1MD8A

Monomeric structure of the active catalytic domain of complement protease c1r
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
329
structure length
314
Chain Sequence
DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 314
sequence length 329
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A01
2LOJA 4FUGA 1UMAH 1SFQB 1FZZA 2WYGA 1BA8B 3SZNA 1ZPZA 2ZPRA 3F9GA 4GCHG 2ANKH 1C5NH 3P8FA 1P12E 2GZ8A 2OCVB 3ZZ6A 3PLBA 2NWNA 1XUJA 2PGQB 1ABIH 3BTEE 3T5OA 1GVLA 1BITA 2BD9A 3MNXA 4UEHH 1HAGE 4Y8ZA 1GJAB 2EC3A 1ZSLA 1FJSA 4WMEA 1B7XB 2GDEH 5E0GA 1OK1A 1SB1H 1YYY1 1SPJA 2JH6D 2XBVA 2ZECA 3M61U 2GZ7A 5FX6A 1AFQC 1HRTH 2GKVE 1TYNA 4KGAA 4Y8XA 1Z6EA 5C5NA 2QXIA 1O5EH 1LQEA 4INKA 4INLA 2BTCE 3U1IB 5L6NH 3PTNA 4AZ2B 4O3TA 2C8XB 2YNBA 2Q6FA 3RXCA 4B1TA 3F6UH 2FZZA 5EW2H 1UCYK 4Z6AH 5L2ZH 1IHSH 1GJ6A 5TJXA 1C4U2 2GDDA 1V2UT 3VGCB 1EAIA 2AGIX 2BDHA 4D9QA 1GDUA 3BF6H 1EB2A 5DP6A 4NSVA 4NFEA 1GI2A 2PTCE 1GDQA 1O38A 2QF0A 4BXSA 3RXAA 1TA2A 1QB9A 2ANWA 2XTTB 1W10U 1MKWH 1PJPA 2ODYB 1CU1A 1FIWA 2EI6A 1E35B 2Y6TA 1HAHH 4MG3A 4X8VH 2WYJA 1KYNA 2O8LA 4I8GA 6CHAC 5F8ZA 2SGQE 1GHBF 4YNXA 2GCHG 2TGPZ 2Z3EA 3ZVBA 1GCTC 1GHQB 2OUAA 3TPIZ 3QWCH 1QCPA 5JDUB 1P8VC 3GOVA 1Y59T 1VVDA 4NWLA 2ZFFH 2XCNA 3GY8A 3P95A 5DK1A 1ZYOA 1HAXB 1TMUH 3Q77A 1BHXF 1TGSZ 3VGCC 1TWXB 3BN9A 3K2UA 1T31A 4WF8A 1TABE 2IJOB 3SW0X 1PYTD 4DCDA 1G30B 1FDPA 2FOMB 1P2KA 1F5KU 3UIRA 2BOHB 1SHHB 1FQ3A 2BVXH 2FODA 2BLWA 2B5ID 1TPAE 3A87A 5JPMG 1C1QA 1EPTA 5GXPA 2NU3E 1F5RA 1OWEA 3TK6A 2IN2A 3RXGA 1SOTA 3LOXA 2ZA5A 1SL3A 4LOYH 4K5ZA 1MBQA 1IQKA 4HFPB 4AYYB 4LZ4B 3ZV9A 4IS5A 4ZH1D 1THPB 3GCTF 1CGIE 1VJAU 2OC8A 2BXTH 1GHZA 1ZRKA 4GPGA 1GMDF 3BIVH 1NN6A 1ZJDA 2HALA 4X1RU 4BAHB 1N8OC 1M9UA 1XXDA 3LIWA 1BQYA 4ABEA 1GJ5H 1C5OH 3TIUA 1A4WH 2W3KA 3RM0H 1LCYA 1L4DA 1P9UA 3F1SB 2SGFE 2VVCA 3SV8A 1A61H 4ZKOU 4B75A 4DG4A 2OBOA 