1MD8A

Monomeric structure of the active catalytic domain of complement protease c1r
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
329
structure length
314
Chain Sequence
DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 314
sequence length 329
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A01
4ZXYH 1O3BA 2UWPA 3ZZAA 1KDQA 1TA2A 2A7HA 4RKJB 7LPRA 3BEFB 2ZGBH 5DPAA 1PPQA 1BRUP 1OWDA 1GBTA 2WUCA 1VR1H 1ZPCA 1GKNA 2VH0A 3SNCA 2CJIA 1O2NA 1Q31A 4DVAU 2A32A 4I31A 1PPCE 3QGNB 4KP0A 2JGWA 2AS9A 2OUAA 4ABIA 3RXKA 2OBQA 4A92A 2R2MB 1AZ8A 5TJXA 1H2PP 3RLWH 2FI5E 4CRDA 4Y6DA 4BAHB 2BX3A 4INKA 5C3NA 4KGAA 4ESTE 1LCYA 3STIA 4D8NA 1C5ZB 2BXTH 3QUMP 2PSXA 1Q3XA 1GHAG 1QBNA 5AF9H 1Y5UT 4WXVA 4YM9A 5GWZA 1F2SE 3KQDA 2TGAA 3L3TA 1J8AA 1C9TA 4HGCA 2F9VA 1GJ5H 1ANEA 1P0SH 3V12A 1TABE 4DOQA 3QK1A 4Y0ZE 5J4SA 1NWVA 3AVZA 5JBTA 2Z7FE 3KN2A 4XBDA 3TK6A 2BZMA 2NU1E 3E91A 1DXPA 1MKXK 1SS2A 1O2JA 2ALPA 3TK5A 3UOUA 2Z3DA 3ZZBA 1AFQC 4Y71A 4WXIA 3Q3KA 1FPCH 3ODFA 3OY5U 3GISB 1ZGIA 3NKKA 3LPRA 2XTTB 1HXEH 1B5GH 4ISIH 2IN2A 4Y7AA 3K2UA 2OP9A 1NTPA 1ABJH 4B2AA 2VVUA 1GDUA 3UUZA 1P3CA 3RC5A 2BDCA 1UTOA 1H8DH 2GCHF 1O2KA 4WMDA 2FODA 1S82A 1GBCA 1GI0A 3MQLA 2YNBA 1NROH 2Y82A 1FPHH 3RXAA 4WMEA 1C1OA 2FTLE 2VWOA 1OX1A 4GSOA 4X8VH 3QZRA 2V3OH 1KIGH 1TBRH 5A09A 4JMYA 2WIIC 1D4PB 1NS3A 1EPTC 1DLKB 5CHAB 1C2LA 2BX4A 1YCPK 4UDWH 2NWNA 1ZZZA 3P8GA 3RP2A 4FUFA 3TH4H 1W12U 4IC6A 1TE0A 1TYNA 4JZ1A 2G4TA 5A8XA 4ABHA 3ATIA 4NZLA 3MH4A 5EXLA 1V6DA 4AYMA 2A5KA 5HYUB 3TIUA 6LPRA 3T62A 3TLOA 1XM1A 4D7FA 1LVOA 3LOXA 2C93B 4AYEA 2JH5D 3F9EA 2Z9GA 1OP2A 3M35A 3VPKA 2Z9IA 3EDXB 1TB6H 1DSUA 3KL6A 4Y7BA 4CREA 1K1JA 4XDEA 1GVKB 3ZVDA 1EUFA 1Z1IA 2O8MA 1O2QA 1D3TB 2TIOA 2KMSA 5HM2A 1Y3VA 1Y8TA 1K1MA 1C2HA 1OPHB 3ZZ7A 3GCHB 4X2VA 1BTZA 3BTQE 2PKSC 1EASA 1XUFA 1Y59T 1GHAF 1IQLA 1C5OH 3MO6A 1SFQB 2ZTZA 2VIQA 1J14A 1MTNB 1DFPA 3ZZCA 2WPLS 1CA0B 2XC5A 2WUBA 3P70B 1G37A 4MPUA 2TGDA 2BLQA 4R0IA 7GCHG 1GI2A 3TH3H 5DP6A 1FN6A 3SV8A 1C5VA 1JBUH 3VGCC 1AVGH 2QF3A 2NU2E 1Z1JA 3SNAA 5DGJA 1XUHA 3RXGA 3BTTE 4X2WA 2RKYA 3E16B 1SBWA 3GY4A 3T2NA 1H9HE 1TRYA 3GICB 3EA7A 1YCPM 2FMJA 1AKSA 1FQ3A 2BD9A 4SGAE 1GBJA 1C5QA 1FV9A 2P59A 2A0QB 1T8OA 2HPQH 1GI5A 1F0SA 2XCFA 3U69H 1NU7B 3T25A 2BZ6H 2I6SA 1YPHC 1RTLA 2O39C 2IOTA 5BRRE 1T32A 1OYQA 2UWNA 1A0JA 3M37A 4YOIA 1O31A 1ANBA 2BYAX 3ATKA 1QA0A 3A84A 2R2WU 1GMCG 1LQDB 1WBGB 4NIVA 1WAYB 2NU4E 4DJZB 4BAKB 1LVBA 1E38B 1KXFA 1K1PA 2OC0A 1J9CH 2ZO3H 4AYYB 2C3SA 3GY8A 2QGRA 1V2ST 3ZVEA 1K9OE 1QA7A 5GCHG 1NESE 2AEIH 2FOBA 2ZPQA 5T6DA 4X8SH 1LHGH 5AVDA 1G3EA 1GJ4H 1O3IA 2R3YA 1OK2A 1QRZA 1O2VA 1O2IA 2G8TA 2ZDMA 4NG9H 1PQ5A 1HJ9A 1DWCH 3NZIA 2C8WB 4HZHA 3EA8A 1C5MD 1E5GA 2TGPZ 3MHWU 3A7YA 3M36A 3BG4C 3STJA 3SORA 4YZUA 1MQ5A 1LKBA 2BXUH 1EP5A 1S6HA 4WH8A 2XXLA 3PMHB 3O8CA 2KRIA 2ZGHA 1XVMA 1K1IA 1VGCC 1BZXE 4IN2A 3JZ2B 2CF9H 3UR6A 1ZJDA 3S9AA 4DT7B 4ABFA 1BTHH 3ZVGA 1AFQB 5HM9A 1SLVB 3M5NA 1O5BB 3B8JA 1TNGA 4F49A 2R3UA 3RXOA 1NZQH 2LNCA 1TNIA 3LT3A 4DG4A 2WPHS 4NA8A 4WY3A 4FUCA 3LH3A 7GCHF 3NK8A 5FAHA 1HFHA 1ESAA 2VWNA 1IQEA 4ZHAA 5GPIB 3LKWA 3NCLA 3ZD2A 1VZQH 1SFIA 3UWIA 3RC6A 1ARBA 1OKXA 2O8WA 4DIIH 1QNJA 1GHBG 1DX5M 1O3KA 1OWKA 5E0GA 3INBC 3PLKA 4MDSA 1FY5A 4Q2KA 1IQKA 1PPFE 3RXDA 3SV2H 2R9PA 2XQWC 4DCDA 1AGJA 1IOEA 1XUJA 2V35A 1JOUB 1EPTB 3SO3A 3W94A 1QB9A 4A7IB 2BZAA 2ANYA 1H4WA 3RXPA 3F9HA 1QB6A 3NXPA 1G4GA 3AW1A 3TPIZ 4OS7A 1LVMA 1DY9A 1S6FA 2K1QA 2Y5HA 3HGNA 1MMJN 5JBCS 1GG6C 1SGRE 1O3HA 3BTFE 3UNQA 1MAXA 5GIBA 1ZMLA 3MYWA 1S81A 2F9NA 5PTPA 1DWBH 1GMCF 2C8XB 1C1RA 3MH7A 4ZH8A 4NGAH 1AQ7A 2ZQ2A 1GBDA 1Z8RA 3GDVA 4Q80A 4ZROA 5ABWA 4U2WA 2FXRA 1H9LB 1NY22 1RTFB 4IMQA 1ABIH 5GCHF 1BMMH 1LHCH 5A0BA 1OP0A 1O30A 2VINA 1V2UT 1W0YH 5A0AE 1XXFA 1G3DA 1B7XB 1A7SA 3A7WA 1BA8B 5C1YA 3NFPI 1P02A 1E35B 2PKSB 2ZHQH 3M5LA 3TNSA 1GCDA 3BSQA 1GVZA 3M5OA 2W5EA 2PTNA 1N6XA 1ZR0A 2ZHWH 5H4IB 3RXRA 2QXHA 1QRXA 1MH0A 4K1SA 2BDGA 2VGCC 1LMWB 1EOJA 2OXSA 2P94A 1F0RA 4K69A 2ZHDA 4YESB 3Q00A 2BMGB 2VIPA 2GTBA 4MLFB 5CMXH 2ZKSA 3T26A 3PYHA 2BY9X 8GCHG 3VGCB 3GYMA 1MKWH 4TWYA 1NPMA 3S69A 1FY3A 1IHSH 3B9FH 1NC6A 1W10U 4HI3A 4MPXA 5G4BA 3UPEA 4Y0YE 1GHWH 4MUCA 1INCA 2G81E 4ZKRU 2G4UA 3IX0A 2OINA 1BRAA 3EJHA 2BD2A 1QO6A 2FI3E 1K2I1 3SNDA 5F03A 1BOQA 1A3BH 8ESTE 2V3HH 5C1UA 1V2QT 1IQJA 3A81A 2ANWA 3ESTA 3KF2A 4AB8A 4BAMB 1FAKH 1SQTA 2QXIA 1TGCA 4ABBA 1O33A 2D26C 4Y11E 3SZNA 2ODQA 4U30A 1CQQA 1Y5BT 5HMAA 3E1XB 4A6LA 2CGAA 4IGDA 4J1YA 1JRTA 1IQIA 2BLVA 2V0BA 3BIVH 1GHBF 2R0LA 5EQSA 2G7IA 7KMEH 2SGAA 3HK3B 4AG1A 4UFFH 1O5EH 3ZVCA 3MNSA 5FHTA 2F9BH 1MZAA 5GXPA 2DE8A 3GYLB 5DP5A 2XRDA 1WQVH 1SRZA 1SGQE 2FOCA 2A1DB 1UTLM 2BD8A 3AAUA 4X6OA 5LPFA 3KEEA 1MTWA 2B9LA 3ZD1A 3RJ3D 5A0CA 2AMPA 1A5HA 2JH6D 2Q6GA 3SGBE 4CH2B 1ZHRA 1SGCA 3HPTB 1HCGA 3CALA 4K1TA 4KTUA 4ZUHA 2OQ5A 1BTWA 2VIWA 1BBRH 2W3KA 1C5NH 3GY7A 5DK1A 3BG4B 4MTBA 2IZ4A 1O2XA 5FX5A 1ESBA 1MBQA 2Y5GA 1XKBC 4Y79A 1TNHA 2BQ6B 1FI8A 4ZH1D 1FDPA 1O3JA 2J38A 1ELCA 3A7ZA 4MQAA 3M5MA 1V2PT 1VGCB 1V2JT 3PMJA 1GBMA 