2ZGQ A;  3DPR B;  5GZF A;  1VVD A;  1ZZ7 A;  2C9A A;  5HXM A;  4JGY B;  1VBE 3;  5CB7 A;  2XKP A;  2BP6 A;  1YCI A;  3P3N A;  5AFE A;  1ULO A;  5IVB A;  2QQU A;  1RUD 1;  5LAS A;  1C8M 1;  1LGC A;  1QQP 1;  1TMF 3;  1UO9 A;  4FI9 A;  4P9Y A;  2VO5 A;  3OGG A;  5LBE A;  4XC9 A;  4OQ8 A;  3NAP C;  4R9C A;  1MZF A;  3TAY A;  1UY4 A;  2ZGL A;  3CBN A;  3FLR A;  1EAH 2;  2H6B A;  2ZHK A;  1N47 A;  4M3C F;  1KXG A;  4CP9 A;  2BZM A;  4QM9 A;  1YWK A;  2W3J A;  3IDA A;  4XMA A;  1AR8 2;  5C6C A;  5FO8 B;  2Q1F A;  1PO2 2;  2D3S A;  5JXI A;  2D6O X;  4IGD A;  3H1Y A;  1N3Q A;  2JE8 A;  4IW3 A;  2CYF A;  5CIR A;  5CFD A;  1UZZ A;  3VB9 A;  2IXL A;  4QU2 A;  1Z0H A;  1GUI A;  4BOW A;  2WFF 3;  3OEA A;  1HKD A;  1CAU B;  2I07 B;  2V5D A;  2BQP A;  1QXP A;  3O0X A;  4U36 A;  5JPN B;  2PYT A;  5FLI A;  3BI3 A;  1VB2 A;  3VBR B;  5DAX A;  2FQP A;  4A42 A;  4NID A;  2VMD A;  4YW5 A;  3WG2 A;  1OF3 A;  2AH2 A;  1GZC A;  4FQ4 A;  4CEW B;  4B3N A;  4LO7 A;  3RYR A;  5JPM B;  2LTN A;  2VZO A;  3ZR5 A;  1C1Z A;  1L7R A;  3VUO A;  5FTT C;  4Y3O A;  3RS6 A;  5HXV A;  3WLU A;  3DXU A;  4OZO A;  1NZI A;  4XHX A;  1OFN A;  3SXW A;  2RJK A;  4DXS A;  5F2W A;  4XQD A;  1QJX 1;  1WGP A;  3VN4 A;  2DF7 A;  3VV1 A;  3HIF A;  5CZK A;  2CAV A;  2ZEX A;  5LA0 A;  1FOD 2;  4KG0 A;  5F1R A;  4MH0 E;  3VZJ A;  4QX8 A;  3BCW A;  1R08 3;  2ZYC A;  4CTE A;  1V0A A;  1Q8P A;  1V6K A;  2JDZ A;  3POY A;  1GLH A;  3AFG A;  1EP0 A;  3ZSK A;  2VMG A;  1FBR A;  1G86 A;  3AKT A;  1TZO A;  4XE9 A;  1PX3 A;  1W8T A;  1S0E A;  4EV0 A;  5JIA A;  5GZG A;  4CCK A;  3LOB A;  2HEY F;  4AQT A;  2EC3 A;  1BKZ A;  4FFF A;  2FZ1 A;  1NT0 A;  4LHN A;  3SKJ E;  1JW6 A;  3WX5 A;  2VTX A;  1RUE 3;  1FPN 1;  1KDK A;  4XFG A;  1OQ1 A;  3PJQ A;  3R4D B;  1N1V A;  1MS0 A;  2EIE A;  5CEH A;  3ZLD A;  1RMU 2;  5HYP A;  1I5Z A;  4HXC A;  4Q4X 3;  1ZZC A;  4X6R B;  2WNV B;  5L19 A;  3AC0 A;  3ZXG A;  5A3L A;  2KR2 A;  3C8X A;  2Y60 A;  1XC6 A;  4N7U A;  5DG1 A;  5FY4 A;  3RZM A;  1RIR A;  5F6K A;  1J3R A;  4LOR A;  5FZ7 A;  4QPI A;  5F5I A;  4Q8L A;  5FYH A;  2NLR A;  4JC1 A;  3JD7 2;  4AHW A;  4HZF A;  2MCZ A;  1H2M A;  2E53 A;  4JCK A;  2YBY A;  4UF0 A;  1A34 A;  1TNR A;  2Y6J A;  4CDU B;  3E6C C;  1C1L A;  1CZV A;  3JBG 2;  4M4R A;  4XQ4 A;  1NA1 A;  2A6Y A;  4NJ4 A;  1SAC A;  3BAL A;  1D4M 3;  1DZQ A;  3LDK A;  2JEN A;  3EMR A;  4RN5 A;  1ZVF A;  4WM7 B;  4CCL A;  4KU8 A;  2VNO A;  4NE9 A;  4N90 A;  5IW0 A;  5D8A A;  4P14 A;  3T4H B;  4AED B;  3I2G A;  3RSJ A;  4MG2 A;  1DGR A;  2K9Z A;  4AGG A;  1GFF 2;  3PL0 A;  3WNO A;  4A7Y A;  4CP2 A;  5HI0 A;  3FBM A;  1AJO A;  1NLS A;  1V9U 3;  2JG9 A;  1OC1 A;  3MHZ A;  4TYS A;  5EV7 A;  3ZFF A;  4XJ9 A;  3TBD A;  2DTW A;  1PGL 1;  5A3O A;  5CG9 A;  4KBZ A;  4CCE A;  2GNM A;  5I8Y A;  5KBF A;  1BMV 1;  1LES A;  2UYA A;  1Y9Q A;  4YZ5 A;  1BJQ A;  1PIV 1;  3LPF A;  3NV4 A;  4K1Z A;  1W3X A;  1QH6 A;  5EJ3 A;  2JG8 B;  1H2L A;  3TEX A;  1FAT A;  5LY1 A;  3D8C A;  3HAG A;  4LLO A;  1STM A;  2EAA A;  2OS2 A;  2DBN A;  1VRH 2;  3MV1 1;  2R07 3;  4M3C E;  2WNE A;  2YGM A;  2RLQ A;  1ZBA 1;  2OA2 A;  2ZKL A;  3AP9 A;  3HJR A;  4IEP A;  4CSW A;  2YBS A;  2OW4 A;  1ALY A;  4K21 A;  1RUC 1;  3MDP A;  2BGO A;  3AM2 A;  4EZH A;  2RM2 2;  3HBZ A;  2XJT A;  1UAI A;  2ZGR A;  4IER A;  2PHL A;  1NYW A;  4YPJ A;  1GNH A;  4GWJ A;  4BQW A;  3AP7 A;  4MGQ A;  3OB8 A;  1QOT A;  4LQR A;  5FPX A;  2A3W A;  1W6M A;  2JD9 A;  4MXW B;  4YM2 A;  4MYE A;  1QWR A;  3MGU A;  2R0F A;  2ZX0 A;  3T5O A;  1AR6 1;  1FV3 A;  4DZG A;  3IU3 I;  2J22 A;  1OOP B;  2CHH A;  3KV9 A;  1BCX A;  2Y64 A;  2SBA A;  3I3M A;  2WRA