1E5GA

Solution structure of central cp module pair of a pox virus complement inhibitor
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
120
structure length
120
Chain Sequence
RRCPSPRDIDNGQLDIGGVDFGSSITYSCNSGYHLIGESKSYCELGSTGSMVWNPEAPICESVKCQSPPSISNGRHNGYEDFYTDGSVVTYSCNSGYSLIGNSGVLCSGGEWSDPPTCQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT CONTROL PROTEIN C3
publication title Solution Structure and Dynamics of the Central Ccp Module Pair of a Poxvirus Complement Control Protein
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Complement inhibitor
total genus 12
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e5gA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1e5gA02
1O9AA 2W81A 1LY2A 4FXGG 4J38B 3L89M 1GHQB 1PPQA 3GXEA 4K12A 2IZ4A 4CSYA 2EHFA 2XQWC 1G4GA 3EJHA 3OP8A 2CG7A 3MQLA 2KRIA 2CKUA 4AYEA 1HFIA 2A55A 3KZJA 1GKNA 5I0QB 2JRAA 4LOTA 1CKLA 3KXVA 3M7PA 2O39C 5HYUB 1QO6A 5JPMG 2W80A 3NFPI 1E8BA 3GOVA 4JHSA 4AYMA 1HCCA 1SRZA 4F4OC 2ERJA 4ONTD 4PZ5A 2RKZA 2MCYA 5HYTB 1MD7A 4B2RA 1H2PP 2RL0A 1UOTP 2BZMA 3ZRZA 2V8EA 1U5MA 1TPNA 1OK2A 2KMSA 2XWJI 4B2SA 3ERBA 2MCZA 2XWBF 1E88A 1TPMA 1E5GA 2EC3A 1VVDA 2RLQA 2YRAA 4AYIA 5FO8C 3TVJA 4KKDA 1GPZA 1GKGA 3INBC 3RJ3D 3OEDC 3R62A 1MD8A 1OK9A 3CALA 1H04P 3ZD1A 1FBRA 2RKYA 3ZD2A 2XRDA 1OJVA 3IX0A 4YNXA 4C16A 2QY0A 4ZH1D 3OXUD 1VVCA 1QUBA 1Z92B 1OJWA 4IGDA 2UWNA 1NWVA 4WJG2 1ZJKA 3O8EB 5HZPB 2XRBA 1H2QP 3IU3I 2CG6A 1H03P 1OK1A 4DJZA 2JGWA 1G4FA 1SS2A 1OK3A 2B5ID 2YBYA 4MUCA 2WIIC 4LOSA 1TPGA 2RLPA 2G7IA 4A5WB 1ELVA 1Q3XA 1QGBA 2LOJA 3T5OA 1OJYA 2IZ3A 3SW0X 5HYPA 1HFHA 4AYDA 1C1ZA 2JGXA
chains in the Genus database with same CATH superfamily
1O9AA 2W81A 1LY2A 4FXGG 4J38B 3L89M 1GHQB 1PPQA 3GXEA 4K12A 3VWOA 2Y8TA 2IZ4A 4CSYA 3FGRA 2EHFA 2XQWC 1G4GA 3ZLEA 3EJHA 3OP8A 2CG7A 3WSYA 3MQLA 2KRIA 2CKUA 4AYEA 1HFIA 2A55A 4APLA 3KZJA 5DN5A 1GKNA 5I0QB 2JRAA 4LOTA 1CKLA 3KXVA 3M7PA 2O39C 5HYUB 1QO6A 2ZYCA 5JPMG 2W80A 3NFPI 1E8BA 3GOVA 4JHSA 4AYMA 1HCCA 1SRZA 4F4OC 2ERJA 4ONTD 4PZ5A 2RKZA 2MCYA 5HYTB 