1MCVA 2HNTC 5T6GA 3R62A 2UWLA 2IJOB 3GCHC 4WVPE 2W3IA 4ZXXH 4X1QU 3HK6B 4THNH 3RXLA 4KTCA 5E2OA 5C5OA 4I7YH 1XX9A 1EX3A 3IU3I 1HIAA 1P8VC 3E6PH 4E7NA 3SJ8A 1Y3XA 1C2GA 1RJXB 1SGEE 1SGFA 1Z6JH 2FO9A 3A86A 1K21H 5JBAS 1Z8IB 5FBIA 2ERJA 1HUTH 3VXEH 1RD3B 3RXEA 3SJIA 4IS5A 1EOLA 4NWLA 1HPGA 2QN5T 4ISHH 2O8UA 4MNYA 8GCHF 4YLQH 3SUDA 2OCVB 1KTSB 2XWBI 1OJWA 2HWLB 1UK2A 2GKVE 4E06H 2GGVB 3SUEA 3GCNA 1FMGA 2UWOA 1DXWA 1IHTH 4ABGA 1TRNA 3RXHA 3SV7A 4BTIB 1SGTA 4AFZA 1JIMA 1TPSA 1C4U2 2FI4E 3LJOA 1RGQA 4WJG2 1C2IA 3N7OA 3P92A 4B2BA 2XWBF 3PM3A 2SGDE 5T6FA 2W26A 1ZMJA 1AE5A 2CG7A 1QQ4A 2QC2A 1GG6B 1GI3A 4TY7A 2CKUA 2WPKS 2PR3A 5FPTA 2GCTC 5FBEA 2J34A 5FPYA 3SU0A 4NA7A 3ENSB 4FU7A 2CN0H 1NRNH 1O5CB 1S83A 3K6ZA 4LOTA 4CR5A 1JXPA 2ODYB 2HGTH 1JRSA 2ZIQH 4IC5A 2QCYA 4RN6A 1GBIA 1NU9A 3BEIB 1EZSC 1O2GH 5DP7A 2BD5A 1MTUA 1AKSB 2ZDKA 2XW9A 2PTCE 3DT0H 3I29A 2J92A 3DFJA 1MKWK 1TNLA 2TGTA 3ZZ3A 2JGXA 2H9HA 3TJOA 1DWDH 3F1SB 3AASA 5EW1H 5FX6A 3CS7A 4Y8XA 2FLRH 1G9IE 2M5TA 3PB1E 1BRBE 1O34A 1OSSA 1YPGH 1E36B 1HAIH 1K1NA 4ZKOU 1SB1H 4FUHA 2A4OA 1TALA 1O2YA 5DP9A 5L30H 2VGCB 4JZFH 4TPIZ 2FLBH 1NM6A 2BDYA 2GP9B 5EPYA 3SGQE 3RXFA 4IW4E 1EZUC 1P57B 4BTUB 1EAWA 3IG6B 1GI7B 1IQNA 2Y7XA 4O03A 5JB9S 3KXVA 2QYIA 2FOMB 3BTGE 1O3LA 4X2XA 1HAZB 1SSXA 2EC9H 4NZQA 1O5AB 4KKDA 1KLTA 1TBZH 1P09A 3QO6A 1HFIA 3DHKH 5C1XA 1NFWA 3A83A 1FIZA 1H9IE 2P3UB 5L2YH 1GJ8B 1O39A 4TY6A 1T4UH 1BMLA 5F8TA 3BTEE 1UTMA 3R0FA 1QL8A 1PFXC 1ZGVA 1V2OT 1THSH 4K60A 1FZZA 4FU9A 4OGXA 3KIDU 3TVJA 4B2SA 3P95A 1O3EA 2XYAA 1YP9A 2W80A 2MCZA 1OWEA 1P10A 2D8WA 1P3EA 5FPSA 1GHZA 1KLJH 5K7RA 1SGDE 2DE9A 3GY6A 1SQOA 3MU4A 1OS8A 2FOAA 1TPGA 1E37B 4ABEA 1O2PA 4FUGA 1THRH 2STBE 1BBRK 2LOJA 3MU5A 2A5AA 1GI4A 1SLXB 4NIXA 3W95A 1A3EH 2ZQ1A 1L0ZA 4J38B 1JWTA 1MUEB 3P8NA 4UONA 6GCHG 1E8BA 1QGBA 5HYOA 2Q6DA 2A2QH 4AYIA 3MNBA 4FUBA 5EW2H 1DUEA 1Z7KA 1KSNA 3SU1A 3EQ0H 2PKAB 3TNTA 3O8RA 4GCHG 4U01A 4CSYA 2GD4B 3KQEA 5SGAE 1F0TA 1YLCA 5HYPA 1QBVH 3EGKH 4K5ZA 4HFPB 4BXSA 3A7TA 5LH8A 1G3BA 4D9RA 1TNJA 2H9EH 1W11U 1ZMNA 4AGJA 1V2TT 3OSYA 1RTKA 1V2RT 3A8AA 1WV7H 1C1PA 1RS0A 3A8CA 3HATH 1G4FA 2BOKA 3F68H 3SNEA 2PFEA 3SU4A 1FY4A 3HKIB 1C5TA 1MTSA 1WTHD 3O8EB 1AUJA 1F0UA 3PLPA 1HJAB 2B8OH 3A8BA 3SJ9A 4ISLA 1E34B 1O3CA 1UTNA 3M3TA 1S5SA 4AGKA 1AVXA 4ZMAH 4E05H 3SW0X 3FANA 5HYTB 1TA6A 1BDAA 3GDUA 2BVRH 1YPKH 2ZCKP 1LDTT 1HRTH 4D76A 3LC5A 3SBKA 1CT4E 2VVVA 4YOJA 3A80A 3TH2H 1W7XH 2FOFA 4Q7YA 2ZI2H 1EB1H 1NO9H 5EPNA 1UK3A 1UMAH 2SFAA 3BTME 2W81A 5JYIA 2G51A 1ZSLA 1AFEH 1O32A 3GCTG 1AMHA 1PYTC 2ZU2A 1P2KA 1UK4A 5ESBA 4ISNA 2A2XH 4TPYA 4I32A 1UVUH 4NSVA 4MNXA 1HAVA 1G2LA 4X6NA 4AFQA 1TPOA 2PV9B 2CXVA 1MZDA 2XBWA 1KY9A 1C2FA 2H9TH 1AO5A 4X8TH 4ZAEA 1J17T 1A5GH 1GBFA 1YPHE 2ZC9H 1DICA 1YPJH 1XVOA 1LKAA 1HB0B 5DP3A 1AZZA 5L2ZH 3SJKA 1G36A 1HDTH 2Z9JA 1DANH 2GZ7A 2LPRA 3MH6A 2GCTB 3GOVB 1GBBA 2BHGA 2RLQA 2ZP0H 3RXVA 4MNWA 3F9GA 2V6NA 2A31A 3S7KB 1P2MA 3UQVA 1ID5H 3U1JB 3K65B 4ZKNU 3FVFB 2AMQA 3RXSA 2QXGA 3V3MA 5JB8S 1CHOG 1CU1A 2XNIA 5JDUB 4FUJA 3L33A 3UY9A 3VB3A 2NU0E 6GCHF 1DE7H 2RA3A 2A5IA 2WPMS 3MO9A 2FOGA 3ODDA 4LK4A 1UVSH 2ZFPH 3D49H 1NN6A 1BT7A 3SI4H 2ZU3A 4DURA 4JZDH 5A8ZA 1UVPA 1W8BH 3DA9B 2XBYA 1PPZA 4GCHF 1V2MT 1D3DB 2UUJB 1PPGE 2BVSH 4PROA 1GMDG 2TBSA 4MG3A 3B23B 1OYTH 1A46H 2EEKA 2PUQH 3ZZ9A 2P16A 3M7UA 2QIQA 4I8HA 1GBEA 4IBLH 2BLWA 4ISOA 2PUXB 3ATLA 4I33A 2WYGA 2ZG0H 3KGPA 1VVDA 3PWCA 1C5UA 1HNEE 1YPLH 3VB6A 3QTOH 4AX9H 1MD8A 3PV4A 1V2WT 3TU7H 1QJ6B 1O5GH 4X8UH 5LPEA 4ZKSU 1HCCA 3ITIA 1PPBH 1SG8B 2GV7A 1SHYA 4X6PA 3VB4A 3CP7A 1AU8A 1C4V2 3MFJA 1YF4A 4X2YA 3M3VA 2ZHEH 2PGQB 2EI6A 5A2MH 1Z92B 1VVCA 4MVNA 1YPMH 1FNIA 3SN8A 5I0QB 2HALA 2ZWLH 3JZ1B 4WF8A 1B0EA 1GL0E 4ABJA 4NIYA 2FESH 1JIRA 1SI5H 1O2SA 5DO4H 1O3NA 1VITG 1QJ7B 5DG6A 1S85A 2ZFTA 5JPMG 4JYTA 3GY5A 2ZHFH 1DDJA 3GCTF 4UE7H 2FP7B 2VWLA 1OK1A 1OXGA 2ZFFH 4UD9H 1H1BA 5F8XA 4H42U 3TGKE 1LTOA 3I78A 4CBOA 1W14U 4CHAB 1EAXA 1C1UH 3M61U 3GCOA 1C5XB 5B6OA 1Z8JB 4B71A 3PO1C 1ZPZA 4BNRA 1Z71A 1TQ0B 1HIAB 2H5CA 1QL9A 1UO6A 3RMNH 4NWKA 4BXWA 1BQYA 5C67A 2OQUA 1TGSZ 1OWJA 1BJUA 1KLIH 1ZJKA 1ZSKA 2OTVA 1P04A 3VEQB 3PMBB 2BLOA 2FPZA 3UQOA 3VXFH 3FZDA 2F9PA 1NRPH 1DS2E 1BJVA 2C4FH 3P8OA 3RLYH 3SHCH 2J94A 3SJOA 2FTMA 2ZCLP 2Y7ZA 1CHOF 5FCRA 2ZFQH 2Z6BD 1C4Y2 3O8DA 4QT8C 1CHGA 2FIRH 4XOJA 1OJVA 1LY2A 3SOSA 3RXCA 1ANDA 5C2ZA 1BTUA 1S0RA 1WUNH 4WWYA 4D7GA 1BMAA 4AFUA 4J2YB 3OTJE 4TWWA 1O2UA 1LHDH 1ZPBA 2OD3B 1ELFA 1A5IA 1QGFA 5C20A 2P95A 4R8TB 3SV6A 1KDQB 1GMHG 1Z6EA 2TPIZ 1IQMA 1ELEE 1GMDF 1H04P 3U9AH 2HLCA 4ABAA 1TNKA 1UVOA 2YOLA 4OS6A 1O35A 2JRAA 2A4RA 2HOBA 3R3GB 2TRMA 4F4OC 3TK9A 3VB5A 3DD2H 3UR9A 3OP8A 3M7TA 1OWHA 3DFLA 4PZ5A 1AWHB 3OX7U 3V7TA 3ATMA 4B76A 2FOHA 5C5NA 4GUXA 4MPVA 2EA3A 2PW8H 3LGYA 1GBHA 2PWXA 5IYTA 1W7GH 4A1TA 4RKOB 2VVCA 4CRBA 1WSSH 1J15A 1ELAA 1ACBE 1FJSA 2VWMA 1FN8A 1P2NA 1CA8B 1LHEH 4JYVH 1A0HB 1SC8U 2G55A 1GJAB 4K12A 2VIOA 3BTWE 1NFUA 1C5LH 3RUOA 1VITF 1EJAA 3NWUA 4ABDA 1FIWA 2ZPSA 4Y8YA 4ASHA 1DSTA 2Z3CA 3NPSA 1ELTA 2UUFB 2EI8A 1EP6A 