A;  4BIO A;  5GZE A;  2BUK A;  4GH4 A;  1YQ5 A;  2ARB A;  2JIG A;  2RS5 2;  4BIS A;  4ZKT B;  5C8C B;  3IT8 A;  4RS5 A;  5FYV A;  2EXI A;  1AJK A;  2UY9 A;  3SIT A;  4Y5Z 0;  1B09 A;  1J3Q A;  1S0J A;  1UMH A;  1A78 A;  1IPS A;  2IWG B;  5JVV A;  1C5H A;  2BW8 A;  2VMC A;  3WEZ A;  1OHF A;  3IDB B;  3JCI A;  4MOA A;  4XUQ A;  5FQ0 B;  1WKY A;  3RI8 A;  2Y6G A;  1HRI 2;  4AQ2 A;  2XRB A;  4XOG A;  2VPV A;  1IQD C;  4OMC A;  4Q0S A;  1Q43 A;  4FAG A;  4ZS2 A;  3OP8 A;  3S30 A;  4DY5 A;  4OFG A;  4EN0 A;  2DBI A;  5CFD C;  3IDC B;  3WNL A;  5JMC A;  1W05 A;  4XDQ A;  5F39 A;  1EAH 3;  2CKU A;  1D4V B;  1HRV 1;  3BTZ A;  1ZRF A;  3O1R A;  1H1M A;  3DV8 A;  4ZU7 A;  4LBL A;  1JH5 A;  3CJI B;  4FBF A;  5KXC A;  2GC1 A;  3GDB A;  4ZXE A;  2MPF A;  2XJR A;  1AR7 1;  3ZFE B;  3PIJ A;  3O8E B;  1UIK A;  3WG4 A;  1R09 2;  4IEW A;  5K0U B;  2QQI A;  2WT0 A;  2XWB F;  1CAW B;  3KVB A;  4QAW A;  3VZM A;  1UL9 A;  1DP0 A;  1RUH 1;  2D3P A;  4DO0 A;  2FCV A;  2JB4 A;  5DDJ 1;  4FTE A;  1QJE A;  1U5I A;  3M1H A;  5BNN B;  2QQM A;  4TTG A;  4A7Z A;  4GQ7 A;  3S7E A;  5KXB A;  4ZU4 A;  1ZJK A;  2A70 A;  3VBF B;  4XQW A;  1UX6 A;  1WWY A;  4RYD A;  2P6H A;  4DUV A;  3T2P A;  5L9V A;  4YM1 A;  3VDD B;  1YJL A;  4YGD A;  1EYB A;  1ZRE A;  2W92 A;  4QX7 A;  1MPX A;  4DQA A;  2XON A;  2XVK A;  3I2D A;  3LGR A;  4V2W A;  1COV 1;  4Q0V A;  1KJR A;  3EO6 A;  5T5O A;  1MS4 A;  1T6G C;  3WHT A;  3DKW A;  3C7F A;  1FOD 3;  2RS1 3;  4AAP A;  4BLI A;  3ZDV A;  3U10 A;  5DAV A;  3NNG A;  1GV9 A;  1W9W A;  3K4Z A;  3MIF A;  3KS7 A;  4Q4V 1;  4QX0 A;  1OK2 A;  4HFS A;  4QPG B;  1G9A A;  4OUL A;  1H4G A;  4N7E A;  3SMH A;  4K3U A;  2DUR A;  2DUQ A;  4YVW A;  3CAL A;  2ZA9 A;  1K45 A;  4YNX A;  5A6Z A;  2JIJ A;  3NNJ A;  1VAL A;  4L0P A;  4O65 A;  2VVF A;  1PM4 A;  2JB8 A;  1RLH A;  5L7O B;  2I2L A;  4LOS A;  4HON A;  3ZKY A;  1AVB A;  2FMD A;  2QNK A;  3Q8A A;  1HXS 2;  3I59 A;  1PVX A;  5K8S A;  1AYM 2;  3WF0 A;  3VKN A;  4LA3 A;  3LEK A;  4QMA A;  3H42 B;  4QPI C;  1KS4 A;  4ARY A;  5IFT A;  2DYC A;  1VPH A;  1WUV A;  2P6C A;  2ZGK A;  3RWN A;  4CU8 A;  1F35 A;  3LQC A;  1BEV 1;  2BV4 A;  1W6Q A;  3U11 A;  4LNV A;  1NA1 C;  1DDL A;  2XGX A;  5BNO B;  3RZH A;  1IOA A;  1AR8 1;  2EID A;  4BYY A;  2JGX A;  1RUI 2;  5A3U A;  2ZX2 A;  2X2Z A;  1PO2 1;  5D8A C;  1RUG 2;  4Y1X A;  4E8D A;  2RLP A;  3IX0 A;  2V4V A;  2BFU L;  3JD7 3;  4MVT A;  2CGN A;  1DQ0 A;  4IV1 A;  5EFU A;  1SLC A;  3O1V A;  2JG9 C;  4QQL A;  3ZFF C;  4HK9 A;  1FV2 A;  3HWJ A;  4AHY A;  1PO1 1;  5K9Y A;  2Q0A A;  1VB4 A;  3H8R A;  2C1F A;  4HMZ A;  1H2K A;  3LEI A;  4AF9 A;  4WZC A;  5A33 A;  4J1W A;  2KM2 A;  1DGL A;  2Y6F A;  3ZPO A;  4AG4 A;  3MIB A;  1YUD A;  3KGZ A;  3VBO B;  3ZVX A;  1NZC A;  4EE2 A;  1X82 A;  2R30 A;  2ZX3 A;  2ZZJ A;  3H8O A;  2E26 A;  4YAR A;  1JUI A;  3IN9 A;  2YYO A;  2HWE 3;  4I30 A;  3Q8E A;  1GWL A;  2R32 A;  3IDE A;  4LBQ A;  4Q4Y 3;  2WZP P;  4Z1V A;  1MS1 A;  1VBA 2;  2R04 3;  4K9S A;  4LK6 A;  1KGY A;  2E63 A;  3D6E A;  1PGW 2;  4R9B A;  1CPN A;  2BJS A;  4H3W A;  3BOW A;  5A80 A;  3RFR A;  3UGF A;  3TEZ A;  2MEV 2;  3O1S A;  2EA7 A;  1LEM A;  2QQO A;  4XJW A;  1LKN A;  1F31 A;  3UKN A;  4PDW A;  5CKQ A;  1DBN A;  3KCX A;  4OI1 A;  1H03 P;  1NQJ A;  2JE9 A;  4AI8 A;  5FZC A;  4EJR A;  2BDR A;  2RMU 2;  2WUH A;  5FBZ A;  3BGA A;  1F4A A;  3PUH A;  4NPL A;  5C5T A;  1RUF 1;  2FDI A;  3T2T A;  5DXD A;  3AB0 A;  4ZZ8 A;  2H0V A;  3HQX A;  2ZML A;  4QKF A;  4RHV 3;  1C1F A;  3LA2 A;  3PIG A;  5DN5 A;  4ZS3 A;  4AAX A;  4RS5 C;  2HBU A;  5LRR A;  2JKX A;  1ZZB A;  5T54 A;  4DXZ A;  1T6B X;  1Q8V A;  