3EJHA

Crystal structure of the fibronectin 8-9fni domain pair in complex with a type-i collagen peptide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
91
structure length
91
Chain Sequence
DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibronectin
publication title Identification and structural analysis of type I collagen sites in complex with fibronectin fragments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 17
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ejhA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3ejhA02
1E88A 2RKYA 3KZJA 2WIIC 2MCZA 2LOJA 2UWNA 1ZJKA 1OK3A 4F4OC 3TVJA 2KRIA 2W81A 1GHQB 2XRBA 1MD7A 1UOTP 1QGBA 1SS2A 2JGXA 4C16A 2IZ4A 2RKZA 5JPMG 2RL0A 3EJHA 1G4GA 1GPZA 1TPMA 1E8BA 1OK2A 1Z92B 3SW0X 3KXVA 2CG7A 2KMSA 3ZRZA 3O8EB 4WJG2 3R62A 1GKGA 2JGWA 4LOSA 2XWBF 3GOVA 3OP8A 5FO8C 2RLQA 1VVCA 4JHSA 2O39C 2RLPA 2XQWC 4AYMA 5HYPA 4AYIA 1NWVA 1PPQA 2V8EA 3OXUD 4ONTD 4AYDA 1H2PP 2B5ID 3CALA 1H04P 1QO6A 1U5MA 1TPNA 2EHFA 2ERJA 1H03P 1QUBA 3NFPI 4K12A 1HFIA 4DJZA 4YNXA 3IU3I 2MCYA 2QY0A 4B2RA 2XRDA 1GKNA 2G7IA 2W80A 1HCCA 3L89M 1H2QP 4AYEA 5HYTB 3M7PA 4ZH1D 2CG6A 2BZMA 3ERBA 1OK1A 2YRAA 1SRZA 4PZ5A 3ZD2A 3GXEA 1OJWA 1VVDA 2XWJI 3IX0A 4J38B 3RJ3D 1CKLA 2A55A 1E5GA 4LOTA 5HZPB 1MD8A 1Q3XA 3INBC 1OJVA 4MUCA 1LY2A 3OEDC 2JRAA 4CSYA 3ZD1A 1O9AA 5I0QB 2IZ3A 2EC3A 2YBYA 1OJYA 4B2SA 4FXGG 5HYUB 3MQLA 1OK9A 1C1ZA 4IGDA 1TPGA 4A5WB 1FBRA 4KKDA 1HFHA 1ELVA 1G4FA 3T5OA 2CKUA
chains in the Genus database with same CATH superfamily
1E88A 2RKYA 2ZYCA 3KZJA 2WIIC 2MCZA 2LOJA 2UWNA 1ZJKA 1OK3A 4F4OC 3TVJA 2KRIA 2W81A 1GHQB 2XRBA 1MD7A 1UOTP 1QGBA 1SS2A 2JGXA 4C16A 3K3TA 2IZ4A 2RKZA 5JPMG 2RL0A 3EJHA 4BWCA 1G4GA 1GPZA 1TPMA 1E8BA 1OK2A 1Z92B 3SW0X 3KXVA 2CG7A 2KMSA 5DN5A 5DN4A 3ZRZA 3O8EB 4WJG2 3R62A 1GKGA 2JGWA 4LOSA 2XWBF 3GOVA 3OP8A 3NJAA 3F6KA 5FO8C 2I2LA 2RLQA 1VVCA 4JHSA 2O39C 2RLPA 2XQWC 4AYMA 5HYPA 4AYIA 1NWVA 1PPQA 2V8EA 3FGRA 3OXUD 4ONTD 4AYDA 1H2PP 2B5ID 3CALA 1H04P 1QO6A 1U5MA 1TPNA 