4DW2U 1SGYE 4GPGA 1O2ZA 3LGTA 4YOGA 4ZHLU 1VITH 3RMOH 2ANMH 3O8BA 1O36A 2VU8E 3WY8A 1LPGB 2GMTC 3PMAB 3TGJE 5JPMH 4H6SB 2Y5FA 3MNCA 4I8LA 3UFAA 2FYQA 2O9QA 3RXBA 4GVUA 2B0FA 3E0PB 2FOEA 1FXYA 4Y10E 1C1QA 4K8YA 2ILNA 1EB2A 1ZSJA 2Y6TA 5JBBS 4B73A 1TMUH 1ARCA 4B2CA 1FAXA 1DPOA 5T3HA 1GGDC 1HFDA 3SU5A 3P6ZB 4JK5A 3H7OA 3RC4A 3D62A 2STAE 1E0FD 4UEHH 1TPPA 5LPRA 2HNTE 2GT7A 2UUKB 1ZLRA 2ESTE 1GDQA 2ULLA 3U1IB 1HJAC 1UCYH 4TYDA 1BCUH 1UVTH 2OLGA 2B5ID 1D3QB 1L4ZA 1VJAU 1C2KA 3NUMA 1GHYH 1QURH 2G52A 2ZF0H 2QXJA 9ESTA 2VIVA 4OS1A 1Y3WA 1O38A 1LQEA 1P9UA 2BY8X 3CENA 1PQ7A 1O2MA 2AFQB 3VFEA 1V2KT 2PLXA 1GMHF 3BN9A 3MO3A 1F5KU 4JCNA 1Z8GA 4GAWA 1C5SA 1BMNH 3S9CA 4M7GA 1DUAA 1O0DH 2XC0A 3OU0A 5GDSH 1GI9B 5EQRA 2A4GA 2THFB 1TGTA 2CMYA 1TMTH 2AGIX 1EPTA 8LPRA 2ZPRA 1N6YA 1SVPA 1CO7E 3FP6E 1K1LA 2JKHA 4D9QA 1HV7A 2Q6FA 2ZU4A 3MI4A 2RG3A 2XRBA 3LGWA 1ESTA 5EG4A 1O3GA 3K9XB 1GJ9B 2BM2A 1JMOH 1MQ6A 2GCHG 1LO6A 1HJ8A 2FS9A 3TGIE 3PO1B 3PTBA 4JYUH 3E90B 3ZV9A 1V3XA 1XMNB 1C2DA 5FCKA 5DKMA 2J4IA 3SI3H 2XWJI 1V2NT 4I8JA 1ZTKA 4H4FA 1C5WB 1TONA 2SGQE 3QTVH 1W3CA 1N8OC 1THPB 3BIUH 1TAWA 3URCA 4B2RA 2OC1A 2HNTF 1BUIA 2FX6A 1N1LA 2KAIA 5BPEA 1RRKA 2AERH 5EODA 4FUIA 1YLDA 1GI8B 1P2IA 1O3FA 1YM0A 1S84A 1G32B 3T28A 1DWEH 1TX7A 5E8EH 2Z9LA 1TQ7B 4YNXA 1XUIA 1BITA 4CRGA 1WOFA 1HAPH 4IMZA 1CT2E 1ZHPA 1QB1A 2ZFRH 4Q7ZA 1HAGE 1PPHE 3SUGA 2WPIS 1C2EA 3MTYA 1SLWB 1HAHH 1NFXA 1QRWA 1SGIB 1S0QA 1MBMA 1O2WA 4RSPA 2ASUB 3F6UH 1AUTC 4JZIA 1TGNA 1FY8E 5HXFA 1GVLA 3L89M 1RXPA 2ZCHP 3IITA 1TX6A 1XUGA 1H03P 2OBOA 1QY6A 3LIWA 2C8ZB 3BTKE 4AZ2B 3UTUH 4HTCH 1AD8H 3GY2A 4K3JA 3T5FH 4BTTB 4AG2A 1WTGH 2D2DA 5FO8C 2G00A 4O3UA 1O3AA 1CBWC 1ZOMA 2F3CE 4VGCC 1U5MA 1GBAA 2BQ7B 2Z3EA 1ANCA 3ZRZA 1MTVA 1SGNE 1YPEH 1SGFG 4MNVA 1C1SA 5HGGA 3A87A 2JETC 2FEQH 2R0KA 3QN7A 3QLPH 1EAIA 1O2RA 2FS8A 1HGTH 1Y5AT 4H6TA 4DIHH 1FBRA 4O97A 1C9PA 1EJNA 3P17H 4AYDA 1CVWH 3ERBA 2XCNA 1MU8B 1HLTH 1C2MA 3DUXH 4A1VA 1HYLA 1EXFA 1O2LA 1C1NA 2J95A 4K2YA 3TJUA 1PJPA 2GV6A 1GJDB 3TITA 3V13A 3UREA 1NRQH 1V2VT 2G5NA 2ZECA 1D6WA 2AGGX 3RXJA 1ELBA 4FXGG 1TIOA 1PPEE 2BD4A 3ZVFA 3QWCH 4X0WU 2YRAA 2HPPH 4CHAC 2VIDA 1O3OA 2ZEBA 1EZQA 2XBVA 1T8MA 3ZYEA 1B0FA 1GCTC 2GMTB 1QHRB 2QV1A 2A7JA 2AIQA 2G5VA 3A85A 1A61H 3M3SA 5E0JA 2PGBB 3G01A 5DJ7A 5L6NH 1UCYK 1AB9C 1ZRBA 1KXCA 1L1GA 1H2QP 3ZZDA 3FP8E 3OXUD 2QY0A 3IWMA 3EE0B 1SQAA 1ETSH 1TPNA 3OEDC 3BV9B 1BHXF 1SR5C 1PYTD 4JK6A 1UJ1A 1GGDB 1T8NA 1NRSH 4CR9A 1GBLA 3C1KA 3EYDA 4X1PU 1DLEA 4NSYA 2BDAA 4FU8A 2V8EA 1C1WH 4XE4A 1GHQB 3A7XA 3L6PA 2F83A 5HZPB 1AI8H 1HAOH 1K28D 2QAAA 1EAUA 3MU0A 5CE1A 3C27B 1SOTA 3LGIA 1QUBA 1Y3UA 2W7SA 5DP4A 1FLEE 6CHAC 3SU3A 1F5LA 3KHVA 3E3TA 2P8OB 3LONA 1Q2WA 1W0ZU 5IDKA 2AMDA 4INLA 2O8LA 5DP8A 8KME2 3FAOA 1WQSA 1UHBA 3BTHE 2BTCE 1EATA 1C1ZA 2OC7A 5J4QA 1CKLA 2WYJA 1L1NA 1UTQA 2QA9E 2ZTXA 1KXEA 4UFGH 3T29A 1DY8A 3Q3XA 1MU6B 2FYRA 1C5YB 4NIWA 4AFSA 2SGEE 5K0HA 4YO9A 1IQFA 1BRCE 1UTJA 1CGIE 1QCPA 2IPHA 1FUJA 3ZZ6A 4WMFA 3A89A 1P03A 1MCTA 2ZNKH 1CGHA 4X1SU 2EI7A 3SQEE 4YT7H 2D1JA 4K1EA 4FUEA 1O2OA 3RXMA 1GHVH 1BTXA 2ZFSA 1M9UA 1YGCH 2BQWB 3A7VA 1VJ9U 7ESTE 4C16A 4A5TS 1QFKH 2HRVA 2WV4A 4KELA 1N8OB 1QBOA 1KTTB 4I8GA 2RLPA 4CRCA 3Q76A 1QR3E 2BD7A 2AYWA 3CS0A 5TCCA 1QIXB 5EXMA 1TOCB 2A55A 2IZ3A 2H5DA 3KZJA 1NFYA 1KXAA 2Z9KA 3SU6A 1WU1A 3LH1A 1A1RA 1LVYA 1D6RA 1C5RA 3SNBA 4NA9H 1ORFA 1V2LT 4OS5A 3P8FA 4FXGH 5EOKA 1PQ8A 2A4QA 2UUYA 3H5CB 4XSKU 2AH4X 1O3PB 3Q77A 2BOHB 3GY3A 1RIWC 2Z94A 2A7CA 2ZA5A 2ZTYA 1CT0E 1TPMA 1VCQA 3MMGA 3ZV8A 2H2ZA 3QGJA 1MD7A 3LGVA 1TFXA 1BHXB 3KCGH 1G2MA 1QTFA 2CHAC 2VJ1A 2ZDAH 4UFDH 1O9AA 3MWIU 5FXLA 1LPZB 1OWIA 2GDDA 4X1RU 1GPZA 3U98H 1TMBH 4YT6H 3RXUA 3RMMH 3SGAE 2BD3A 2OC8A 2WV5A 4GLYA 3PTNA 1CBWB 1E88A 4VGCB 3BTDE 3KQBA 2BDIA 1GDNA 1O3DA 9LPRA 1ELVA 4LXBH 3RDZA 5EQQA 1LPKB 2ODPA 5F8ZA 1YYY1 4YLUA 2JETB 1PQAA 4NCYA 1HAXB 3T27A 3KNXA 1RFNA 2J2UA 1SL3A 3U8OH 1KYNA 1Y3YA 2H1UA 3A82A 3LC3A 1DOJA 1GJ7B 3MNXA 3D65E 1NT1A 1ELDE 2ANKH 1ELGA 1EQ9A 1SMFE 3M7PA 2PKAA 3MU8A 3RM2H 3RXTA 2W7UA 1BTPA 1YKTA 2ZGXH 3RM0H 3UOPA 1TWXB 2QF0A 4NFFA 3GXEA 4Y76A 1CGJE 1GCTB 1UOTP 3MOCA 3MH5A 4MPWA 1K22H 1G30B 4B74A 3SUFA 3UNSA 1BB0B 1P06A 1OJYA 1DT2A 3UNRA 1BTYA 2GX4A 1NRRH 4BAQB 2Y80A 1AB9B 2GZ9A 1SGPE 1T7CA 1D3PB 5AFYH 1TGBA 2CF8H 1SOZA 3EA9A 4OS2A 4AYVB 1P2OA 2AGEX 2F9OA 3PROA 4XBBA 4XBCA 5AHGH 2ZU1A 3RU4T 2Y81A 5ETXA 1G3CA 2FM2A 2RDLA 1P11E 3S7HB 4NFEA 3QDZB 2PSYA 1IQGA 1OP8A 1ZHMA 1BBRE 1MAYA 3M7QA 1H8IH 1ETTH 1GKGA 4AOQA 2BVXH 3RXIA 1GI1A 1P05A 2FX4A 6CHAB 1O37A 1GWAA 1ZYOA 2WPJS 1AHTH 3K6YA 1J16A 3LU9B 2YBYA 5I25A 3E8LA 1F5RA 1CSOE 4GHTA 4AORA 1UCYE 2SGPE 1A4WH 1GBKA 1QL7A 3RU4D 1CE5A 2BY6X 1HXFH 1IAUA 1OK9A 1KXDA 1F92A 5EXNA 4SGBE 3I77A 3U8TH 5AFZH 1FY1A 4YTAA 6ESTA 3LDXH 1QQUA 3BEUA 1DVAH 5GJ4B 2BB4A 2EHFA 1AWFH 2KAIB 2JH0D 5E2PA 2F91A 3U8RH 4CH8B 2EC3A 3T5OA 2ZDVH 3RMLH 2C8YB 3GOVA 3A8DA 4DJZA 2J9NA 1YC0A 1P2QA 1K1OA 1ZRKA 5EU8A 1XKAC 1EZXC 1O2TA 2XRCA 1P01A 3BG8A 1A0LA 1T8LA 2RL0A 1P12E 2C90B 2B7DH 2P3TB 1GJ6A 2I6QA 3ATWA 4DY7B 2BY5X 2ZDNA 2FZZA 1D9IA 3ZVBA 4U32A 3RU4E 5F6MA 3EAJA 3UIRA 3A88A 3FP7E 2ZU5A 4KTSA 2GVFA 2ZDLA 3ELAH 1AY6H 3ZVAA 1GJBB 2RCEA 3Q3YA 1MKXH 4INHA 1WYKA 3TJNA 2O8TA 1C1MA 5TCAA 3F9FA 2BY7X 4JHSA 1VCWA 3S9BA 1UTKA 4X6MA 5ESTE 4BANB 1HAYB 2XBXA 3ZZ8A 3HGPA 4X1NU 1F7ZA 4Q7XA 3AW0A 1SHHB 3SW2B 1ZTLA 2H6MA 3TVJB 4BAOB 2BDBA 2ZGCA 2A45B 3LGUA 3OY6U 5CHAC 3KQCA 1O5FH 4I8KA 1RIWB 1P2JA 1KXBA 2P93A 3PWBA 1W2KH 2NU3E 4BOHA 3PLBA 3OYPA 3FZZA 1VCPA 2DUCA 1L2EA 1LHFH 2RA0A 1ZTJA 2P3FH 2YNAA 4K8BA 1TRMA 1IQHA 1O3MA 1C1VH 5I46H 2CHAB 2MCYA 1TPAE 4FVDA 1DM4B 1AE8H 2Q1JA 1YBWA 4OGYA 1SPJA 4GHQA 4E7RG 1U6QA 2AIPA 4O9VA 4UFEH 4LOSA 3AAVA 5LGOA 3SV9A 4LOYH 2VB0A 1FONA 5A8YA 4AN7A 1DITH 3BF6H 3SHAH 2XWAA 1C5PA 2P8OC 1GI6A 5E0HA 2FWWA 4FUDA 4CRFA 1AIXH 2CG6A 1GJCB 1YCPH 1P9SA 3H7TA 4A1XA 1O2HA 4Z0KA 3D23A 2SNWA 2HVXA 2QY0B 3RXQA 3ZZ4A 3QZQA 1WCZA 1EJMA 4LZ4B 4A5WB 2SGFE 2CV3A 1W13U 4Y8ZA 2PHBA 1AN1E 2SNVA 3UWJH 4CRAA 2RKZA 1SLUB 1TOMH 1TX8A 1MTNC 3MU1A 3V0XA 2ZZUH 1T4VH 2GZ8A 4B1TA 1CA0C 2BDHA 2FDAA 4IN1A 4AB9A 4B75A 4OS4A 3HKJB 4CBNA 4XFQA 2ALVA 1UTPA 4ZHMU 1L4DA 4LZ1H 3LJJA 4O3TA 2F9UA 1AVWA 4JZEH 5EGMA 2XC4A 3SU2A 1X7AC 1ETRH 2GDEH 2GT8A 3E0NB 1OK3A 1TLDA 1GL1A 1A2CH 1XUKA 1XXDA 3VB7A 4Z6AH 2ZGJA 1L1JA 4ONTD 2B5TB 1OOKB 1GHXH 3TJVA 4DGJA 1O5DH 2VH6A 4WH6A 1UHBB 3GDSA 1QJ1B 3SQHE 2VNTA 3URDA 1TBQH 2WINI 3FFGA 1C1TA 1EKBB 1C2JA 3S0NA 3ZYDA 4FVBA 1HBTH 3QX5H 1BIOA 3ZZ5A 1HAVB 1T31A
chains in the Genus database with same CATH superfamily
2RFKC 4ZXYH 1O3BA 2UWPA 3ZZAA 1KDQA 1TA2A 2A7HA 4RKJB 3UB0A 7LPRA 3BEFB 2ZGBH 5DPAA 1PPQA 1BRUP 1OWDA 1GBTA 2WUCA 1VR1H 1ZPCA 1GKNA 2VH0A 3SNCA 2CJIA 1O2NA 1Q31A 4DVAU 2A32A 4I31A 1PPCE 3QGNB 4KP0A 2JGWA 2AS9A 2OUAA 4ABIA 3RXKA 2OBQA 4A92A 2R2MB 1AZ8A 5TJXA 1H2PP 3RLWH 2FI5E 4CRDA 4Y6DA 4BAHB 2BX3A 4INKA 2X2ZA 5C3NA 4KGAA 4ESTE 2YMSB 1LCYA 3STIA 1WDIA 4D8NA 1C5ZB 2BXTH 3QUMP 2PSXA 1Q3XA 1GHAG 1QBNA 5AF9H 1Y5UT 4WXVA 3F3BA 4YM9A 1F2SE 5GWZA 4B6EA 3KQDA 2TGAA 3L3TA 1J8AA 1C9TA 4HGCA 2F9VA 1GJ5H 1ANEA 1P0SH 3N7DA 1TABE 3V12A 4DOQA 3QK1A 4Y0ZE 5J4SA 1NWVA 2JIZD 3AVZA 5JBTA 2Z7FE 3KN2A 4XBDA 3TK6A 2BZMA 3PV5A 2NU1E 3E91A 1DXPA 1MKXK 1SS2A 1O2JA 2ALPA 1SKYE 3TK5A 3UOUA 2Z3DA 3ZZBA 3F0PA 2WV9A 1AFQC 4Y71A 4WXIA 3Q3KA 1FPCH 3ODFA 3OY5U 3GISB 1H8HD 1ZGIA 3NKKA 3LPRA 2XTTB 1HXEH 1B5GH 4ISIH 2IN2A 4Y7AA 3K2UA 2OP9A 1NTPA 1ABJH 4B2AA 2VVUA 1GDUA 4I86A 3UUZA 1P3CA 3RC5A 2BDCA 1UTOA 1H8DH 2GCHF 1O2KA 4WMDA 2FODA 1S82A 1GBCA 1GI0A 3MQLA 2YNBA 1NROH 2Y82A 2J5UA 1FPHH 3RXAA 4WMEA 1C1OA 2FTLE 2VWOA 1OX1A 4GSOA 4X8VH 3QZRA 2V3OH 1KIGH 1TBRH 5A09A 4JMYA 2WIIC 1D4PB 1NS3A 1EPTC 5EJZA 1DLKB 1FX0B 5CHAB 1C2LA 2BX4A 1YCPK 4UDWH 2NWNA 1ZZZA 3P8GA 3RP2A 4FUFA 3TH4H 4APLA 1W12U 4IC6A 1UW7A 1TE0A 1TYNA 4JZ1A 2G4TA 5A8XA 4ABHA 3ATIA 4NZLA 3MH4A 5EXLA 4TT3D 1V6DA 4FETA 4AYMA 2QF4A 2A5KA 5HYUB 3TIUA 6LPRA 3T62A 3TLOA 1XM1A 4D7FA 1LVOA 3LOXA 2C93B 4AYEA 2JH5D 3F9EA 2Z9GA 1OP2A 3M35A 3VPKA 2Z9IA 3EDXB 1TB6H 1DSUA 3KL6A 4Y7BA 4CREA 3ZLEA 1K1JA 4XDEA 1GVKB 3ZVDA 1EUFA 1Z1IA 2O8MA 1O2QA 1D3TB 2TIOA 2KMSA 5HM2A 1Y3VA 1Y8TA 5DSFA 1K1MA 1C2HA 1OPHB 3ZZ7A 3GCHB 4X2VA 1BTZA 2KCAA 3BTQE 2PKSC 1EASA 1XUFA 1Y59T 1GHAF 1IQLA 1C5OH 3MO6A 1SFQB 2ZTZA 2VIQA 1J14A 1MTNB 1DFPA 4M9FA 3FN8A 3ZZCA 2WPLS 1CA0B 2XC5A 2WUBA 3P70B 1G37A 4MPUA 2TGDA 2BLQA 4R0IA 7GCHG 1GI2A 3TH3H 2V7QD 5DP6A 1FN6A 3SV8A 1C5VA 1JBUH 3VGCC 1AVGH 2QF3A 2NU2E 3H09A 1Z1JA 3SNAA 5DGJA 1XUHA 3RXGA 3BTTE 4X2WA 2RKYA 3E16B 1SBWA 3GY4A 3T2NA 1H9HE 1TRYA 3GICB 3EA7A 1YCPM 2FMJA 1AKSA 1FQ3A 2BD9A 4SGAE 1GBJA 3FGRA 1C5QA 1FV9A 2P59A 2A0QB 1T8OA 2HPQH 1GI5A 1F0SA 2XCFA 3U69H 1NU7B 3T25A 2BZ6H 2I6SA 1YPHC 1RTLA 2O39C 2IOTA 5BRRE 1T32A 1K0HA 1OYQA 2UWNA 1A0JA 3M37A 4YOIA 1O31A 1ANBA 2BYAX 3ATKA 1QA0A 3A84A 2R2WU 1GMCG 1LQDB 1WBGB 4NIVA 1WAYB 2NU4E 4DJZB 4BAKB 1LVBA 1E38B 1KXFA 1K1PA 2OC0A 1J9CH 2ZO3H 4AYYB 2C3SA 3GY8A 2QGRA 1V2ST 3ZVEA 1K9OE 1QA7A 5GCHG 1NESE 2AEIH 2FOBA 2ZPQA 5T6DA 4X8SH 1LHGH 5AVDA 1G3EA 1GJ4H 1O3IA 2R3YA 1OK2A 1QRZA 1O2VA 1O2IA 2G8TA 2ZDMA 4NG9H 1PQ5A 1HJ9A 1DWCH 3NZIA 2C8WB 4HZHA 2Y8TA 3EA8A 1S6LA 3VWOA 1C5MD 1E5GA 2TGPZ 3MHWU 3A7YA 3M36A 3BG4C 3STJA 3SORA 4YZUA 1MQ5A 1LKBA 2BXUH 1EP5A 1S6HA 4WH8A 2XXLA 3PMHB 3O8CA 2KRIA 2ZGHA 1XVMA 1K1IA 1VGCC 3OFND 1BZXE 4IN2A 3JZ2B 3N7EA 2CF9H 3UR6A 1ZJDA 3S9AA 4DT7B 4ABFA 1BTHH 4ACAA 3ZVGA 1AFQB 5HM9A 1SLVB 3M5NA 1O5BB 3B8JA 1TNGA 4F49A 2R3UA 3RXOA 3WSXA 1NZQH 2LNCA 1TNIA 3LT3A 4DG4A 2WPHS 4NA8A 4WY3A 4FUCA 3LH3A 7GCHF 3NK8A 5FAHA 1HFHA 1ESAA 2VWNA 1IQEA 4ZHAA 5GPIB 3LKWA 3NCLA 3ZD2A 1VZQH 1SFIA 3EE7A 3UWIA 3RC6A 1ARBA 1OKXA 2O8WA 4DIIH 1QNJA 1GHBG 1DX5M 1O3KA 1OWKA 5E0GA 3INBC 3PLKA 4MDSA 1FY5A 4Q2KA 1IQKA 5CDFE 1PPFE 3RXDA 3SV2H 2R9PA 2XQWC 4DCDA 1AGJA 1IOEA 1XUJA 2V35A 1JOUB 1EPTB 3SO3A 3W94A 1QB9A 4A7IB 2BZAA 2ANYA 1H4WA 3RXPA 3F9HA 1QB6A 3NXPA 1G4GA 3AW1A 3TPIZ 4OS7A 1LVMA 1DY9A 1S6FA 2K1QA 2Y5HA 3HGNA 1MMJN 5JBCS 1GG6C 1SGRE 1O3HA 3BTFE 3UNQA 1MAXA 5GIBA 1ZMLA 3MYWA 1S81A 2F9NA 5PTPA 1DWBH 1GMCF 2C8XB 1C1RA 3MH7A 4ZH8A 