3NST A;  5KXE A;  1PZ9 A;  1S0D A;  4GA9 A;  4GJZ A;  3ZYI B;  3WW2 A;  2QDR A;  2VME A;  1JOJ A;  3DPR A;  3OBZ A;  4PJY A;  5DAW A;  2DCT A;  4OHZ A;  4XBL A;  4XF0 A;  4B1M A;  4K8F A;  4OMD A;  4JDM A;  4FAH A;  5E8A A;  4HKL A;  5A7P A;  1PMJ X;  4JGY A;  2OX0 A;  2WZ8 A;  4LIT A;  4D3W A;  5T5L A;  1LB2 A;  4GXL A;  3HEI A;  2D3R A;  3NKG A;  1CGP A;  4LT5 A;  2GC2 A;  1XBF A;  2D5H A;  3ZM8 A;  1VP6 A;  4CXW A;  3PUA A;  3ACL A;  5FZM A;  4CUA A;  4AFA A;  4SBV A;  5FBJ A;  1XOY A;  3FZ3 A;  4QX3 A;  2DFB A;  2VTX J;  4XF1 A;  3UET A;  4Q0P A;  1QJU 2;  2ZOE B;  1OMI A;  3DL3 A;  3FWE A;  5IK5 A;  4K7J A;  5FZ4 A;  5JWP A;  4YGC A;  1JYW A;  3IWZ A;  3KZ4 C;  5H9P A;  1TPG A;  3ZN5 A;  5BNP B;  3U0Z A;  3ROU A;  3ZMN A;  1XYP A;  1O8P A;  4LO8 A;  4AEJ A;  3M3C A;  3WP3 A;  1WW6 A;  1WA4 A;  2PFW A;  3WDX A;  2HYX A;  1FYU A;  2BOI A;  4FCA A;  2IVI B;  2KMS A;  2WT2 A;  2X09 A;  4IL7 A;  4NAO A;  1QQP 2;  1W9T A;  4KU7 A;  1GOH A;  3ATG A;  4DEQ A;  4OI4 A;  4I09 A;  5IFP A;  5FY1 A;  4LHS A;  2BWA A;  3KT4 A;  1W28 A;  4J1X A;  3DYO A;  3HT1 A;  1ENX A;  2Z4F A;  4CDW C;  3ZX7 A;  2C9K A;  5DN2 A;  4XZU G;  5FZ3 A;  2ZGT A;  5JZG A;  1Y4W A;  4CEW A;  2ATF A;  4LUK A;  3T0D A;  3VBU A;  2WZE A;  4NHM A;  4AVC A;  4LKE A;  4MGS A;  4RSU A;  1IG0 A;  1W8W A;  4KKD A;  5APA A;  2B4K A;  4I02 A;  4FPY A;  4COZ A;  3GHN A;  3BKZ A;  4XAC A;  3UT0 A;  3OY8 A;  4YG3 A;  1HB3 A;  4YVW C;  2A6X A;  3DKQ A;  1QJY 1;  3J8F 3;  3FMG A;  3NJY A;  5FMO L;  4ARX A;  2Y33 A;  1MS8 A;  3ZXJ A;  3PUS A;  4Q4W 3;  3UV9 A;  1O3S A;  3UGH A;  4LE3 A;  5CKM A;  1OFS A;  5A7N A;  4TLF A;  4FPG A;  2QY0 A;  2HWF 1;  3OGR A;  3FX3 A;  1Z92 B;  4IEX A;  2G19 A;  5FDB A;  4RGG A;  1QJX 2;  1UWW A;  4C1X A;  3TEW A;  3SLI A;  2QUO A;  2VQU A;  1DCS A;  5EYY A;  1WLT A;  4HVQ A;  4Q29 A;  2Y8R A;  3S5Q A;  3GCX A;  3LKJ A;  4NN0 A;  4BM8 A;  4IET A;  1RB8 G;  3MF6 A;  1V00 A;  4RQP A;  4AGV A;  2BNO A;  3PNA A;  5CAD A;  1X8M A;  1SHW B;  1SPP A;  4IV1 C;  3THC A;  4IGP A;  3EHK A;  1H2N A;  2RJL A;  4AYI A;  4TN7 A;  5LA2 A;  1KD7 A;  3FGR A;  3ZSL A;  5C3O A;  2R6Q A;  2B46 X;  1URX A;  1VBD 1;  5F3C A;  2Z42 A;  3ACH A;  4D69 A;  1UY0 A;  1FPN 2;  2D6M A;  3POI A;  5A3P A;  4CXY A;  1YFU A;  4I0W B;  2VZP A;  2W2I A;  4N43 B;  2ILM A;  2B42 B;  2YUE A;  2VZ3 A;  1V6M A;  1GNZ A;  2V09 A;  3MEP A;  4XEZ A;  1G4G A;  1G6N A;  2WC2 A;  1MS3 A;  1UOG A;  4FPO B;  4YYO A;  5C4W B;  5JI9 A;  2XPJ A;  2IVJ A;  4GKY A;  1GQH A;  1LNS A;  2PHD A;  1UF2 C;  2GAL A;  3KHB A;  4B7E A;  4D7S A;  3CL1 A;  4W50 A;  3SH4 A;  3SCF A;  1J84 A;  5FY7 A;  1LY2 A;  1DHK B;  1UIJ A;  2HJI A;  2P3J A;  2P34 A;  3JB4 C;  5H9S A;  3R0R A;  1X8E A;  2CU5 A;  5FXW A;  4KL1 A;  1JZ8 A;  1CWP A;  1DZR A;  2UWC A;  5G04 L;  5C3Q A;  4DFS A;  5IVE A;  4UFI A;  4GB3 2;  4PDW C;  4CSY A;  1GSL A;  3ALQ A;  4Y26 A;  5ANN A;  5FKC A;  3VGI A;  4YVS B;  4I0B A;  3ILF A;  1R1A 2;  2E32 A;  1PM7 A;  3GXU A;  5EZW A;  3WIN E;  3WQ1 A;  5HCA A;  4UFH A;  3UKT A;  5C71 A;  4XF3 A;  1CKL A;  2QZ2 A;  1GWK A;  2RS3 1;  1LHW A;  4OHX A;  1PGL 2;  3CDZ B;  3RMX A;  3FHI B;  3V0A B;  5FZK A;  2PMW B;  1HW5 A;  2RG4 A;  2QQV A;  4ZON A;  4CP1 A;  1QXJ A;  1LHV A;  1PIV 2;  4QX1 A;  4BQ5 A;  4AXO A;  5E6H A;  3V65 A;  1PK6 A;  1GAN A;  1R1Z A;  1I3H A;  3CZU A;  3D4K A;  1E5S A;  2WS9 3;  1LRH A;  2YPJ A;  3K77 A;  4M3C A;  4NPM A;  4Q8K A;  3WF2 A;  4WVW A;  4CDX B;  2JGW A;  1ZBA 2;  2DCJ A;  3ZYG A;  4CEY B;  1VBB 1;  1W9S A;  1GZW B;  1RUC 2;  2VNG A;  2FBE A;  2QQN A;  2PLV 2;  3NJZ A;  3THP A;  5KHK A;  4F4O C;  3WQ7 A;  