3MFJA 1C5PA 3O8DA 2BD3A 4BOHA 4JYTA 1O2VA 2OQUA 3T62A 1DY8A 1P0SH 2J2UA 1OK2A 1GKNA 3NUMA 1YPMH 1KTTB 1MAXA 2P59A 4Y7BA 1ID5H 4DIIH 4GHQA 3LC5A 1CBWC 3TLOA 1MTWA 1O3LA 2Z9KA 1Y5AT 1J16A 1S85A 2C93B 3NFPI 1RTFB 2ZGHA 1XM1A 5C5OA 1C1NA 2SFAA 1AKSB 1C5LH 2GCTB 2Z9JA 1WQSA 2CGAA 3OX7U 4HTCH 1ACBE 2A5AA 5A0AE 1ZMLA 5J4QA 2D1JA 3PO1C 2ZFTA 4YTAA 4YOJA 3RXLA 1C2GA 1O3MA 2G81E 2RKZA 1LPKB 2UUJB 1GHAG 1TPSA 1O5FH 1C5TA 3URCA 1Y3UA 4DY7B 1D3TB 1BJVA 5GDSH 2BD8A 1G3EA 2BD7A 4JYUH 3A86A 1IQHA 2FDAA 2Z7FE 1Z8IB 3PMAB 3KIDU 1V2NT 3R0FA 5C67A 4YOIA 2OINA 1UTJA 2ZTZA 2HPPH 1GJ8B 1A5HA 3HKIB 5TCCA 2BDBA 3DD2H 2D26C 1AY6H 1TX6A 1AFEH 3SU4A 2ALPA 9LPRA 3K6YA 3SV6A 3SUDA 3SOSA 3D49H 5EQSA 3LU9B 3MOCA 4Y6DA 3U8TH 3EAJA 2BD4A 1KXDA 2W81A 3GY4A 1H9HE 1YCPH 4YO9A 4YOGA 1C5YB 4D7FA 1G32B 2O8WA 3ZZ7A 3RU4D 1GHXH 4ZKSU 3GCNA 1O5AB 3SJKA 1OS8A 3ZZDA 5A0CA 1GL1A 2F9VA 3W95A 1AU8A 3L6PA 2ZWLH 4NCYA 1UCYE 1T4VH 3SV2H 3RLYH 4AB8A 1V2TT 2I6SA 1MAYA 1S6HA 1ELBA 4JZFH 1ZSJA 2BY7X 1GBFA 1N6YA 4UFEH 1CGHA 2CHAC 1XKAC 3T5FH 2FOEA 1C1RA 2EI7A 2JETB 2OXSA 3KNXA 3TH3H 5C20A 2BDAA 1OX1A 2ZDMA 1TGBA 3FP6E 1PPEE 4B2CA 4F4OC 3ITIA 2BDYA 2CF8H 4ZHAA 3ENSB 5EXMA 2BD2A 2VIQA 2QGRA 1NC6A 4Y79A 3KZJA 1Z8RA 1FAKH 5DKMA 1O9AA 2CKUA 3RP2A 3MO3A 5A8YA 5EXNA 4BAOB 4LZ1H 4JZDH 1QRWA 5JB9S 3E3TA 2ZO3H 3SU3A 4MPUA 2WPMS 1BMLA 1CHGA 3A81A 3TGIE 1RIWB 3F9FA 1LHEH 2Q6GA 1NM6A 3TVJA 1IHTH 1XKBC 4FU8A 1MTSA 1SQAA 3GDSA 3BTDE 1GI4A 2VIPA 3AW0A 4FU7A 3H7TA 3K9XB 1C2HA 1V2JT 3PMJA 1K2I1 2STAE 4KKDA 3NWUA 2FOFA 1OK3A 3MHWU 2FWWA 5EODA 2ZCKP 1MQ5A 2AMQA 4MDSA 2NU2E 3U9AH 4B2AA 2WV5A 2RLPA 1WYKA 2FLBH 5HXFA 5HMAA 1OWIA 1J15A 3E8LA 2XC4A 4I32A 1MZAA 4AFUA 2JRAA 3GDUA 5HYPA 4YLQH 2RLQA 3V7TA 1NRRH 3T27A 1AUJA 2GT8A 3M3SA 5EPYA 3PWCA 3GY6A 2P16A 1FAXA 4UFDH 1W7GH 1ZJKA 4CSYA 1SGPE 2WV4A 5AHGH 1O2XA 1UTMA 1ELCA 2WPJS 3T26A 4IN2A 4K1EA 1O2QA 