4NGAH 1AQ7A 2ZQ2A 1GBDA 1Z8RA 3GDVA 4Q80A 4ZROA 5ABWA 4U2WA 2FXRA 1H9LB 1NY22 1RTFB 4IMQA 1ABIH 5GCHF 1BMMH 1LHCH 5A0BA 1OP0A 1O30A 2VINA 1V2UT 1W0YH 5A0AE 1XXFA 1G3DA 1B7XB 1A7SA 3A7WA 1BA8B 3DSGA 5C1YA 3NFPI 1P02A 1E35B 2K0QA 2PKSB 2ZHQH 3M5LA 3TNSA 1GCDA 2QE7D 3BSQA 1GVZA 3M5OA 1YWUA 2XOKD 2W5EA 2PTNA 1N6XA 1ZR0A 2ZHWH 5H4IB 3RXRA 2QXHA 5EJLA 1QRXA 1MH0A 4K1SA 2BDGA 2VGCC 1LMWB 1EOJA 4TSFD 2OXSA 2P94A 3OTPA 1F0RA 4K69A 2ZHDA 4YESB 3Q00A 2BMGB 2VIPA 2GTBA 4MLFB 5CMXH 2ZKSA 3T26A 3PYHA 2BY9X 8GCHG 3VGCB 3GYMA 1MKWH 4TWYA 1NPMA 3S69A 1FY3A 1IHSH 3B9FH 1NC6A 1W10U 4HI3A 4MPXA 5G4BA 3UPEA 4Y0YE 1GHWH 4MUCA 1INCA 2G81E 4ZKRU 2G4UA 3IX0A 2OINA 1BRAA 3EJHA 2BD2A 1QO6A 2FI3E 1K2I1 3SNDA 5F03A 1BOQA 2EY4C 1A3BH 8ESTE 2V3HH 5C1UA 1V2QT 1IQJA 3A81A 2ANWA 3ESTA 3KF2A 4AB8A 4BAMB 1FAKH 1SQTA 2QXIA 1TGCA 4ABBA 1O33A 2D26C 4Y11E 3SZNA 2ODQA 4U30A 1CQQA 3PV2A 1Y5BT 5HMAA 3E1XB 4A6LA 2CGAA 4IGDA 4J1YA 1JRTA 2M2AA 1IQIA 2BLVA 2V0BA 3BIVH 1GHBF 2R0LA 5EQSA 2W6JD 2G7IA 7KMEH 2SGAA 3HK3B 4AG1A 4UFFH 1O5EH 3ZVCA 3MNSA 5FHTA 2F9BH 1MZAA 5GXPA 2KFWA 2DE8A 3GYLB 5DP5A 2XRDA 1WQVH 1SRZA 1SGQE 2FOCA 2A1DB 1UTLM 2BD8A 3AAUA 4X6OA 5LPFA 3KEEA 1MTWA 3DCLA 2B9LA 3ZD1A 3RJ3D 5A0CA 2AMPA 1A5HA 2JH6D 2Q6GA 3SGBE 4CH2B 1ZHRA 1SGCA 3HPTB 1HCGA 3CALA 3FGTA 4K1TA 4KTUA 4ZUHA 2OQ5A 1BTWA 2VIWA 1BBRH 2W3KA 1C5NH 3GY7A 5DK1A 3BG4B 4MTBA 2IZ4A 2HVYB 1O2XA 5FX5A 3ZLDA 1ESBA 1MBQA 2Y5GA 4N7EA 1XKBC 1QZ8A 4Y79A 1TNHA 2BQ6B 1FI8A 4ZH1D 1FDPA 1O3JA 2J38A 1ELCA 3A7ZA 4MQAA 3M5MA 1V2PT 1VGCB 1V2JT 2WSSD 3PMJA 1GBMA 1MCVA 2HNTC 5T6GA 3R62A 2UWLA 1RLHA 2IJOB 3GCHC 4WVPE 2W3IA 4ZXXH 4X1QU 3HK6B 4THNH 3RXLA 4KTCA 5E2OA 5C5OA 4I7YH 1XX9A 1EX3A 3IU3I 1HIAA 1P8VC 3E6PH 4E7NA 3SJ8A 1Y3XA 1C2GA 1RJXB 4F48B 1SGEE 2J98A 1SGFA 1Z6JH 2FO9A 3A86A 1K21H 5JBAS 1Z8IB 5FBIA 2ERJA 1HUTH 3VXEH 1RD3B 3RXEA 3SJIA 2V3MA 4IS5A 1EOLA 4NWLA 4Z1MD 1HPGA 2QN5T 4ISHH 2O8UA 4MNYA 8GCHF 4YLQH 3SUDA 2OCVB 1KTSB 2XWBI 1OJWA 2HWLB 1UK2A 2GKVE 4E06H 2GGVB 3SUEA 3GCNA 1FMGA 2UWOA 1DXWA 1IHTH 4ABGA 1TRNA 3RXHA 3SV7A 4BTIB 1SGTA 4AFZA 1JIMA 1TPSA 1C4U2 2FI4E 3LJOA 1RGQA 4WJG2 1C2IA 3N7OA 3P92A 4B2BA 2XWBF 3PM3A 2SGDE 5T6FA 2W26A 1ZMJA 1AE5A 2CG7A 1QQ4A 2QC2A 1GG6B 1GI3A 4TY7A 2CKUA 2WPKS 2PR3A 5FPTA 2GCTC 5FBEA 2J34A 5FPYA 3SU0A 3W1EA 4NA7A 3ENSB 4FU7A 2CN0H 1NRNH 1O5CB 1S83A 3K6ZA 4LOTA 4CR5A 1JXPA 2ODYB 2HGTH 1JRSA 2ZIQH 4IC5A 2QCYA 4RN6A 1GBIA 1NU9A 3BEIB 4XRNA 1EZSC 1O2GH 5DP7A 2BD5A 1MTUA 1AKSB 2ZDKA 2XW9A 2PTCE 3DT0H 3I29A 2J92A 3DFJA 1NBME 1MKWK 1TNLA 2TGTA 3ZZ3A 2JGXA 2H9HA 3TJOA 1DWDH 3F1SB 3AASA 5EW1H 5FX6A 3CS7A 4Y8XA 2FLRH 1G9IE 2M5TA 3PB1E 1BRBE 1O34A 1OSSA 1YPGH 1E36B 1HAIH 1K1NA 4ZKOU 1SB1H 4FUHA 2A4OA 1TALA 1O2YA 5DP9A 5L30H 2VGCB 4JZFH 4TPIZ 2FLBH 1NM6A 2BDYA 2GP9B 5EPYA 3SGQE 3RXFA 4IW4E 2Y8RA 1EZUC 1P57B 4BTUB 1EAWA 3IG6B 3K3TA 1GI7B 1IQNA 2Y7XA 4O03A 4Q4LA 5JB9S 3KXVA 2QYIA 2FOMB 3BTGE 1O3LA 4X2XA 1HAZB 1SSXA 2EC9H 4NZQA 1O5AB 4KKDA 1KLTA 1TBZH 1P09A 3QO6A 1HFIA 3DHKH 5C1XA 1NFWA 3A83A 1FIZA 1H9IE 2P3UB 5L2YH 1GJ8B 1O39A 4TY6A 1T4UH 1BMLA 5F8TA 3BTEE 1UTMA 3R0FA 1QL8A 1PFXC 1ZGVA 1V2OT 1THSH 4K60A 1FZZA 2J97A 4FU9A 4OGXA 3KIDU 3TVJA 4B2SA 3P95A 1O3EA 2XYAA 1YP9A 2W80A 2MCZA 1OWEA 1P10A 2D8WA 1P3EA 5FPSA 1GHZA 1KLJH 5K7RA 1SGDE 2DE9A 3GY6A 3FKSD 1SQOA 3CNRA 1OS8A 3MU4A 2FOAA 1TPGA 1E37B 4ABEA 1O2PA 4FUGA 2LELA 1THRH 2STBE 1BBRK 2LOJA 3MU5A 2A5AA 1GI4A 1SLXB 4NIXA 3W95A 1A3EH 2ZQ1A 1L0ZA 4J38B 1JWTA 1MUEB 3P8NA 4UONA 6GCHG 1E8BA 3OEHD 1QGBA 5HYOA 5HIYA 2Q6DA 2A2QH 4AYIA 3MNBA 3PRBA 4FUBA 5EW2H 1DUEA 1Z7KA 1KSNA 3SU1A 3EQ0H 2PKAB 3TNTA 3O8RA 4GCHG 4OM9A 4U01A 4CSYA 2GD4B 3KQEA 5SGAE 1F0TA 1YLCA 5HYPA 1QBVH 3EGKH 4K5ZA 4HFPB 4BXSA 3A7TA 5LH8A 1G3BA 4D9RA 1TNJA 2H9EH 1W11U 1ZMNA 4AGJA 1V2TT 3OSYA 4MSLA 1RTKA 1V2RT 3A8AA 1WV7H 1C1PA 1RS0A 3A8CA 4RT0A 3HATH 1G4FA 2BOKA 3F68H 3SNEA 2PFEA 3SU4A 1FY4A 3HKIB 1C5TA 1MTSA 1WTHD 3O8EB 1AUJA 1F0UA 3PLPA 1HJAB 2B8OH 3A8BA 3SJ9A 4ISLA 1E34B 1O3CA 1UTNA 3M3TA 1S5SA 4AGKA 1AVXA 4ZMAH 4E05H 3SW0X 3FANA 5HYTB 1TA6A 1BDAA 3GDUA 2BVRH 1YPKH 2GJGA 2ZCKP 1LDTT 1HRTH 4D76A 3LC5A 3SBKA 1H8ED 1CT4E 2VVVA 4YOJA 3A80A 3TH2H 1W7XH 2FOFA 4Q7YA 2ZI2H 1EB1H 1NO9H 5EPNA 1UK3A 1UMAH 2SFAA 3BTME 2W81A 5JYIA 2G51A 1ZSLA 1AFEH 1O32A 3GCTG 1AMHA 3SYJA 1PYTC 2ZU2A 1P2KA 1UK4A 5ESBA 4ISNA 3GS9A 2A2XH 4TPYA 4I32A 1UVUH 4NSVA 4MNXA 1HAVA 1G2LA 4X6NA 2VBCA 4AFQA 3PRDA 1TPOA 5DN4A 2PV9B 2CXVA 1MZDA 5DN5A 2XBWA 1KY9A 1C2FA 2H9TH 1AO5A 4X8TH 5F53A 3DSOA 4ZAEA 2I2LA 1J17T 1A5GH 1GBFA 1YPHE 5KEDA 2ZC9H 1DICA 1YPJH 1XVOA 1LKAA 1HB0B 5DP3A 1AZZA 4YXWD 5L2ZH 3SJKA 5T1VA 1G36A 1HDTH 2Z9JA 1DANH 2GZ7A 2LPRA 3MH6A 2GCTB 3GOVB 1GBBA 2BHGA 2RLQA 2ZP0H 3RXVA 4MNWA 3F9GA 2V6NA 2A31A 3S7KB 1P2MA 3UQVA 1ID5H 3U1JB 2L74A 3K65B 4ZKNU 3FVFB 2AMQA 3RXSA 2QXGA 3V3MA 5JB8S 1CHOG 1CU1A 2XNIA 2JJ1D 5JDUB 4FUJA 3L33A 3UY9A 3VB3A 2NU0E 6GCHF 1DE7H 2RA3A 2A5IA 2WPMS 3MO9A 2FOGA 3ODDA 2F4LA 4LK4A 1UVSH 2ZFPH 3D49H 1NN6A 1BT7A 3SI4H 2ZU3A 4DURA 4JZDH 5A8ZA 1UVPA 1W8BH 3DA9B 2XBYA 1PPZA 4GCHF 1V2MT 