1MD7A 4B2RA 1H2PP 2RL0A 1UOTP 2BZMA 3ZRZA 2V8EA 1U5MA 1TPNA 1OK2A 2KMSA 1RLHA 2XWJI 4B2SA 3ERBA 2MCZA 2XWBF 1E88A 1TPMA 1E5GA 2EC3A 3CI0J 1VVDA 4YIZA 2RLQA 2YRAA 4AYIA 5FO8C 3TVJA 3K3TA 4KKDA 1GPZA 1GKGA 2Y8SA 3INBC 3RJ3D 3OEDC 3R62A 1MD8A 1OK9A 4N7EA 4MSLA 3CALA 1H04P 3ZD1A 1FBRA 2RKYA 2Y8RA 3ZD2A 2XRDA 3FGTA 1OJVA 3IX0A 4BWCA 2I2LA 4YNXA 4C16A 2QY0A 4ZH1D 3OXUD 1VVCA 1QUBA 1Z92B 1OJWA 4IGDA 2UWNA 1NWVA 4WJG2 1ZJKA 3O8EB 4PO7A 5HZPB 2XRBA 1H2QP 3IU3I 2CG6A 3NJAA 1H03P 1OK1A 4DJZA 2JGWA 1G4FA 5DN4A 2X2ZA 1SS2A 1OK3A 2B5ID 2YBYA 4MUCA 2WIIC 4LOSA 1TPGA 3WSXA 2RLPA 3ZLDA 2G7IA 4A5WB 1ELVA 1Q3XA 1QGBA 2LOJA 3T5OA 1OJYA 2IZ3A 3SW0X 3F6KA 5HYPA 1HFHA 4AYDA 1C1ZA 2JGXA
chains in the Genus database with same CATH topology
1O9AA 2W81A 1LY2A 4FXGG 4J38B 3L89M 1GHQB 1PPQA 3GXEA 4K12A 2IZ4A 4CSYA 2EHFA 2XQWC 1G4GA 3EJHA 3OP8A 2CG7A 3MQLA 2KRIA 2CKUA 4AYEA 1HFIA 2A55A 3KZJA 1GKNA 5I0QB 2JRAA 4LOTA 1CKLA 3KXVA 3M7PA 2O39C 5HYUB 1QO6A 5JPMG 2W80A 3NFPI 1E8BA 3GOVA 4JHSA 4AYMA 1HCCA 1SRZA 4F4OC 2ERJA 4ONTD 4PZ5A 2RKZA 2MCYA 5HYTB 1MD7A 4B2RA 1H2PP 2RL0A 1UOTP 2BZMA 3ZRZA 2V8EA 1U5MA 1TPNA 1OK2A 2KMSA 2XWJI 4B2SA 3ERBA 2MCZA 2XWBF 1E88A 1TPMA 1E5GA 2EC3A 1VVDA 2RLQA 2YRAA 4AYIA 5FO8C 3TVJA 4KKDA 1GPZA 1GKGA 3INBC 3RJ3D 3OEDC 3R62A 1MD8A 1OK9A 3CALA 1H04P 3ZD1A 1FBRA 2RKYA 3ZD2A 2XRDA 1OJVA 3IX0A 4YNXA 4C16A 2QY0A 4ZH1D 3OXUD 1VVCA 1QUBA 1Z92B 1OJWA 4IGDA 2UWNA 1NWVA 4WJG2 1ZJKA 3O8EB 5HZPB 2XRBA 1H2QP 3IU3I 2CG6A 1H03P 1OK1A 4DJZA 2JGWA 1G4FA 1SS2A 1OK3A 2B5ID 2YBYA 4MUCA 2WIIC 4LOSA 1TPGA 2RLPA 2G7IA 4A5WB 1ELVA 1Q3XA 1QGBA 2LOJA 3T5OA 1OJYA 2IZ3A 3SW0X 5HYPA 1HFHA 4AYDA 1C1ZA 2JGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9A A;  2W81 A;  1LY2 A;  4FXG G;  4J38 B;  3L89 M;  1GHQ B;  1PPQ A;  3GXE A;  4K12 A;  2IZ4 A;  4CSY A;  2EHF A;  2XQW C;  1G4G A;  3EJH A;  3OP8 A;  2CG7 A;  3MQL A;  2KRI A;  2CKU A;  4AYE A;  1HFI A;  2A55 A;  3KZJ A;  1GKN A;  5I0Q B;  2JRA A;  4LOT A;  1CKL A;  3KXV A;  3M7P A;  2O39 C;  5HYU B;  1QO6 A;  5JPM G;  2W80 A;  3NFP I;  