1UY2 A;  1SLI A;  1W2O A;  2JJ6 A;  1GQG A;  1UOT P;  1Z7S 3;  2IXH A;  4K20 A;  4Y1Y A;  4MX3 A;  1AR9 3;  1JZ3 A;  2WNU A;  4A41 A;  1SLA A;  4XJA A;  3D0J A;  1B35 A;  5FYT A;  2YU1 A;  1AR6 2;  4EN8 B;  1WA6 X;  2VOX A;  4OLL A;  2YB7 A;  5EJZ B;  4A3Z A;  1H8T B;  4KGQ A;  3WP5 A;  1LEN A;  2YHJ A;  4Q5O A;  2ZHM A;  5A7W B;  2VUL A;  4HPK B;  3PUQ A;  1N1S A;  4M0H A;  2ADE A;  1Y9M A;  4FFG A;  1QO6 A;  3ZFG C;  1AL0 G;  5FYM A;  4C90 A;  4DXR A;  4LIV A;  4WM8 B;  4Y24 A;  1JZ6 A;  1JYN A;  1U5M A;  4OHW A;  5KHI A;  4ZHN A;  1ZRD A;  2XBO 1;  2E31 A;  5FFO C;  3AL5 A;  1JXN A;  1GQP A;  2X5I B;  3GNE A;  3DEC A;  3ZKU A;  4NRO A;  2JDP A;  3S7I A;  1KS5 A;  3HQR A;  3PU8 A;  1RUD 3;  5JZG C;  1C8M 3;  1DQ1 A;  1W6P B;  3GCW A;  3ACI A;  5A6Q A;  3WXP A;  1OSG A;  2VOK A;  4KNC A;  4B8E A;  3VBU C;  3AKQ A;  4NR1 A;  1ZRC A;  2OUH A;  3CO2 A;  2NN8 A;  3CIH A;  5F9T A;  3TRS B;  4LO4 B;  4A3X A;  2MEV 1;  4Y4Y A;  3ZN6 B;  2WAO A;  3ZN4 A;  4AI2 A;  1HRV 2;  1X50 A;  3OYW B;  4YW3 A;  2FDF A;  3ERB A;  4E9K A;  1HQW A;  4CCN A;  1LTE A;  3TN9 2;  5IVC A;  1OK1 A;  2J42 A;  3NW4 A;  2D97 A;  1J58 A;  2ZGS A;  1AR7 2;  2VMH A;  2IC1 A;  2W52 A;  3ES4 A;  4Y5T A;  3SC7 X;  3WW3 A;  1UZ0 A;  1T2X A;  1LUL A;  3HVD A;  3B9I A;  1MS5 A;  2O39 C;  5HBA A;  3ILR A;  5DMY A;  1RUH 2;  3V0B B;  1UKR A;  2ZEY A;  4HG6 B;  5DDJ 2;  4W8J A;  3NV2 A;  4M4P A;  1N1Y A;  2P4E A;  1XU1 A;  1PHM A;  1F4H A;  2EXJ A;  3LAG A;  2XL9 A;  4QKN A;  2A55 A;  1DYO A;  2GMP A;  3MW4 A;  3POF A;  3WZ1 A;  4DPN A;  1JZ4 A;  1V6L A;  3OOX A;  4IND A;  4YZ1 A;  2CG6 A;  2SLI A;  4LO6 B;  3WSO A;  3ETP A;  5A70 A;  2HWC 1;  1W04 A;  3KQR A;  4RQP C;  1IS3 A;  1COV 2;  3ILN A;  3AK0 A;  4IV3 B;  5CFC A;  2E7T A;  1BBT 1;  4KQ7 A;  1ZBE 3;  3ZSM A;  1NCQ B;  1YC6 1;  2P3I A;  5TSW A;  4ASK A;  4C1W A;  4ASL A;  3AMM A;  4A44 A;  3ZYJ B;  4YGE A;  1SFY A;  4Q4V 2;  5FAX A;  2OQ7 A;  2VNV A;  4BH9 A;  1LOC A;  2EIC A;  2VZR A;  3M3I A;  4NWW A;  2B45 X;  4QWN A;  5FRA A;  1EPZ A;  5LBF A;  2QTW B;  5L9R A;  1PZ7 A;  5KHH A;  1FNZ A;  1OQD A;  4XTP A;  1Q8Q A;  1RUJ 2;  3AMP A;  4XET A;  1JOD A;  3BB6 A;  3ACG A;  3GZE A;  5FWJ A;  2BBA A;  1S4C A;  2FDJ A;  2ID4 A;  1OK9 A;  2HWB 3;  2Y6K A;  3NWK A;  3LDB A;  3R6S A;  1OXC A;  1QOO A;  1LGN A;  2ORZ A;  2IUW A;  3MO4 A;  2GNT A;  4NIH A;  3HD8 B;  1C5I A;  3CF6 E;  4LUL A;  2TNF A;  2VQT A;  1UPI A;  3IAP A;  4R8H A;  2XVG A;  4E8C A;  1OUX A;  5FV3 A;  3PUR A;  5JXH A;  4ORF A;  2XJS A;  3MIG A;  2PTM A;  3MFC A;  4AR2 A;  5HPO A;  1MQT B;  1M4W A;  4YWA A;  1OH3 A;  4LJH A;  1BHG A;  1S1A A;  1BEV 2;  2QBX A;  2W1W A;  3AP6 A;  3PVE A;  1HV0 A;  2HWD 1;  2JRA A;  1TPM A;  4XAB A;  4ITC A;  4LBN A;  2WIN B;  3LFI A;  3B94 A;  2V8E A;  5CA6 A;  2ARA A;  4L9B A;  4OUM A;  4ZPI A;  5FOB B;  5FZ1 A;  2VZT A;  2X10 A;  3AKP A;  4A7K A;  5JCT A;  2ZBJ A;  2R1D A;  2YC2 A;  4CDQ A;  5LA1 A;  3O1P A;  2IXC A;  1NWV A;  1PO1 2;  2HBT A;  2L9L A;  4FO9 A;  4XIO A;  1AX0 A;  1WD3 A;  2BOJ A;  2GDF A;  3KT7 A;  4HET A;  4XXP A;  4ZU5 A;  2R0H A;  2F6B A;  1ULG A;  2OUJ A;  3NO8 A;  1ZRI A;  5FXV A;  2O8Q A;  2W95 A;  2VCB A;  3TNP B;  3USU B;  1GWM A;  4XFC A;  2BFU S;  1VBC 3;  1CIW A;  2D40 A;  4LHK A;  1RXF A;  3AVR A;  4FVV A;  1PK6 C;  2LOJ A;  3HBK A;  1XND A;  5FYS A;  3WNP A;  4AVB A;  2AUY A;  4PI0 A;  1UNB A;  1VAM A;  2VW0 A;  4L97 A;  2B5H A;  3ZRZ A;  1XNB A;  1AXY A;  2FDH A;  4PBP A;  5F5A A;  1GIC A;  4E4Z A;  1FXZ A;  3IIA A;  4W6W A;  4UAP A;  4XTM A;  3I3E A;  4GD4 A;  2VC9 A;  2R06 3;  1E5I A;  1YIP A;  5C3S A;  2C5D A;  1BLZ A;  2XB6 C;  4JGZ A;  2WNU C;  5EHD A;  1MR5 A;  4LOT A;  1ZBA 3;  4NHL A;  1B35 C;  2WR9 A;  2ZPX A;  1J1L A;  2E33 A;  3OCP A;  1RUF 2;  3B93 A;  4XVH A;  1TVG A;  4Y20 A;  3I3B A;  4XJU A;  3RI9 A;  2VQ0 A;  3U75 A;  3ZXE A;  1XYO A;  1VMJ A;  5JSP A;  1ND3 A;  4BHP A;  1V6J A;  2CV6 A;  3B7M A;  3ACF A;  3EBR A;  4JRL A;  4L11 A;  4RR3 A;  1WCS A;  1O3Q A;  4PIZ A;  4Y22 A;  1ULP A;  4N53 C;  3LE0 A;  2UYB A;  3FL7 A;  3WNX A;  3U4S A;  3K3O A;  5IK8 A;  1MVQ A;  5A32 B;  2HH9 A;  2VBP A;  4AVA A;  2JIC A;  2P5B A;  3U07 A;  1HV1 A;  1KFX L;  3O1O A;  2NPI A;  1W39 A;  4YSF A;  1RUN A;  3FE5 A;  2Q8D A;  4ES8 A;  5BNP A;  1EV1 1;  2KA3 A;  4L92 A;  2Q8O A;  4JKL A;  1ACC A;  5GZD A;  2VE1 A;  3VBH B;  5LY2 A;  4DUW A;  5JOY A;  1K5M A;  3GHM A;  3OGS A;  4IQP A;  4KWK A;  1OQE A;  4QHB A;  5I0S A;  1CAX B;  3TYJ A;  1VBE 1;  2K2S A;  3DEM A;  5AVA A;  1AL2 3;  3ME2 A;  2D93 A;  2RDN A;  3ENR A;  5F8P A;  5A7O A;  4IUG A;  4JHS A;  4AE2 A;  4MSL A;  4E2S A;  4OYU A;  1HLC A;  3P6B A;  3GBF A;  2DCK A;  3O0V A;  2KD7 A;  3AVS A;  4GB3 1;  4YFZ A;  2Y38 A;  3K51 A;  1R1A 1;  1JYI A;  4LBK A;  3SW0 X;  3I97 A;  1TME 3;  1XSQ A;  4GMP 1;  4PQQ A;  4QQO A;  4QT6 A;  1P8J A;  4WVV A;  3X29 B;  2VBB A;  1WMX A;  3HNM A;  1OUR A;  3I54 A;  2PHW A;  1MEC 3;  4E4H A;  2ARX A;  1MZE A;  1NCR A;  2Y26 A;  1M06 G;  4A6O A;  1A6C A;  1DQ4 A;  3BOD A;  4BK4 A;  4C91 A;  4GIQ A;  1UYY A;  4XDP A;  1AR7 3;  4XIK A;  2ARE A;  3FUQ A;  4W6X A;  1UOF A;  4FPK A;  2WFF 1;  5GLU A;  3CI0 J;  3VBS A;  2A1X A;  4XFB A;  5I0D A;  2JDA A;  1RUH 3;  3AJY A;  4LXL A;  4Q0Q A;  4XDO A;  2A6Z A;  5ERL A;  4CRQ A;  2XOM A;  3O1M A;  3V64 A;  4QU1 A;  3EJH A;  3T2Q A;  1JHJ A;  3B9C A;  5FYC A;  2KRI A;  1G8W A;  4HSJ A;  1OF4 A;  4QDS A;  2I45 A;  4RFR B;  4QX5 A;  5CFC C;  5JIU A;  4NUB A;  4S2D A;  5IHR A;  3NAP B;  2PLV 1;  4UBH A;  1RJ7 A;  1HCC A;  1RHI 3;  5F3G A;  3THD A;  4E4S A;  3MW2 A;  4IE0 A;  4V1P A;  1RVF 1;  2CY6 A;  2NMO A;  2XLA A;  3AZX A;  3ES1 A;  1G9B A;  4QKD A;  1ZYB A;  5BV6 A;  1RL3 A;  1ULC A;  1QJY 2;  2PHT A;  2CDP A;  4MLO A;  4WVM A;  2A75 A;  2J1T A;  2CDO A;  3LIH A;  4XCA A;  3IMN A;  4BK5 A;  3C2U A;  2OPK A;  4LUM A;  5GLT A;  2DU1 A;  2AYH A;  2Z79 A;  4BE3 A;  5EIY B;  1W0N A;  1W2U A;  4CCM A;  2LM3 A;  3QH7 A;  2JEC A;  2DVB A;  1W8F A;  2HWF 2;  1X9T A;  5A3M A;  1CPM A;  4D7T A;  1JZ7 A;  3POE A;  1LOB A;  5FMO S;  3N7J A;  1UD1 A;  2IZ4 A;  2IZW A;  4DS0 A;  4NHY A;  2J1E A;  1RUE 1;  4ZZ5 A;  3WQB A;  4O9G A;  4B1L A;  2J1S A;  3JUU A;  3VWO A;  3M3Q A;  5LAT A;  1L7Q A;  1SFN A;  3AZZ A;  5EWS A;  4WJG 2;  2DVA A;  5J7M A;  3DGT A;  4Q4X 1;  1SG3 A;  2D44 A;  3A0N A;  5C70 A;  3BU0 A;  3FHA A;  2FDG A;  3V56 A;  3CU7 A;  1UQX A;  5JAX A;  5FPL A;  5LWB A;  1QU0 A;  1O4Y A;  4CDQ C;  4ERO A;  1RXG A;  4R4X A;  5ACA 2;  3JZV A;  5D21 A;  1VBD 2;  2Y34 A;  3WNK A;  3GJB A;  2EAK A;  1AR8 3;  2UY8 A;  4Z2W A;  3K75 B;  3TN9 1;  1EUT A;  1PO2 3;  1QIQ A;  2GN7 A;  1NXM A;  1FMD 2;  4DIN B;  2YY1 A;  4M00 A;  1ULF A;  2W1Q A;  3WY6 A;  2B7Y A;  2W68 A;  5HCB A;  1D4M 1;  2RJ2 A;  3AFK A;  1IS5 A;  4O7X A;  4XAE A;  3PHM A;  4YM0 A;  5C3P A;  4E27 A;  3ITQ A;  3SH3 A;  2YDE A;  2XR4 A;  5FYZ A;  2ENR A;  2VAU A;  3ZYP A;  4AEM A;  4ONT D;  2IFW A;  3A22 A;  4Q26 A;  1V9U 1;  2DVG A;  1UKG A;  1J1T A;  3MLK A;  4N9H A;  4BZ4 A;  4M01 A;  5FZO A;  4QGM A;  1ND2 A;  2XQW C;  3MW3 A;  2GZW A;  3GZT B;  1H1A A;  2A6W A;  1QGB A;  3TEY A;  2NZ9 A;  4JGZ C;  2PA7 A;  4FPH A;  5FPU A;  5FZL A;  1CES A;  4XBQ A;  2WNO A;  2Q1M A;  4QKB A;  2W91 A;  4IEQ A;  