1D3DB 2KCOA 2UUJB 1PPGE 4PO7A 2BVSH 4PROA 1GMDG 2TBSA 4MG3A 3B23B 1OYTH 1A46H 2EEKA 2PUQH 3ZZ9A 2P16A 3M7UA 2QIQA 4I8HA 1GBEA 4IBLH 2BLWA 4ISOA 2PUXB 3ATLA 4I33A 2WYGA 2ZG0H 3KGPA 1VVDA 3PWCA 1C5UA 1HNEE 1YPLH 3VB6A 3QTOH 4AX9H 1MD8A 3PV4A 1V2WT 3TU7H 1QJ6B 1O5GH 4X8UH 5LPEA 4ZKSU 1HCCA 5KGOA 3ITIA 1PPBH 1SG8B 2GV7A 1SHYA 4X6PA 3VB4A 3CP7A 1AU8A 1C4V2 3MFJA 1YF4A 4X2YA 3M3VA 2ZHEH 2PGQB 2EI6A 5A2MH 1Z92B 1E79D 1VVCA 4MVNA 1YPMH 1FNIA 3SN8A 3WWFA 5I0QB 2HALA 2ZWLH 3JZ1B 4WF8A 1B0EA 1GL0E 4ABJA 4NIYA 2FESH 1JIRA 1SI5H 1O2SA 5DO4H 2KX4A 1O3NA 1VITG 1QJ7B 5DG6A 1S85A 2ZFTA 5JPMG 4JYTA 3GY5A 2ZHFH 2EQNA 1DDJA 3GCTF 4UE7H 2FP7B 2VWLA 1OK1A 1OXGA 2ZFFH 4UD9H 1H1BA 5F8XA 4H42U 3TGKE 1LTOA 3I78A 4CBOA 1W14U 4CHAB 1EAXA 1C1UH 3M61U 3GCOA 1C5XB 5B6OA 1Z8JB 4B71A 3PO1C 1ZPZA 4BNRA 1Z71A 1TQ0B 1HIAB 2H5CA 1QL9A 1UO6A 3RMNH 4NWKA 4BXWA 1BQYA 5C67A 2OQUA 1TGSZ 1OWJA 1BJUA 1KLIH 4RI0A 1ZJKA 1ZSKA 2OTVA 1P04A 3VEQB 3PMBB 2BLOA 2FPZA 3UQOA 1MABB 3VXFH 3FZDA 2F9PA 1NRPH 1DS2E 1BJVA 2C4FH 3P8OA 3RLYH 4XD7D 3SHCH 2WHXA 2J94A 3SJOA 2FTMA 2ZCLP 2Y7ZA 1CHOF 5FCRA 2ZFQH 1COWD 1C4Y2 2Z6BD 3O8DA 4QT8C 1CHGA 2FIRH 4XOJA 1OJVA 1LY2A 3SOSA 3RXCA 1ANDA 5C2ZA 1BTUA 1S0RA 1WUNH 4WWYA 4D7GA 4F55A 3NJAA 1BMAA 5KECA 4AFUA 4J2YB 3OTJE 4TWWA 1O2UA 1LHDH 1ZPBA 2OD3B 1ELFA 1A5IA 1QGFA 5C20A 2P95A 4R8TB 3F0OA 3SV6A 1KDQB 1GMHG 1Z6EA 2TPIZ 1IQMA 1ELEE 1GMDF 1H04P 3U9AH 2HLCA 4ABAA 1TNKA 1UVOA 2YOLA 3ZIAD 4OS6A 2IPQX 1O35A 2JRAA 2A4RA 2HOBA 3R3GB 1OHHD 2TRMA 4F4OC 3TK9A 3VB5A 3DD2H 3UR9A 3OP8A 3M7TA 1OWHA 3DFLA 4PZ5A 1AWHB 3OX7U 3V7TA 3ATMA 4B76A 2FOHA 5C5NA 4GUXA 4MPVA 2EA3A 2PW8H 3LGYA 1GBHA 2PWXA 5IYTA 1W7GH 4A1TA 4RKOB 2VVCA 4CRBA 1WSSH 1J15A 1ELAA 1ACBE 1FJSA 2VWMA 1FN8A 1P2NA 1CA8B 1LHEH 4JYVH 1A0HB 1SC8U 2G55A 1GJAB 4K12A 2VIOA 3BTWE 1NFUA 1C5LH 3RUOA 1VITF 1EJAA 4RT1A 3NWUA 4ABDA 1FIWA 2ZPSA 4Y8YA 4ASHA 1DSTA 2Z3CA 3NPSA 1ELTA 2UUFB 2EI8A 1EP6A 4DW2U 1SGYE 4GPGA 1O2ZA 3LGTA 4YOGA 4ZHLU 1VITH 3RMOH 2ANMH 3O8BA 1O36A 2VU8E 3WY8A 1LPGB 2GMTC 3PMAB 3TGJE 5JPMH 4H6SB 2Y5FA 3MNCA 4I8LA 3UFAA 2FYQA 2HLDD 2O9QA 3RXBA 4GVUA 2B0FA 3E0PB 2FOEA 1FXYA 4Y10E 1C1QA 4K8YA 2ILNA 1EB2A 1ZSJA 2Y6TA 5JBBS 4B73A 1TMUH 1ARCA 4B2CA 1FAXA 1DPOA 5T3HA 1GGDC 1HFDA 3SU5A 1BMFD 4ASUD 3P6ZB 4JK5A 3H7OA 3RC4A 2IJD1 3D62A 2STAE 1E0FD 4UEHH 1TPPA 5LPRA 2HNTE 2GT7A 2UUKB 1ZLRA 2ESTE 1GDQA 2ULLA 3U1IB 1HJAC 1UCYH 4TYDA 1BCUH 1UVTH 2OLGA 2B5ID 4Q63A 1D3QB 1L4ZA 1VJAU 1C2KA 3NUMA 1GHYH 1QURH 2G52A 2XNDD 2QXJA 2ZF0H 2VIVA 9ESTA 2AHME 4OS1A 1Y3WA 1O38A 1LQEA 1P9UA 2BY8X 3CENA 1PQ7A 1O2MA 2AFQB 3VFEA 1V2KT 2PLXA 2WPDD 1GMHF 3BN9A 3MO3A 1F5KU 4JCNA 1Z8GA 4GAWA 1C5SA 1BMNH 3S9CA 4M7GA 1DUAA 1O0DH 2XC0A 3OU0A 5GDSH 1GI9B 5EQRA 2A4GA 2THFB 1TGTA 2CMYA 1TMTH 2AGIX 1EPTA 2OK5A 8LPRA 2ZPRA 1N6YA 1SVPA 1CO7E 3FP6E 1K1LA 2JKHA 4D9QA 1HV7A 2Q6FA 5HIZA 2ZU4A 3MI4A 2RG3A 2XRBA 3LGWA 1ESTA 5EG4A 1O3GA 3K9XB 1GJ9B 2BM2A 1JMOH 1MQ6A 2GCHG 1LO6A 3F2FA 1HJ8A 2FS9A 3TGIE 3PO1B 3PTBA 4JYUH 3E90B 3ZV9A 1V3XA 1XMNB 1C2DA 5FCKA 5DKMA 2J4IA 3SI3H 3VG8A 2XWJI 1V2NT 4I8JA 1ZTKA 4H4FA 1C5WB 5C0UA 1TONA 2SGQE 4ACBA 3QTVH 1W3CA 1N8OC 1THPB 2JDID 3BIUH 1TAWA 3OE7D 3URCA 4B2RA 2OC1A 2HNTF 1BUIA 4DT4A 2FX6A 1N1LA 2KAIA 5BPEA 1RRKA 2AERH 5EODA 4FUIA 1YLDA 1GI8B 1P2IA 1O3FA 1YM0A 1S84A 1G32B 3T28A 1DWEH 1TX7A 5E8EH 2Z9LA 1TQ7B 4YNXA 1XUIA 1BITA 4CRGA 1WOFA 1HAPH 4IMZA 1CT2E 1ZHPA 1QB1A 2ZFRH 4Q7ZA 1HAGE 1PPHE 3SUGA 2WPIS 1C2EA 3MTYA 1SLWB 5HKKD 1HAHH 1NFXA 1QRWA 1SGIB 1S0QA 1MBMA 1O2WA 4RSPA 2ASUB 3F6UH 1AUTC 4JZIA 1TGNA 1FY8E 5HXFA 1GVLA 3L89M 1RXPA 2ZCHP 3IITA 1TX6A 1XUGA 1H03P 2OBOA 1QY6A 3LIWA 2C8ZB 3BTKE 4AZ2B 3UTUH 4BWCA 1W0KD 1AD8H 3GY2A 4HTCH 4K3JA 3T5FH 4BTTB 4AG2A 1WTGH 2D2DA 5FO8C 2G00A 4O3UA 1O3AA 1CBWC 1ZOMA 2F3CE 4VGCC 1U5MA 1GBAA 2BQ7B 2Z3EA 1ANCA 3ZRZA 1MTVA 1SGNE 1YPEH 1SGFG 4MNVA 1C1SA 5HGGA 3A87A 2JETC 2FEQH 2R0KA 3N99A 3QN7A 1EAIA 3QLPH 1O2RA 2FS8A 1HGTH 1Y5AT 4H6TA 4DIHH 1FBRA 4O97A 1C9PA 1EJNA 3P17H 4AYDA 1CVWH 3ERBA 2XCNA 1MU8B 1HLTH 1C2MA 3DUXH 4A1VA 1HYLA 1EXFA 1O2LA 1C1NA 2J95A 4K2YA 3TJUA 1PJPA 2GV6A 1GJDB 3TITA 3V13A 3UREA 1NRQH 1V2VT 2G5NA 5IK2D 2ZECA 1D6WA 2AGGX 3RXJA 1ELBA 4FXGG 1TIOA 1PPEE 2BD4A 2KM0A 3ZVFA 4AC9A 3QWCH 4X0WU 2YRAA 2HPPH 4CHAC 2VIDA 1O3OA 2ZEBA 1EZQA 2XBVA 1T8MA 3ZYEA 3KYFA 3F2HA 1B0FA 1GCTC 2GMTB 1QHRB 2QV1A 2A7JA 1WXRA 2AIQA 2G5VA 3NRLA 3A85A 1A61H 3M3SA 5E0JA 2PGBB 3G01A 5DJ7A 5L6NH 1UCYK 1AB9C 1ZRBA 1KXCA 1L1GA 4YIZA 1H2QP 3KQ5A 3ZZDA 3FP8E 3OXUD 2QY0A 3IWMA 3EE0B 1SQAA 1ETSH 1TPNA 3OEDC 3BV9B 1BHXF 1SR5C 1PYTD 4JK6A 1UJ1A 1GGDB 1T8NA 1NRSH 4CR9A 1GBLA 3C1KA 3EYDA 4X1PU 1DLEA 4NSYA 2BDAA 4FU8A 2V8EA 3FO8D 1C1WH 4XE4A 1GHQB 3A7XA 3L6PA 2F83A 5HZPB 1AI8H 1HAOH 1K28D 2QAAA 1EAUA 3MU0A 5CE1A 3C27B 1SOTA 3LGIA 1QUBA 1Y3UA 2W7SA 5DP4A 1FLEE 6CHAC 3SU3A 1F5LA 5B6LA 2KZ4A 3KHVA 3E3TA 2P8OB 3LONA 1Q2WA 1W0ZU 5IDKA 2AMDA 4INLA 2O8LA 5DP8A 8KME2 4P00A 3FAOA 1WQSA 1UHBA 2LP6A 3BTHE 2BTCE 1EATA 1C1ZA 2OC7A 5J4QA 1CKLA 2WYJA 1L1NA 1UTQA 2QA9E 2ZTXA 1KXEA 4UFGH 3WWBA 3T29A 