2EHFA 4PO7A 2ERJA 1H03P 1QUBA 3NFPI 4K12A 3CI0J 1HFIA 4DJZA 4YNXA 2Y8SA 3IU3I 2MCYA 2QY0A 4B2RA 2XRDA 1GKNA 2G7IA 2W80A 1HCCA 3L89M 2Y8RA 1H2QP 4AYEA 5HYTB 3M7PA 3ZLDA 2CG6A 4ZH1D 2BZMA 3ERBA 1OK1A 2YRAA 1SRZA 4PZ5A 3VWOA 3ZD2A 3GXEA 3WSXA 1OJWA 1VVDA 2XWJI 3IX0A 4J38B 3RJ3D 1CKLA 2A55A 4N7EA 1E5GA 1RLHA 4LOTA 5HZPB 1MD8A 4YIZA 1Q3XA 2X2ZA 3FGTA 3INBC 1OJVA 4MUCA 1LY2A 3OEDC 2JRAA 4CSYA 2Y8TA 3WSYA 3ZLEA 3ZD1A 1O9AA 4APLA 5I0QB 2IZ3A 2EC3A 2YBYA 4MSLA 1OJYA 4B2SA 4FXGG 5HYUB 3MQLA 1OK9A 1C1ZA 4IGDA 1TPGA 4A5WB 1FBRA 4KKDA 1HFHA 1ELVA 1G4FA 3T5OA 2CKUA
chains in the Genus database with same CATH topology
1E88A 2RKYA 3KZJA 2WIIC 2MCZA 2LOJA 2UWNA 1ZJKA 1OK3A 4F4OC 3TVJA 2KRIA 2W81A 1GHQB 2XRBA 1MD7A 1UOTP 1QGBA 1SS2A 2JGXA 4C16A 2IZ4A 2RKZA 5JPMG 2RL0A 3EJHA 1G4GA 1GPZA 1TPMA 1E8BA 1OK2A 1Z92B 3SW0X 3KXVA 2CG7A 2KMSA 3ZRZA 3O8EB 4WJG2 3R62A 1GKGA 2JGWA 4LOSA 2XWBF 3GOVA 3OP8A 5FO8C 2RLQA 1VVCA 4JHSA 2O39C 2RLPA 2XQWC 4AYMA 5HYPA 4AYIA 1NWVA 1PPQA 2V8EA 3OXUD 4ONTD 4AYDA 1H2PP 2B5ID 3CALA 1H04P 1QO6A 1U5MA 1TPNA 2EHFA 2ERJA 1H03P 1QUBA 3NFPI 4K12A 1HFIA 4DJZA 4YNXA 3IU3I 2MCYA 2QY0A 4B2RA 2XRDA 1GKNA 2G7IA 2W80A 1HCCA 3L89M 1H2QP 4AYEA 5HYTB 3M7PA 4ZH1D 2CG6A 2BZMA 3ERBA 1OK1A 2YRAA 1SRZA 4PZ5A 3ZD2A 3GXEA 1OJWA 1VVDA 2XWJI 3IX0A 4J38B 3RJ3D 1CKLA 2A55A 1E5GA 4LOTA 5HZPB 1MD8A 1Q3XA 3INBC 1OJVA 4MUCA 1LY2A 3OEDC 2JRAA 4CSYA 3ZD1A 1O9AA 5I0QB 2IZ3A 2EC3A 2YBYA 1OJYA 4B2SA 4FXGG 5HYUB 3MQLA 1OK9A 1C1ZA 4IGDA 1TPGA 4A5WB 1FBRA 4KKDA 1HFHA 1ELVA 1G4FA 3T5OA 2CKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E88 A;  2RKY A;  3KZJ A;  2WII C;  2MCZ A;  2LOJ A;  2UWN A;  1ZJK A;  1OK3 A;  4F4O C;  3TVJ A;  2KRI A;  2W81 A;  1GHQ B;  2XRB A;  1MD7 A;  1UOT P;  1QGB A;  1SS2 A;  2JGX A;  4C16 A;  2IZ4 A;  2RKZ A;  5JPM G;  2RL0 A;  3EJH A;  1G4G A;  1GPZ A;  1TPM A;  1E8B A;  1OK2 A;  1Z92 B;  3SW0 X;  3KXV A;  2CG7 A;  2KMS A;  3ZRZ A;  3O8E B;  4WJG 2;  3R62 A;  1GKG A;  2JGW A;  4LOS A;  2XWB F;  3GOV A;  3OP8 A;  