5I0U A;  2O14 A;  5I0Q B;  3OJB A;  2OQ6 A;  4PF1 A;  2R49 A;  3B69 A;  5FUN A;  2JD4 A;  5FUP A;  1ND3 C;  2RS3 2;  4RR3 C;  1XQN A;  3WW4 A;  5M0T A;  1K12 A;  4AYU A;  4EN9 B;  4BME A;  3ZXA C;  1UY1 A;  3CEW A;  4GZ9 A;  4RL7 A;  1TE1 B;  3NRU A;  2O8O A;  1RUJ 1;  4UW6 A;  1D7P M;  2VU9 A;  4LHL A;  4COU A;  1S2E A;  4HVR A;  4MHR A;  3RZK A;  5H9R A;  4F3J A;  1AX2 A;  2W80 A;  5FP4 A;  2Z5W A;  1LOE A;  3O12 A;  4BQ4 A;  5JPM G;  1HN1 A;  2YGL A;  2AEZ A;  3K4A A;  4Y33 A;  3UJQ A;  4P9L A;  1K5M C;  4CUG A;  4HBN A;  3KCC A;  3GZU C;  3T09 A;  2PHU A;  1RMU 3;  3G6J B;  4GMP 0;  1APN A;  1UYP A;  3LEM A;  4TWT A;  1VBB 2;  3OED C;  2RDQ A;  3VZK A;  3H8X A;  4JVA A;  1CAV B;  3M3E A;  4PT6 A;  4FXG B;  5DPN A;  5FCC A;  3VKL A;  1BK0 A;  1NLR A;  1S0G A;  2IZ3 A;  1XSR A;  3T1L A;  5KC5 A;  4UFK A;  3K3N A;  2W5F A;  3IZO A;  2BTV C;  2EHF A;  3AZY A;  2R1B A;  4EYU A;  3A4U A;  4UYB A;  1OI6 A;  5E88 A;  3PVN A;  3KHC A;  1X36 A;  4OI2 A;  3VL9 A;  4LA2 A;  1U5Z A;  4CU9 A;  1JYT A;  1XYN A;  3KVA A;  5CAZ A;  5IVF A;  2XDV A;  4XIL A;  2VL4 A;  4U2A A;  5T5J A;  1NCR C;  1XE7 A;  1O4Z A;  2YC0 A;  3JBG 3;  2WQ8 A;  4QXC A;  3DYM A;  3TOJ A;  2B39 A;  2LRP A;  1LOF A;  1GNY A;  2UU8 A;  2GMM A;  2RE9 A;  4KWJ A;  3OXU D;  3IB3 A;  5FMC A;  1RTV A;  2XQR A;  2HEW F;  5C33 A;  5J48 A;  1SRZ A;  2XXZ A;  4GWI A;  4XFI A;  1O5L A;  1U12 A;  3KF5 A;  3VBS C;  5FZE A;  3WCS A;  2IXK A;  1S0I A;  2OPW A;  1WBF A;  2WII C;  2WKK A;  3PME A;  2XBO 2;  1X7N A;  5LA9 A;  4UI9 L;  5B4X A;  2G7I A;  5I8T A;  2JXA A;  4XUT A;  4GAL A;  1UY3 A;  3SCG A;  4LKD A;  4AZZ A;  1ZZ9 A;  1UZY A;  4FSJ A;  3I8T A;  1S0F A;  1W3V A;  4CCD A;  3LA3 A;  3Q8F A;  1ENQ A;  3KT1 A;  4CCC A;  1UYX A;  1KIT A;  3IPV A;  1G4F A;  4JQT A;  5C9A A;  2YFU A;  4HL0 A;  5CVR A;  2X53 S;  5C5U A;  3RJ2 X;  4S2F A;  4N8M A;  4CP9 B;  1VRH 3;  4CE8 A;  2ZKN A;  2WWU A;  3N9M A;  4P5H A;  3AZV A;  4MGI E;  4QXK A;  3RNS A;  2V73 A;  2VOV A;  4DRV A;  1AX1 A;  3HMY A;  2GP3 A;  3OPZ A;  2DU0 A;  4FPC A;  1IPK A;  2XHN A;  4XAA A;  5CFD B;  1OLM E;  2RM2 3;  2ZGN A;  2RR1 2;  3QOP A;  2K46 A;  4QDQ A;  3UYJ A;  3J7H A;  2XUM A;  2ZEW A;  4GH4 C;  4Y5S A;  4CCO A;  1YQ8 A;  4RGK A;  1NCQ A;  2ZAC A;  3AP4 A;  3OPW A;  4JTN A;  3ZD2 A;  2RS1 1;  5A3W A;  2Q8C A;  3BIE A;  3BUC A;  1WLW A;  5IT6 A;  2Y8K A;  4QGN A;  1WBL A;  2BVB A;  2F4P A;  2IXJ A;  4IE5 A;  5B4N A;  2X05 A;  5CG8 A;  2VG9 A;  1LHU A;  4PLN A;  4AOC A;  2CNA A;  2YV8 A;  2ET7 A;  5FY9 A;  2RS5 3;  1IHM A;  2A6V A;  2HWC 2;  3AXD A;  3CQO A;  3LFM A;  3POG A;  4QB6 A;  2HWF 3;  3JQW A;  1CX4 A;  2RL0 A;  1DF0 A;  1OKQ A;  4QB1 A;  4HK8 A;  5FPZ A;  1Q8S A;  2P3Y A;  3SEE A;  4D7Y A;  4FFH A;  4NPR A;  1BBT 2;  1VE0 A;  2WWJ A;  2YZ4 A;  1K42 A;  2XJU A;  4BLJ A;  4P02 B;  3JB8 A;  3LOI A;  1W90 A;  3QD6 A;  1GMM A;  4RD7 A;  5IK4 A;  3ZXK A;  4CA9 A;  5AFB A;  1UX7 A;  4FP3 A;  1PGS A;  2AEN A;  1HRI 3;  2W1U A;  2YPD A;  4PBO A;  5FZO B;  1Q3E A;  1Q5O A;  3MIE A;  2I2S A;  5C3R A;  1CZS A;  3WV6 A;  3LF7 A;  3ZIW A;  4MO3 M;  2Y8S A;  2WO3 A;  3I2I A;  3ZPY A;  3B02 A;  4D94 A;  5CNA A;  1GR3 A;  1LCL A;  4R9D A;  5F5C A;  4CVU A;  4DY3 A;  5FZF A;  1W9F A;  2A5Z A;  5A7S A;  4FTS A;  4ASM B;  2J1A A;  1LHN A;  3LSE A;  1ZM1 A;  1UOB A;  1R09 3;  3P3P A;  1CAU A;  3KV6 A;  4D6R A;  5JDB A;  1SLB A;  2CL2 A;  1LR5 A;  3MIH A;  1GYK A;  1ND2 C;  5FXZ A;  3VBR A;  2WO1 A;  1EPW A;  2HWD 2;  3M2M A;  5FZA A;  4AI9 A;  2DFC A;  3SKV A;  4L8Q A;  2E7Q A;  4JDO A;  5FMB A;  2ORX A;  1TQ5 A;  4UFM A;  3SHR A;  3MF9 A;  3VD7 A;  4A6S