1DY8A 3OEED 3Q3XA 1MU6B 2FYRA 3F6KA 1C5YB 4NIWA 3MQKC 4AFSA 2SGEE 5K0HA 4YO9A 1IQFA 1BRCE 1UTJA 1CGIE 1QCPA 2IPHA 1FUJA 3ZZ6A 4WMFA 3A89A 1P03A 1MCTA 2ZNKH 1CGHA 4X1SU 2EI7A 3SQEE 4YT7H 2D1JA 4K1EA 4FUEA 1O2OA 3RXMA 1GHVH 1BTXA 2ZFSA 2Y8SA 3OAAD 4P02A 1M9UA 1YGCH 2BQWB 3A7VA 1VJ9U 7ESTE 4C16A 4A5TS 5EJ1A 1QFKH 2HRVA 2WV4A 4KELA 1N8OB 1QBOA 1KTTB 4I8GA 2RLPA 4CRCA 3Q76A 1QR3E 2BD7A 2AYWA 3CS0A 5TCCA 1QIXB 5EXMA 1TOCB 2A55A 2IZ3A 2H5DA 3KZJA 1NFYA 1KXAA 2Z9KA 3SU6A 1WU1A 3LH1A 1A1RA 2QF5A 3CI0J 1D6RA 1LVYA 1C5RA 3SNBA 4NA9H 1ORFA 1V2LT 4OS5A 3P8FA 4FXGH 5EOKA 1PQ8A 2A4QA 2UUYA 3H5CB 4XSKU 2AH4X 1O3PB 3Q77A 2BOHB 3GY3A 1RIWC 2Z94A 2A7CA 2ZA5A 2ZTYA 1CT0E 1TPMA 1VCQA 3MMGA 3ZV8A 2H2ZA 3QGJA 1MD7A 3LGVA 1TFXA 1BHXB 3KCGH 1G2MA 1QTFA 2CHAC 2VJ1A 2ZDAH 4UFDH 1O9AA 3MWIU 5FXLA 1LPZB 1OWIA 2GDDA 4X1RU 1GPZA 3U98H 1TMBH 4YT6H 3RXUA 3RMMH 3SGAE 2BD3A 2OC8A 2WV5A 4GLYA 3PTNA 1CBWB 1E88A 4VGCB 2K8IA 3BTDE 5FL7D 3KQBA 2BDIA 1GDNA 1O3DA 3F2GA 9LPRA 1ELVA 1W0JD 4LXBH 3RDZA 5EQQA 1LPKB 2ODPA 5F8ZA 1YYY1 4YLUA 2JETB 1PQAA 4NCYA 1HAXB 5C0TA 3T27A 3KNXA 1RFNA 2J2UA 1SL3A 3U8OH 1KYNA 1Y3YA 2H1UA 3A82A 3LC3A 1DOJA 3UAIC 1GJ7B 1E1QD 3MNXA 3D65E 1NT1A 1ELDE 2ANKH 1ELGA 1EQ9A 1SMFE 3M7PA 2PKAA 3MU8A 3RM2H 3RXTA 2W7UA 1BTPA 1YKTA 2ZGXH 3RM0H 1E1RD 3UOPA 1TWXB 2QF0A 4NFFA 3AK5A 3GXEA 4Y76A 1CGJE 1GCTB 1UOTP 3MOCA 3MH5A 4MPWA 1K22H 1G30B 4B74A 3SUFA 3UNSA 1BB0B 1P06A 1OJYA 1DT2A 3UNRA 1BTYA 2J98B 2GX4A 1NRRH 4BAQB 2Y80A 1AB9B 2GZ9A 1SGPE 1T7CA 1D3PB 2YMSD 5AFYH 4ZCNA 1TGBA 2CF8H 1SOZA 3EA9A 4OS2A 4AYVB 1P2OA 2AGEX 2F9OA 3PROA 4XBBA 2ZYCA 4XBCA 5AHGH 2ZU1A 3RU4T 2Y81A 5ETXA 3WSYA 1G3CA 2FM2A 2RDLA 5EIYA 1P11E 3S7HB 4NFEA 3QDZB 2PSYA 1IQGA 1OP8A 1ZHMA 1BBRE 1MAYA 3M7QA 1H8IH 1ETTH 1GKGA 4AOQA 1YY3A 2BVXH 3RXIA 1GI1A 1P05A 2FX4A 6CHAB 1O37A 1GWAA 1ZYOA 2WPJS 1AHTH 3K6YA 1J16A 3LU9B 2YBYA 5I25A 3E8LA 1F5RA 1CSOE 4GHTA 4AORA 1UCYE 2L6OA 2SGPE 1A4WH 1GBKA 1QL7A 3RU4D 1CE5A 2BY6X 1HXFH 1IAUA 2YMSC 1OK9A 1KXDA 1F92A 5EXNA 4SGBE 3I77A 3U8TH 5AFZH 1FY1A 4YTAA 6ESTA 3LDXH 1QQUA 3BEUA 1DVAH 5GJ4B 2BB4A 2EHFA 1AWFH 2KAIB 2JH0D 5E2PA 2F91A 3U8RH 4CH8B 2EC3A 4FOUC 3T5OA 2ZDVH 3RMLH 2C8YB 3GOVA 3A8DA 4DJZA 2J9NA 3FOAA 1YC0A 1P2QA 1K1OA 1ZRKA 5EU8A 1XKAC 1EZXC 1KMHB 1O2TA 2XRCA 1EFRD 2CK3D 1P01A 3BG8A 1A0LA 1T8LA 2RL0A 1P12E 2C90B 2B7DH 2P3TB 1GJ6A 2I6QA 1YLNA 5C17A 3ATWA 3WW7A 2BY5X 2ZDNA 4DY7B 2FZZA 1D9IA 3ZVBA 5GNDA 4U32A 3RU4E 5F6MA 3EAJA 3UIRA 3A88A 3FP7E 5DN6D 2ZU5A 4KTSA 2GVFA 2ZDLA 3ELAH 1AY6H 3ZVAA 1GJBB 2RCEA 3Q3YA 2WZQA 1MKXH 4INHA 1WYKA 3TJNA 2O8TA 1C1MA 5TCAA 3F9FA 2BY7X 4JHSA 2RDEA 1VCWA 3S9BA 1UTKA 4X6MA 5ESTE 4BANB 1HAYB 2XBXA 3ZZ8A 3HGPA 4X1NU 1F7ZA 4Q7XA 3AW0A 1SHHB 3SW2B 1ZTLA 2H6MA 3TVJB 4BAOB 2JJ2D 2BDBA 2ZGCA 2A45B 3LGUA 3OY6U 5CHAC 3KQCA 1O5FH 4I8KA 1RIWB 1P2JA 3U28C 1KXBA 2P93A 3PWBA 1W2KH 2NU3E 3DSPA 4BOHA 5C94A 3PLBA 3OYPA 3FZZA 1VCPA 2DUCA 1L2EA 1LHFH 2RA0A 1ZTJA 2P3FH 2YNAA 4K8BA 1TRMA 1IQHA 1O3MA 1C1VH 5I46H 2CHAB 2MCYA 1TPAE 4FVDA 1DM4B 1AE8H 2Q1JA 1YBWA 4OGYA 1SPJA 4GHQA 4E7RG 1U6QA 2AIPA 4O9VA 4UFEH 4LOSA 3AAVA 5LGOA 3SV9A 4LOYH 2VB0A 1FONA 5A8YA 4AN7A 1DITH 3BF6H 3SHAH 2XWAA 1C5PA 2P8OC 1GI6A 5E0HA 2FWWA 4FUDA 4CRFA 1AIXH 2CG6A 1GJCB 1YCPH 2KCPA 1P9SA 3H7TA 4A1XA 1O2HA 2KCYA 4Z0KA 3D23A 2SNWA 2HVXA 2QY0B 3RXQA 3ZZ4A 3QZQA 2F43B 1WCZA 1EJMA 4LZ4B 1SQRA 4A5WB 2SGFE 2CV3A 1W13U 4Y8ZA 2PHBA 1AN1E 3SZEA 2SNVA 3UWJH 4CRAA 2RKZA 1SLUB 1TOMH 4HG6A 1TX8A 1MTNC 3MU1A 3V0XA 2ZZUH 1T4VH 2GZ8A 2KR7A 1CA0C 2BDHA 2FDAA 4IN1A 4AB9A 4B1TA 4B75A 4OS4A 3HKJB 4CBNA 4XFQA 2ALVA 1UTPA 4ZHMU 1L4DA 4B6FA 2W6ID 4LZ1H 3LJJA 4O3TA 2F9UA 1AVWA 1VKYA 4JZEH 2PP6A 5EGMA 2XC4A 3SU2A 1X7AC 1ETRH 2GDEH 2GT8A 3E0NB 1OK3A 1TLDA 1GL1A 1A2CH 1XUKA 1XXDA 3VB7A 4Z6AH 2ZGJA 1L1JA 4ONTD 2B5TB 1OOKB 1GHXH 3TJVA 4DGJA 1O5DH 2VH6A 4WH6A 1UHBB 1NBMD 3GDSA 1QJ1B 3SQHE 2VNTA 3URDA 1TBQH 2WINI 3FFGA 5CHBA 1C1TA 1EKBB 1C2JA 3S0NA 3ZYDA 4FVBA 1HBTH 3QX5H 1BIOA 3ZZ5A 3KYGA 1HAVB 1T31A
chains in the Genus database with same CATH topology
4ZXYH 1O3BA 2UWPA 3ZZAA 1KDQA 1TA2A 2A7HA 4RKJB 7LPRA 3BEFB 2ZGBH 5DPAA 1PPQA 1BRUP 1OWDA 1GBTA 2WUCA 1VR1H 1ZPCA 1GKNA 2VH0A 3SNCA 2CJIA 1O2NA 1Q31A 4DVAU 2A32A 4I31A 1PPCE 3QGNB 4KP0A 2JGWA 2AS9A 2OUAA 4ABIA 3RXKA 2OBQA 4A92A 2R2MB 1AZ8A 5TJXA 1H2PP 3RLWH 2FI5E 4CRDA 4Y6DA 4BAHB 2BX3A 4INKA 5C3NA 4KGAA 4ESTE 1LCYA 3STIA 4D8NA 1C5ZB 2BXTH 3QUMP 2PSXA 1Q3XA 1GHAG 1QBNA 5AF9H 1Y5UT 4WXVA 4YM9A 5GWZA 1F2SE 3KQDA 2TGAA 3L3TA 1J8AA 1C9TA 4HGCA 2F9VA 1GJ5H 1ANEA 1P0SH 3V12A 1TABE 4DOQA 3QK1A 4Y0ZE 5J4SA 1NWVA 3AVZA 5JBTA 2Z7FE 3KN2A 4XBDA 3TK6A 2BZMA 2NU1E 3E91A 1DXPA 1MKXK 1SS2A 1O2JA 2ALPA 3TK5A 3UOUA 2Z3DA 3ZZBA 1AFQC 4Y71A 4WXIA 3Q3KA 1FPCH 3ODFA 3OY5U 3GISB 1ZGIA 3NKKA 3LPRA 2XTTB 1HXEH 1B5GH 4ISIH 2IN2A 4Y7AA 3K2UA 2OP9A 1NTPA 1ABJH 4B2AA 2VVUA 1GDUA 3UUZA 1P3CA 3RC5A 2BDCA 1UTOA 1H8DH 2GCHF 1O2KA 4WMDA 2FODA 1S82A 1GBCA 1GI0A 3MQLA 2YNBA 1NROH 2Y82A 1FPHH 3RXAA 4WMEA 1C1OA 2FTLE 2VWOA 1OX1A 4GSOA 4X8VH 3QZRA 2V3OH 1KIGH 1TBRH 5A09A 4JMYA 