1E8B A;  3GOV A;  4JHS A;  4AYM A;  1HCC A;  1SRZ A;  4F4O C;  2ERJ A;  4ONT D;  4PZ5 A;  2RKZ A;  2MCY A;  5HYT B;  1MD7 A;  4B2R A;  1H2P P;  2RL0 A;  1UOT P;  2BZM A;  3ZRZ A;  2V8E A;  1U5M A;  1TPN A;  1OK2 A;  2KMS A;  2XWJ I;  4B2S A;  3ERB A;  2MCZ A;  2XWB F;  1E88 A;  1TPM A;  1E5G A;  2EC3 A;  1VVD A;  2RLQ A;  2YRA A;  4AYI A;  5FO8 C;  3TVJ A;  4KKD A;  1GPZ A;  1GKG A;  3INB C;  3RJ3 D;  3OED C;  3R62 A;  1MD8 A;  1OK9 A;  3CAL A;  1H04 P;  3ZD1 A;  1FBR A;  2RKY A;  3ZD2 A;  2XRD A;  1OJV A;  3IX0 A;  4YNX A;  4C16 A;  2QY0 A;  4ZH1 D;  3OXU D;  1VVC A;  1QUB A;  1Z92 B;  1OJW A;  4IGD A;  2UWN A;  1NWV A;  4WJG 2;  1ZJK A;  3O8E B;  5HZP B;  2XRB A;  1H2Q P;  3IU3 I;  2CG6 A;  1H03 P;  1OK1 A;  4DJZ A;  2JGW A;  1G4F A;  1SS2 A;  1OK3 A;  2B5I D;  2YBY A;  4MUC A;  2WII C;  4LOS A;  1TPG A;  2RLP A;  2G7I A;  4A5W B;  1ELV A;  1Q3X A;  1QGB A;  2LOJ A;  3T5O A;  1OJY A;  2IZ3 A;  3SW0 X;  5HYP A;  1HFH A;  4AYD A;  1C1Z A;  2JGX A; 
#chains in the Genus database with same CATH topology
 1O9A A;  2W81 A;  1LY2 A;  4FXG G;  4J38 B;  3L89 M;  1GHQ B;  1PPQ A;  3GXE A;  4K12 A;  3VWO A;  2Y8T A;  2IZ4 A;  4CSY A;  3FGR A;  2EHF A;  2XQW C;  1G4G A;  3ZLE A;  3EJH A;  3OP8 A;  2CG7 A;  3WSY A;  3MQL A;  2KRI A;  2CKU A;  4AYE A;  1HFI A;  2A55 A;  4APL A;  3KZJ A;  5DN5 A;  1GKN A;  5I0Q B;  2JRA A;  4LOT A;  1CKL A;  3KXV A;  3M7P A;  2O39 C;  5HYU B;  1QO6 A;  2ZYC A;  5JPM G;  2W80 A;  3NFP I;  1E8B A;  3GOV A;  4JHS A;  4AYM A;  1HCC A;  1SRZ A;  4F4O C;  2ERJ A;  4ONT D;  4PZ5 A;  2RKZ A;  2MCY A;  5HYT B;  1MD7 A;  4B2R A;  1H2P P;  2RL0 A;  1UOT P;  2BZM A;  3ZRZ A;  2V8E A;  1U5M A;  1TPN A;  1OK2 A;  2KMS A;  1RLH A;  2XWJ I;  4B2S A;  3ERB A;  2MCZ A;  2XWB F;  1E88 A;  1TPM A;  1E5G A;  2EC3 A;  3CI0 J;  1VVD A;  4YIZ A;  2RLQ A;  2YRA A;  4AYI A;  5FO8 C;  3TVJ A;  3K3T A;  4KKD A;  1GPZ A;  1GKG A;  2Y8S A;  3INB C;  3RJ3 D;  3OED C;  3R62 A;  1MD8 A;  1OK9 A;  4N7E A;  4MSL A;  3CAL A;  1H04 P;  3ZD1 A;  1FBR A;  2RKY A;  