5FO8 C;  2RLQ A;  1VVC A;  4JHS A;  2O39 C;  2RLP A;  2XQW C;  4AYM A;  5HYP A;  4AYI A;  1NWV A;  1PPQ A;  2V8E A;  3OXU D;  4ONT D;  4AYD A;  1H2P P;  2B5I D;  3CAL A;  1H04 P;  1QO6 A;  1U5M A;  1TPN A;  2EHF A;  2ERJ A;  1H03 P;  1QUB A;  3NFP I;  4K12 A;  1HFI A;  4DJZ A;  4YNX A;  3IU3 I;  2MCY A;  2QY0 A;  4B2R A;  2XRD A;  1GKN A;  2G7I A;  2W80 A;  1HCC A;  3L89 M;  1H2Q P;  4AYE A;  5HYT B;  3M7P A;  4ZH1 D;  2CG6 A;  2BZM A;  3ERB A;  1OK1 A;  2YRA A;  1SRZ A;  4PZ5 A;  3ZD2 A;  3GXE A;  1OJW A;  1VVD A;  2XWJ I;  3IX0 A;  4J38 B;  3RJ3 D;  1CKL A;  2A55 A;  1E5G A;  4LOT A;  5HZP B;  1MD8 A;  1Q3X A;  3INB C;  1OJV A;  4MUC A;  1LY2 A;  3OED C;  2JRA A;  4CSY A;  3ZD1 A;  1O9A A;  5I0Q B;  2IZ3 A;  2EC3 A;  2YBY A;  1OJY A;  4B2S A;  4FXG G;  5HYU B;  3MQL A;  1OK9 A;  1C1Z A;  4IGD A;  1TPG A;  4A5W B;  1FBR A;  4KKD A;  1HFH A;  1ELV A;  1G4F A;  3T5O A;  2CKU A; 
#chains in the Genus database with same CATH topology
 1E88 A;  2RKY A;  2ZYC A;  3KZJ A;  2WII C;  2MCZ A;  2LOJ A;  2UWN A;  1ZJK A;  1OK3 A;  4F4O C;  3TVJ A;  2KRI A;  2W81 A;  1GHQ B;  2XRB A;  1MD7 A;  1UOT P;  1QGB A;  1SS2 A;  2JGX A;  4C16 A;  3K3T A;  2IZ4 A;  2RKZ A;  5JPM G;  2RL0 A;  3EJH A;  4BWC A;  1G4G A;  1GPZ A;  1TPM A;  1E8B A;  1OK2 A;  1Z92 B;  3SW0 X;  3KXV A;  2CG7 A;  2KMS A;  5DN5 A;  5DN4 A;  3ZRZ A;  3O8E B;  4WJG 2;  3R62 A;  1GKG A;  2JGW A;  4LOS A;  2XWB F;  3GOV A;  3OP8 A;  3NJA A;  3F6K A;  5FO8 C;  2I2L A;  2RLQ A;  1VVC A;  4JHS A;  2O39 C;  2RLP A;  2XQW C;  4AYM A;  5HYP A;  4AYI A;  1NWV A;  1PPQ A;  2V8E A;  3FGR A;  3OXU D;  4ONT D;  4AYD A;  1H2P P;  2B5I D;  3CAL A;  1H04 P;  1QO6 A;  1U5M A;  1TPN A;  2EHF A;  4PO7 A;  2ERJ A;  1H03 P;  1QUB A;  3NFP I;  4K12 A;  3CI0 J;  1HFI A;  4DJZ A;  4YNX A;  2Y8S A;  3IU3 I;  2MCY A;  2QY0 A;  4B2R A;  2XRD A;  1GKN A;  2G7I A;  2W80 A;  1HCC A;  3L89 M;  2Y8R A;  1H2Q P;  4AYE A;  5HYT B;  3M7P A;  3ZLD A;  2CG6 A;  4ZH1 D;  2BZM A;  3ERB A;  1OK1 A;  2YRA