A;  1OJY A;  3H7J A;  2NP0 A;  1YYN A;  2JDM A;  1L7L A;  2W1S A;  3OSD A;  4FFI A;  4H7L A;  2WL1 A;  4LE4 A;  4N7I A;  1VVC A;  5F6L B;  4AYE A;  1GKG A;  1IG3 A;  3SNM A;  4YM3 A;  3VKO A;  4UF0 B;  3R4S A;  4B7K A;  2HWE 1;  1VJ2 A;  1ELV A;  1XNK A;  4Q4Y 1;  3N7L A;  1NA1 B;  4S2H A;  3SQO A;  2RHP A;  4QHO A;  4BPZ A;  3CNA A;  2G9Z A;  1ENR A;  2XUE A;  5D8A B;  5G05 L;  1JZ2 A;  1IS6 A;  1VIW B;  3C3V A;  1BVP 1;  1QJF A;  4IES A;  1C28 A;  2JG9 B;  3IBM A;  1ZX5 A;  2RS3 3;  1NLQ A;  2VW1 A;  3NNL A;  4HOO A;  4Y4R A;  5FYY A;  3VZO A;  3ZFF B;  2E9Q A;  3G7D A;  4LTA A;  4EWD A;  3APB A;  4KMQ A;  1E5G A;  1RYY A;  5FXX A;  3ZR6 A;  1PMH X;  3E5X A;  1X9P A;  4CU6 A;  3UNP A;  3VL8 A;  4OZX A;  5J3U A;  1JU4 A;  2B9U A;  2JDK A;  2GH8 A;  3P1I A;  4RHV 1;  1I1E A;  2ET1 A;  1KRI A;  1TPN A;  4AYM A;  1JMU B;  3OD0 A;  1AYN 2;  4FOQ A;  4DUX A;  5FO9 B;  4GKX A;  5FZI A;  4AQS A;  1HXS 3;  4J38 B;  1GOF A;  2QCS B;  1AYM 3;  5A32 A;  3GBW A;  4BWO A;  3WNN A;  1O59 A;  3POJ A;  5FZB A;  2W47 A;  2WNV A;  3UL2 A;  4G4F A;  1OLR A;  4H55 A;  2JDU A;  1C57 A;  2XH6 A;  3VDB A;  1GP6 A;  5BNQ A;  4OHY A;  4APL A;  5ACA 1;  2WBK A;  3KM5 A;  2QQW A;  1LOF C;  1QGL A;  4MGT A;  1RUI 3;  3WHU A;  4I3G A;  4NIA A;  1RUG 3;  1U5X A;  1W6M B;  3WP6 A;  1FMD 1;  3NMB A;  3J9S A;  2W46 A;  2JX9 A;  4CDU A;  1QOS A;  5KXD A;  1L3J A;  3VD9 A;  1XJA A;  4O9E A;  2J1U A;  2WDB A;  2GN3 A;  2YXS A;  5DAP A;  4A2U A;  4WM7 A;  5J09 A;  4AFD A;  2WWS A;  4BB3 A;  1EV1 2;  4AED A;  1NXD 1;  4C0B A;  2OII A;  4UOJ A;  5FWE A;  4MZU A;  4LLF A;  1W8Z A;  5A3N A;  2GU9 A;  1VBE 2;  4RS5 B;  1NX9 A;  1CZT A;  1Y9G A;  3WW1 A;  2D98 A;  5HCH A;  2J1V A;  3BIW E;  1H2P P;  1IGO A;  1K3I A;  3HOB A;  3HN3 A;  4JV4 A;  5CYY A;  2RDS A;  5EQU A;  5T52 A;  5C9A C;  5DZF A;  4PZ5 A;  1FAY A;  1DYP A;  2PQS A;  4G3Y C;  1TMF 2;  4NMI A;  1GZT A;  1TEI A;  1IKP A;  1SMV A;  5T50 A;  4SLI A;  1U5Y A;  1XNC A;  3I2J A;  1BZW A;  1W8O A;  5A7Q A;  3OUH A;  3URF A;  2JG8 A;  4P9I A;  4AVV A;  5L9B A;  1VBA 3;  1O9A A;  5IUQ A;  2WYF A;  3MUY 1;  3MPP G;  5SV8 A;  1GP4 A;  2MEV 3;  3H1M A;  3MUZ 1;  2VCM A;  1XU2 A;  2D6P A;  2R16 A;  2LW8 A;  3T08 A;  3OBT A;  3IAQ A;  4YW4 A;  4E2Q A;  2RMU 3;  1NAE A;  2ZXQ A;  3HNB M;  3RMY A;  3WF3 A;  1YJK A;  1H04 P;  2OVU A;  2WFF 2;  4WVZ A;  4UXA A;  3DPR C;  4MGY E;  1A8D A;  2ZHN A;  3EXU A;  4MXW A;  4F83 A;  5BYN A;  2PAK A;  4S2G A;  4JGY C;  3J8F 1;  4JKM A;  2FCT A;  4I0A A;  5DAQ A;  2A7A A;  1A3K A;  4D6Q A;  1OT5 A;  4PHZ A;  3RYP A;  1JYV A;  1OOP A;  3J7N A;  3J7M A;  4W6Y A;  4Q4W 1;  4YG6 A;  2WLQ A;  4G9S B;  2QQP A;  2A71 A;  3FJS A;  5JOZ A;  4E4D X;  5C8C A;  4UW3 A;  5LEJ A;  2V72 A;  4LO5 B;  2QE3 A;  4AI3 A;  2P1B A;  4CDW B;  2VOW A;  1RVF 2;  2D6K A;  2VJX A;  4Z82 A;  4CUC A;  4KH9 A;  1BBT 3;  2F4L A;  2ZAH A;  3AKR A;  1JOB A;  2WA3 A;  3F2Z A;  5FQ0 A;  2VZQ A;  2FHR A;  5HV0 A;  5FO8 C;  2ZX1 A;  2Y6H A;  3GJA A;  1VRB A;  4XUR A;  3ZDS A;  1QJU 3;  4P9W A;  3ZYH A;  5ISL A;  1POV 1;  1SEF A;  1POQ A;  2WN3 A;  3ELN A;  1GOG A;  1OA2 A;  2C24 A;  2DCZ A;  2GME A;  2PXJ A;  4RA0 A;  3IKW A;  4BWC A;  1MAC A;  3M8L A;  1ULE A;  1DLL A;  4I3P A;  2Z2S B;  2A73 B;  3PUI A;  4YVW B;  1E88 A;  1UMZ A;  3J7L A;  3CJI A;  1NQD A;  3INA A;  3VBR C;  2MHF A;  1RUE 2;  4MHU A;  4BMB A;  2W87 A;  1YXW A;  3H9A A;  3ZFE A;  3ASI A;  3DXT A;  1JOP A;  3I59 B;  5K0U A;  5FZ6 A;  2B5I D;  4BQY A;  4CEW C;  2DWR A;  4TSV A;  1CAW A;  1QQP 3;  2YRO A;  3PVO A;  1TG7 A;  2WZR 1;  4Q4X 2;  5LBB A;  4IEU A;  1PVC 1;  3LSD A;  3VHP A;  5BNN