2Y8R A;  3ZD2 A;  2XRD A;  3FGT A;  1OJV A;  3IX0 A;  4BWC A;  2I2L A;  4YNX A;  4C16 A;  2QY0 A;  4ZH1 D;  3OXU D;  1VVC A;  1QUB A;  1Z92 B;  1OJW A;  4IGD A;  2UWN A;  1NWV A;  4WJG 2;  1ZJK A;  3O8E B;  4PO7 A;  5HZP B;  2XRB A;  1H2Q P;  3IU3 I;  2CG6 A;  3NJA A;  1H03 P;  1OK1 A;  4DJZ A;  2JGW A;  1G4F A;  5DN4 A;  2X2Z A;  1SS2 A;  1OK3 A;  2B5I D;  2YBY A;  4MUC A;  2WII C;  4LOS A;  1TPG A;  3WSX A;  2RLP A;  3ZLD A;  2G7I A;  4A5W B;  1ELV A;  1Q3X A;  1QGB A;  2LOJ A;  3T5O A;  1OJY A;  2IZ3 A;  3SW0 X;  3F6K A;  5HYP A;  1HFH A;  4AYD A;  1C1Z A;  2JGX A; 
#chains in the Genus database with same CATH homology
 1O9A A;  2W81 A;  1LY2 A;  4FXG G;  4J38 B;  3L89 M;  1GHQ B;  1PPQ A;  3GXE A;  4K12 A;  2IZ4 A;  4CSY A;  2EHF A;  2XQW C;  1G4G A;  3EJH A;  3OP8 A;  2CG7 A;  3MQL A;  2KRI A;  2CKU A;  4AYE A;  1HFI A;  2A55 A;  3KZJ A;  1GKN A;  5I0Q B;  2JRA A;  4LOT A;  1CKL A;  3KXV A;  3M7P A;  2O39 C;  5HYU B;  1QO6 A;  5JPM G;  2W80 A;  3NFP I;  1E8B A;  3GOV A;  4JHS A;  4AYM A;  1HCC A;  1SRZ A;  4F4O C;  2ERJ A;  4ONT D;  4PZ5 A;  2RKZ A;  2MCY A;  5HYT B;  1MD7 A;  4B2R A;  1H2P P;  2RL0 A;  1UOT P;  2BZM A;  3ZRZ A;  2V8E A;  1U5M A;  1TPN A;  1OK2 A;  2KMS A;  2XWJ I;  4B2S A;  3ERB A;  2MCZ A;  2XWB F;  1E88 A;  1TPM A;  1E5G A;  2EC3 A;  1VVD A;  2RLQ A;  2YRA A;  4AYI A;  5FO8 C;  3TVJ A;  4KKD A;  1GPZ A;  1GKG A;  3INB C;  3RJ3 D;  3OED C;  3R62 A;  1MD8 A;  1OK9 A;  3CAL A;  1H04 P;  3ZD1 A;  1FBR A;  2RKY A;  3ZD2 A;  2XRD A;  1OJV A;  3IX0 A;  4YNX A;  4C16 A;  2QY0 A;  4ZH1 D;  3OXU D;  1VVC A;  1QUB A;  1Z92 B;  1OJW A;  4IGD A;  2UWN A;  1NWV A;  4WJG 2;  1ZJK A;  3O8E B;  5HZP B;  2XRB A;  1H2Q P;  3IU3 I;  2CG6 A;  1H03 P;  1OK1 A;  4DJZ A;  2JGW A;  1G4F A;  1SS2 A;  1OK3 A;  2B5I D;  2YBY A;  4MUC A;  2WII C;  4LOS A;  1TPG A;  2RLP A;  2G7I A;  4A5W B;  1ELV A;  1Q3X A;  1QGB A;  2LOJ A;  3T5O A;  1OJY A;  2IZ3 A;  3SW0 X;  5HYP A;  1HFH A;  4AYD A;  1C1Z A;  2JGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...