A;  1SRZ A;  4PZ5 A;  3VWO A;  3ZD2 A;  3GXE A;  3WSX A;  1OJW A;  1VVD A;  2XWJ I;  3IX0 A;  4J38 B;  3RJ3 D;  1CKL A;  2A55 A;  4N7E A;  1E5G A;  1RLH A;  4LOT A;  5HZP B;  1MD8 A;  4YIZ A;  1Q3X A;  2X2Z A;  3FGT A;  3INB C;  1OJV A;  4MUC A;  1LY2 A;  3OED C;  2JRA A;  4CSY A;  2Y8T A;  3WSY A;  3ZLE A;  3ZD1 A;  1O9A A;  4APL A;  5I0Q B;  2IZ3 A;  2EC3 A;  2YBY A;  4MSL A;  1OJY A;  4B2S A;  4FXG G;  5HYU B;  3MQL A;  1OK9 A;  1C1Z A;  4IGD A;  1TPG A;  4A5W B;  1FBR A;  4KKD A;  1HFH A;  1ELV A;  1G4F A;  3T5O A;  2CKU A; 
#chains in the Genus database with same CATH homology
 1E88 A;  2RKY A;  3KZJ A;  2WII C;  2MCZ A;  2LOJ A;  2UWN A;  1ZJK A;  1OK3 A;  4F4O C;  3TVJ A;  2KRI A;  2W81 A;  1GHQ B;  2XRB A;  1MD7 A;  1UOT P;  1QGB A;  1SS2 A;  2JGX A;  4C16 A;  2IZ4 A;  2RKZ A;  5JPM G;  2RL0 A;  3EJH A;  1G4G A;  1GPZ A;  1TPM A;  1E8B A;  1OK2 A;  1Z92 B;  3SW0 X;  3KXV A;  2CG7 A;  2KMS A;  3ZRZ A;  3O8E B;  4WJG 2;  3R62 A;  1GKG A;  2JGW A;  4LOS A;  2XWB F;  3GOV A;  3OP8 A;  5FO8 C;  2RLQ A;  1VVC A;  4JHS A;  2O39 C;  2RLP A;  2XQW C;  4AYM A;  5HYP A;  4AYI A;  1NWV A;  1PPQ A;  2V8E A;  3OXU D;  4ONT D;  4AYD A;  1H2P P;  2B5I D;  3CAL A;  1H04 P;  1QO6 A;  1U5M A;  1TPN A;  2EHF A;  2ERJ A;  1H03 P;  1QUB A;  3NFP I;  4K12 A;  1HFI A;  4DJZ A;  4YNX A;  3IU3 I;  2MCY A;  2QY0 A;  4B2R A;  2XRD A;  1GKN A;  2G7I A;  2W80 A;  1HCC A;  3L89 M;  1H2Q P;  4AYE A;  5HYT B;  3M7P A;  4ZH1 D;  2CG6 A;  2BZM A;  3ERB A;  1OK1 A;  2YRA A;  1SRZ A;  4PZ5 A;  3ZD2 A;  3GXE A;  1OJW A;  1VVD A;  2XWJ I;  3IX0 A;  4J38 B;  3RJ3 D;  1CKL A;  2A55 A;  1E5G A;  4LOT A;  5HZP B;  1MD8 A;  1Q3X A;  3INB C;  1OJV A;  4MUC A;  1LY2 A;  3OED C;  2JRA A;  4CSY A;  3ZD1 A;  1O9A A;  5I0Q B;  2IZ3 A;  2EC3 A;  2YBY A;  1OJY A;  4B2S A;  4FXG G;  5HYU B;  3MQL A;  1OK9 A;  1C1Z A;  4IGD A;  1TPG A;  4A5W B;  1FBR A;  4KKD A;  1HFH A;  1ELV A;  1G4F A;  3T5O A;  2CKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...