4CREA 4TY7A 1BRBE 3MU4A 4MPXA 1NT1A 3ZZ4A 1NRNH 5DGJA 1TONA 1EKBB 3Q00A 2UWPA 3OP8A 1O2ZA 1C5QA 3BSQA 3IU3I 1C1WH 1EUFA 3M37A 1HAOH 3STIA 3SORA 2ZDLA 2EEKA 1C2FA 3GOVB 2BYAX 1ZLRA 3BEUA 3HATH 4HGCA 1GI8B 1Z1IA 3ZYDA 3MU1A 4FVDA 3KQEA 3RXOA 2F3CE 2BZ6H 4XSKU 4HZHA 2PFEA 2BY8X 3TITA 2ZPSA 1TQ7B 1Z1JA 4X1SU 4A1VA 4B73A 3RDZA 1B0FA 3RC4A 1F2SE 1Z7KA 2O8MA 1PPQA 3M5OA 2ERJA 3F9HA 4H4FA 4O97A 1GBAA 3SGQE 2KMSA 1O5CB 2I6QA 2BLQA 1MUEB 1GHWH 1K1IA 4IC6A 1W12U 1IQGA 5A0BA 1ELFA 2H2ZA 1D3PB 3RC5A 2BY9X 1ABJH 3P6ZB 1IQLA 1O2HA 2ZU4A 2PGBB 4ZHLU 3M35A 2WUCA 1O31A 1A3BH 5EG4A 1ZMNA 4CR5A 8GCHF 2XCFA 2AH4X 5A8XA 2UWOA 2KRIA 1S84A 1VZQH 2ZHEH 4GHTA 1GG6C 2SGAA 2BOKA 2AGGX 5K0HA 1FN6A 4WXVA 3F9EA 3OSYA 1ZTLA 3UFAA 2W80A 2Y7ZA 1UK4A 1VITG 2WPKS 4ESTE 2QCYA 1SBWA 1TAWA 5AFYH 5GPIB 1A0HB 1BRAA 1HLTH 1XVOA 2ZFPH 1CQQA 2UWLA 3ATKA 5E2PA 1EP5A 3SNCA 2P3FH 1SGYE 3RMNH 5DP5A 1SR5C 4ABHA 3BIUH 3GY5A 2XBYA 1D3QB 5FBIA 4RN6A 3S7KB 1K1OA 3H7OA 4K2YA 1HFDA 4NIVA 2A4OA 3EJHA 1C5ZB 4OS2A 1ESAA 1S83A 4OS6A 5AFZH 1EZUC 1JIRA 1Z6JH 5GIBA 1H2PP 2J38A 1LVBA 2GMTB 2BHGA 1HV7A 2UUFB 6GCHF 1AHTH 3UPEA 3CALA 4X2XA 4UDWH 5L2YH 1QRXA 1P2NA 2YBYA 2Z9LA 3EDXB 4SGBE 1TLDA 1QB6A 3ATIA 4MVNA 1Y3VA 2W5EA 1C1VH 1BRCE 2HNTC 1BTWA 2R2MB 2P8OC 3FZZA 1EAWA 1K21H 2Y5HA 3GY3A 3LJOA 1INCA 2M5TA 2ULLA 4XBDA 4AGKA 3SU5A 2BQ7B 4Y7AA 2VINA 1FY1A 1HAVB 1HPGA 3UREA 2F83A 4OS5A 4GLYA 3LGYA 3T28A 2VNTA 4DJZA 1O3EA 4K8YA 1DUAA 2XWJI 2PKAA 5ESBA 1QBVH 2FO9A 7GCHF 1CHOF 1LMWB 1O2GH 1L0ZA 1D6RA 4OS7A 1DPOA 4NIWA 1O5BB 2ZGCA 5EXLA 1W8BH 1QL7A 2ZDVH 3RXEA 2WIIC 1CA0B 4KTSA 3KHVA 3TJOA 2EC9H 2QY0B 3DA9B 2Q1JA 3QUMP 4CHAB 2QIQA 3GCTG 2HRVA 4U30A 4TYDA 3TGKE 1GMDG 1O3HA 2BXUH 1VCWA 3UUZA 1SFIA 5LPFA 1BTPA 3UQVA 1TPPA 1A0LA 3U1JB 3I29A 3NXPA 1GI0A 3VB7A 3L33A 4NA7A 1WQVH 2GV7A 4YM9A 4K3JA 3UWIA 1MTNB 4ABFA 1YPHC 4IMZA 2J34A 4UFFH 4MNXA 3GCHB 