2WIIC 1D4PB 1NS3A 1EPTC 1DLKB 5CHAB 1C2LA 2BX4A 1YCPK 4UDWH 2NWNA 1ZZZA 3P8GA 3RP2A 4FUFA 3TH4H 1W12U 4IC6A 1TE0A 1TYNA 4JZ1A 2G4TA 5A8XA 4ABHA 3ATIA 4NZLA 3MH4A 5EXLA 1V6DA 4AYMA 2A5KA 5HYUB 3TIUA 6LPRA 3T62A 3TLOA 1XM1A 4D7FA 1LVOA 3LOXA 2C93B 4AYEA 2JH5D 3F9EA 2Z9GA 1OP2A 3M35A 3VPKA 2Z9IA 3EDXB 1TB6H 1DSUA 3KL6A 4Y7BA 4CREA 1K1JA 4XDEA 1GVKB 3ZVDA 1EUFA 1Z1IA 2O8MA 1O2QA 1D3TB 2TIOA 2KMSA 5HM2A 1Y3VA 1Y8TA 1K1MA 1C2HA 1OPHB 3ZZ7A 3GCHB 4X2VA 1BTZA 3BTQE 2PKSC 1EASA 1XUFA 1Y59T 1GHAF 1IQLA 1C5OH 3MO6A 1SFQB 2ZTZA 2VIQA 1J14A 1MTNB 1DFPA 3ZZCA 2WPLS 1CA0B 2XC5A 2WUBA 3P70B 1G37A 4MPUA 2TGDA 2BLQA 4R0IA 7GCHG 1GI2A 3TH3H 5DP6A 1FN6A 3SV8A 1C5VA 1JBUH 3VGCC 1AVGH 2QF3A 2NU2E 1Z1JA 3SNAA 5DGJA 1XUHA 3RXGA 3BTTE 4X2WA 2RKYA 3E16B 1SBWA 3GY4A 3T2NA 1H9HE 1TRYA 3GICB 3EA7A 1YCPM 2FMJA 1AKSA 1FQ3A 2BD9A 4SGAE 1GBJA 1C5QA 1FV9A 2P59A 2A0QB 1T8OA 2HPQH 1GI5A 1F0SA 2XCFA 3U69H 1NU7B 3T25A 2BZ6H 2I6SA 1YPHC 1RTLA 2O39C 2IOTA 5BRRE 1T32A 1OYQA 2UWNA 1A0JA 3M37A 4YOIA 1O31A 1ANBA 2BYAX 3ATKA 1QA0A 3A84A 2R2WU 1GMCG 1LQDB 1WBGB 4NIVA 1WAYB 2NU4E 4DJZB 4BAKB 1LVBA 1E38B 1KXFA 1K1PA 2OC0A 1J9CH 2ZO3H 4AYYB 2C3SA 3GY8A 2QGRA 1V2ST 3ZVEA 1K9OE 1QA7A 5GCHG 1NESE 2AEIH 2FOBA 2ZPQA 5T6DA 4X8SH 1LHGH 5AVDA 1G3EA 1GJ4H 1O3IA 2R3YA 1OK2A 1QRZA 1O2VA 1O2IA 2G8TA 2ZDMA 4NG9H 1PQ5A 1HJ9A 1DWCH 3NZIA 2C8WB 4HZHA 3EA8A 1C5MD 1E5GA 2TGPZ 3MHWU 3A7YA 3M36A 3BG4C 3STJA 3SORA 4YZUA 1MQ5A 1LKBA 2BXUH 1EP5A 1S6HA 4WH8A 2XXLA 3PMHB 3O8CA 2KRIA 2ZGHA 1XVMA 1K1IA 1VGCC 1BZXE 4IN2A 3JZ2B 2CF9H 3UR6A 1ZJDA 3S9AA 4DT7B 4ABFA 1BTHH 3ZVGA 1AFQB 5HM9A 1SLVB 3M5NA 1O5BB 3B8JA 1TNGA 4F49A 2R3UA 3RXOA 1NZQH 2LNCA 1TNIA 3LT3A 4DG4A 2WPHS 4NA8A 4WY3A 4FUCA 3LH3A 7GCHF 3NK8A 5FAHA 1HFHA 1ESAA 2VWNA 1IQEA 4ZHAA 5GPIB 3LKWA 3NCLA 3ZD2A 1VZQH 1SFIA 3UWIA 3RC6A 1ARBA 1OKXA 2O8WA 4DIIH 1QNJA 1GHBG 1DX5M 1O3KA 1OWKA 5E0GA 3INBC 3PLKA 4MDSA 1FY5A 4Q2KA 1IQKA 1PPFE 3RXDA 3SV2H 2R9PA 2XQWC 4DCDA 1AGJA 1IOEA 1XUJA 2V35A 1JOUB 1EPTB 3SO3A 3W94A 1QB9A 4A7IB 2BZAA 2ANYA 1H4WA 3RXPA 3F9HA 1QB6A 3NXPA 1G4GA 3AW1A 3TPIZ 4OS7A 1LVMA 1DY9A 1S6FA 2K1QA 2Y5HA 3HGNA 1MMJN 5JBCS 1GG6C 1SGRE 1O3HA 3BTFE 3UNQA 1MAXA 5GIBA 1ZMLA 3MYWA 1S81A 2F9NA 5PTPA 1DWBH 1GMCF 2C8XB 1C1RA 3MH7A 4ZH8A 4NGAH 1AQ7A 2ZQ2A 1GBDA 1Z8RA 3GDVA 4Q80A 4ZROA 5ABWA 4U2WA 2FXRA 1H9LB 1NY22 1RTFB 4IMQA 1ABIH 5GCHF 1BMMH 1LHCH 5A0BA 1OP0A 1O30A 2VINA 1V2UT 1W0YH 5A0AE 1XXFA 1G3DA 1B7XB 1A7SA 3A7WA 1BA8B 5C1YA 3NFPI 1P02A 1E35B 2PKSB 2ZHQH 3M5LA 3TNSA 1GCDA 3BSQA 1GVZA 3M5OA 2W5EA 2PTNA 1N6XA 1ZR0A 2ZHWH 5H4IB 3RXRA 2QXHA 1QRXA 1MH0A 4K1SA 2BDGA 2VGCC 1LMWB 1EOJA 2OXSA 2P94A 1F0RA 4K69A 2ZHDA 4YESB 3Q00A 2BMGB 2VIPA 2GTBA 4MLFB 5CMXH 2ZKSA 3T26A 3PYHA 2BY9X 8GCHG 3VGCB 3GYMA 1MKWH 4TWYA 1NPMA 3S69A 1FY3A 1IHSH 3B9FH 1NC6A 1W10U 4HI3A 4MPXA 5G4BA 3UPEA 4Y0YE 1GHWH 4MUCA 1INCA 2G81E 4ZKRU 2G4UA 3IX0A 2OINA 1BRAA 3EJHA 2BD2A 1QO6A 2FI3E 1K2I1 3SNDA 5F03A 1BOQA 1A3BH 8ESTE 2V3HH 5C1UA 1V2QT 1IQJA 3A81A 2ANWA 3ESTA 3KF2A 4AB8A 4BAMB 1FAKH 1SQTA 2QXIA 1TGCA 4ABBA 1O33A 2D26C 4Y11E 3SZNA 2ODQA 4U30A 1CQQA 1Y5BT 5HMAA 3E1XB 4A6LA 2CGAA 4IGDA 4J1YA 1JRTA 1IQIA 2BLVA 2V0BA 3BIVH 1GHBF 2R0LA 5EQSA 2G7IA 7KMEH 2SGAA 3HK3B 4AG1A 4UFFH 1O5EH 3ZVCA 3MNSA 5FHTA 2F9BH 1MZAA 5GXPA 2DE8A 3GYLB 5DP5A 2XRDA 1WQVH 1SRZA 1SGQE 2FOCA 2A1DB 1UTLM 2BD8A 3AAUA 4X6OA 5LPFA 3KEEA 1MTWA 2B9LA 3ZD1A 3RJ3D 5A0CA 2AMPA 1A5HA 2JH6D 2Q6GA 3SGBE 4CH2B 1ZHRA 1SGCA 3HPTB 1HCGA 3CALA 4K1TA 4KTUA 4ZUHA 2OQ5A 1BTWA 2VIWA 1BBRH 2W3KA 1C5NH 3GY7A 5DK1A 3BG4B 4MTBA 2IZ4A 1O2XA 5FX5A 1ESBA 1MBQA 2Y5GA 1XKBC 4Y79A 1TNHA 2BQ6B 1FI8A 4ZH1D 1FDPA 1O3JA 2J38A 1ELCA 3A7ZA 4MQAA 3M5MA 1V2PT 1VGCB 1V2JT 3PMJA 1GBMA 1MCVA 2HNTC 5T6GA 3R62A 2UWLA 2IJOB 3GCHC 4WVPE 2W3IA 4ZXXH 4X1QU 3HK6B 4THNH 3RXLA 4KTCA 5E2OA 5C5OA 4I7YH 1XX9A 1EX3A 3IU3I 1HIAA 1P8VC 3E6PH 4E7NA 3SJ8A 1Y3XA 1C2GA 1RJXB 1SGEE 1SGFA 1Z6JH 2FO9A 3A86A 1K21H 5JBAS 1Z8IB 5FBIA 2ERJA 1HUTH 3VXEH 1RD3B 3RXEA 3SJIA 4IS5A 1EOLA 4NWLA 1HPGA 2QN5T 4ISHH 2O8UA 4MNYA 8GCHF 4YLQH 3SUDA 2OCVB 1KTSB 2XWBI 1OJWA 2HWLB 1UK2A 2GKVE 4E06H 2GGVB 3SUEA 3GCNA 1FMGA 2UWOA 1DXWA 1IHTH 4ABGA 1TRNA 3RXHA 3SV7A 4BTIB 1SGTA 4AFZA 1JIMA 1TPSA 1C4U2 2FI4E 3LJOA 1RGQA 4WJG2 1C2IA 3N7OA 3P92A 4B2BA 2XWBF 3PM3A 2SGDE 5T6FA 2W26A 1ZMJA 1AE5A 2CG7A 1QQ4A 2QC2A 1GG6B 1GI3A 4TY7A 2CKUA 2WPKS 2PR3A 5FPTA 2GCTC 5FBEA 2J34A 5FPYA 3SU0A 4NA7A 3ENSB 4FU7A 2CN0H 1NRNH 1O5CB 1S83A 3K6ZA 4LOTA 4CR5A 1JXPA 2ODYB 2HGTH 1JRSA 2ZIQH 4IC5A 2QCYA 4RN6A 1GBIA 1NU9A 3BEIB 1EZSC 1O2GH 5DP7A 2BD5A 1MTUA 1AKSB 2ZDKA 2XW9A 2PTCE 3DT0H 3I29A 2J92A 3DFJA 1MKWK 1TNLA 2TGTA 3ZZ3A 2JGXA 2H9HA 3TJOA 1DWDH 3F1SB 3AASA 5EW1H 5FX6A 3CS7A 4Y8XA 2FLRH 1G9IE 2M5TA 3PB1E 1BRBE 1O34A 1OSSA 1YPGH 1E36B 1HAIH 1K1NA 4ZKOU 1SB1H 4FUHA 2A4OA 1TALA 1O2YA 5DP9A 5L30H 2VGCB 4JZFH 4TPIZ 2FLBH 1NM6A 2BDYA 2GP9B 5EPYA 3SGQE 3RXFA 4IW4E 1EZUC 1P57B 4BTUB 1EAWA 3IG6B 1GI7B 1IQNA 2Y7XA 4O03A 5JB9S 3KXVA 2QYIA 2FOMB 3BTGE 1O3LA 4X2XA 1HAZB 1SSXA 2EC9H 4NZQA 1O5AB 4KKDA 1KLTA 1TBZH