A;  4BQX A;  3W58 A;  1V6I A;  5JXG A;  3VKM A;  3O1U A;  1VMF A;  2HWD 3;  4CU7 A;  1AHS A;  1W6Q B;  1OD5 A;  1DQ6 A;  2BVV A;  1Z78 A;  4ZY9 A;  4AGR A;  1QXR A;  2RKZ A;  1Q56 A;  3VBF A;  4MGZ E;  4UW4 A;  2GH2 A;  3PLQ A;  5AVP A;  5BXX A;  1ZZ8 A;  4D0Q A;  4DEV A;  3USS A;  4YLZ A;  2VGD A;  2MNG A;  2OXB A;  3VDD A;  1W06 A;  1LED A;  5DZG A;  4IV1 B;  1BQP A;  1WME A;  1W6O B;  2RR1 1;  1WMF A;  1D4M 2;  2Y0O A;  1J3P A;  3C7H A;  1CVN A;  3KD4 A;  3RJR A;  4EWE A;  3S57 A;  2BYV E;  1Q8O A;  2OT7 A;  4MET A;  4Q27 A;  2CWM A;  3K2O A;  4KG8 A;  5FYB A;  3TWI A;  4QXB A;  2Y6L A;  3L9J T;  1YLL A;  2H6C A;  4QHZ A;  1ZA7 A;  3WR0 A;  5CU1 A;  5LEK A;  3A7Q A;  1V9U 2;  3KQ4 B;  4NAM A;  1E5R A;  4QPG A;  5HV4 A;  2PEL A;  1OPM A;  5I8S A;  1O3T A;  3I2O A;  3DCQ A;  3E1F 1;  3R4U A;  4LIU A;  4Q2F A;  1HB1 A;  3JU9 A;  3LD8 A;  1CQ9 A;  5L7O A;  2YC4 A;  2RKY A;  4DIQ A;  2WNV C;  1QJX 3;  3ORJ A;  4LBQ B;  2ARC A;  3H7Y A;  4GUL A;  4OCT A;  2D7F A;  4OHV A;  3VZN A;  3ZOI A;  2BBV A;  3W21 A;  3TVJ A;  3Q8C A;  5I0R A;  1ODN A;  2WS9 1;  3FN9 A;  3WP4 A;  1LEC A;  4D8M A;  4CYD A;  3DF0 A;  5K4L A;  3WVJ A;  2AR6 A;  2VUA A;  4PDW B;  1HFI A;  2ZMN A;  4CDU C;  4IE4 A;  2D6L X;  1ENS A;  3CJX A;  4JDN A;  1QF3 A;  4QPY A;  5BNO A;  3BU7 A;  2W39 A;  4WM7 C;  2ZGP A;  2W0X A;  3ZYF A;  4AED C;  5JOW A;  1AR9 1;  5KHG A;  1LOA A;  4QX2 A;  1LGB A;  3ZSE A;  3GXE A;  1FPN 3;  4P9X A;  3BTX A;  2O0O A;  3LEG A;  4IGQ A;  4X8P A;  2JKB A;  3KMH A;  5A6X A;  1U0A A;  3FC0 A;  4A4A A;  5FY5 A;  2WO2 A;  3C7G A;  3ZMO A;  3HNY M;  3KB5 A;  4DXT A;  1C3H A;  3FHQ A;  1X33 A;  2HYK A;  3M7P A;  1EV1 3;  2LS6 A;  2VW2 A;  2VZS A;  3MBW A;  4H2A A;  4W65 A;  4YFW A;  5FY8 A;  3RYK A;  4EZ4 A;  1XB9 A;  2MCY A;  4LKF A;  4XFF A;  3EQE A;  3VBO A;  1SFP A;  4NO4 A;  3IMM A;  1BVV A;  1JU3 A;  2JG8 C;  3AP5 A;  1AXZ A;  3CKH A;  2EIG A;  3GBG A; 
#chains in the Genus database with same CATH homology
 5HYT B;  1MD7 A;  5FO8 C;  2G7I A;  1GHQ B;  2QQM A;  3ERB A;  3POI A;  2XWJ I;  3R62 A;  3ZD1 A;  4LOR A;  4WJG 2;  1OK1 A;  1E5G A;  4LOT A;  1ZJK A;  2MCZ A;  2YBY A;  1E88 A;  1G4G A;  2O39 C;  3RJ3 D;  1TPN A;  4AYM A;  1G4F A;  1PPQ A;  4B2R A;  4J38 B;  1VVD A;  2B5I D;  1LY2 A;  3POJ A;  2A55 A;  1GPZ A;  3POF A;  1H2Q P;  4AYI A;  1SZB A;  3POB A;  3L89 M;  2CG6 A;  4AYD A;  1HFH A;  1OK2 A;  2W81 A;  4CSY A;  1TPG A;  2RKZ A;  2CG7 A;  3CAL A;  4ONT D;  3ZD2 A;  3DEM A;  4YNX A;  3GOV A;  4MUC A;  1CKL A;  4JHS A;  4LOS A;  2BZM A;  2XQW C;  2KMS A;  1QGB A;  3MQL A;  1OJV A;  4K12 A;  2XRD A;  4B2S A;  4ZH1 D;  4LMF A;  3POG A;  2WNO A;  2RL0 A;  2RLQ A;  4IGD A;  3SW0 X;  5CKN A;  3KQ4 B;  5I0Q B;  1H2P P;  1OK9 A;  5CIS A;  4PZ5 A;  4A5W B;  2JGX A;  2QQK A;  4GZ9 A;  2RLP A;  3IX0 A;  2JGW A;  2RKY A;  2YRA A;  3T5O A;  1O9A A;  3IU3 I;  1C1Z A;  4F4O C;  2W80 A;  4KKD A;  3TVJ A;  5JPM G;  1SS2 A;  2JRA A;  1TPM A;  5HYU B;  1UOT P;  1NZI A;  3KZJ A;  3EJH A;  1QUB A;  2KRI A;  2V8E A;  1HFI A;  1MD8 A;  3KXV A;  1H04 P;  1E8B A;  3OED C;  1SPP B;  1HCC A;  2QQL A;  4DJZ A;  1NWV A;  2ERJ A;  2IZ3 A;  5CKM A;  2QY0 A;  4FXG G;  2EHF A;  2XRB A;  3GXE A;  1FBR A;  1Z92 B;  1QO6 A;  3OP8 A;  1GKN A;  1OK3 A;  1OJY A;  1U5M A;  3NFP I;  2EC3 A;  3INB C;  1OJW A;  1VVC A;  2CKU A;  4AYE A;  1GKG A;  2QQO A;  1NT0 A;  2LOJ A;  3M7P A;  1ELV A;  1Q3X A;  5CKQ A;  3OXU D;  1H03 P;  2MCY A;  5HZP B;  1SRZ A;  1SFP A;  3O8E B;  4C16 A;  1SPP A;  3ZRZ A;  5HYP A;  3POE A;  2XWB F;  2UWN A;  2IZ4 A;  2WII C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...