3HGPA 4DT7B 2F91A 1F7ZA 4TPIZ 2HNTF 4ZH8A 1PQ8A 1HJ8A 4A7IB 5BPEA 2HNTE 2VVVA 4MNYA 3IWMA 4UD9H 4AG2A 2PUXB 2BQ6B 1MCVA 2LNCA 1PPFE 4X1QU 3BEIB 2PWXA 3V3MA 1BDAA 4O03A 4E7NA 3NPSA 1WUNH 1D4PB 1LDTT 1SGTA 1TNLA 1TNKA 2QV1A 3ELAH 3KL6A 1S5SA 2FPZA 1YPLH 1YKTA 3NK8A 3CS0A 1AIXH 3QX5H 1EAXA 3EQ0H 3T29A 2P3UB 2G8TA 1KXAA 3UNQA 1J17T 1GWAA 4H6TA 5C1UA 5E2OA 1BTHH 5IYTA 1QR3E 1MZDA 2H5DA 4ABBA 3S9CA 2H9TH 1GPZA 2G52A 2QF3A 5I25A 4VGCC 2GGVB 2IZ4A 2XC0A 3RXDA 1VITF 1TMTH 4DOQA 3BTFE 1L4ZA 3SHCH 1C5XB 1YC0A 1T32A 1ETSH 3FAOA 1ELGA 1W14U 1PFXC 2C3SA 1WOFA 3UWJH 1K22H 1UCYH 4FVBA 3VB5A 1PPGE 2Y82A 1RTLA 3RU4T 1FY8E 4ZKRU 1S82A 1P2OA 3KGPA 1EOLA 2W7UA 4YESB 2HPQH 2ZTXA 2XWBI 2Z3DA 1DICA 5I0QB 1P02A 1YPHE 2AYWA 2G51A 4CBOA 2AMPA 1HUTH 1OK9A 3ODDA 4ZKNU 1G4GA 1E38B 4J2YB 5DJ7A 1V2KT 1OJWA 4X0WU 8LPRA 2SNWA 1H4WA 2FXRA 5FO8C 1MKXK 3VXFH 2MCZA 1SHYA 3GDVA 1C1SA 1UTNA 4BAKB 5HM9A 2H1UA 3UTUH 3SQHE 3LGUA 1QURH 2CF9H 3MH5A 3MU8A 2WINI 2B9LA 2O8TA 2PUQH 1T4UH 1LPZB 2EA3A 4FUCA 3ZVGA 4A92A 2FOAA 2WPLS 1AN1E 3I78A 1FNIA 1E34B 2A4GA 2ZU1A 3BTWE 2TIOA 1RTKA 2Y5GA 3C1KA 3HKJB 4JZEH 1ZGVA 1KDQA 2G55A 5JBBS 3SI4H 3A82A 3SUFA 3EGKH 3A83A 1YBWA 1ZR0A 1QL8A 1QJ6B 2STBE 1GVKB 5AF9H 2QXGA 1NU9A 3OEDC 1Y5BT 3RXVA 4GUXA 1HCGA 2J92A 5FPSA 1Z92B 1OWJA 3RXFA 3SBKA 3QLPH 1O35A 2ZHDA 4CH2B 1GBMA 1GBTA 4FUHA 5FXLA 4ABIA 2KAIB 1C2IA 3U98H 2XW9A 1VR1H 3HPTB 1WAYB 3PWBA 1H2QP 1BJUA 2OLGA 2ZEBA 2B0FA 1SI5H 3RM2H 5FCKA 1C1MA 3A89A 1GBCA 3RJ3D 2FX4A 2VU8E 2F9OA 2UUKB 4OS4A 1EXFA 1ORFA 1VCPA 1AB9B 2H9HA 4B2BA 2AGEX 1AZZA 2C8ZB 4DW2U 2DE8A 2B7DH 1FLEE 1A7SA 2C90B 2ZTYA 3MNCA 4O9VA 3QDZB 4NWKA 1FV9A 2R0KA 4WH8A 4AG1A 3UOPA 3LT3A 2VH6A 2TGTA 4CBNA 2ZDKA 2Y80A 3TGJE 4XE4A 3ZZ3A 1GMHF 4NGAH 4YT7H 1THRH 2UWNA 1EJMA 8KME2 2ZGBH 1O5DH 1U5MA 1Y8TA 4MLFB 1CGJE 2XBXA 2A7JA 1NZQH 1TMBH 7LPRA 3LDXH 1QQUA 1EZSC 1K9OE 2J4IA 1MTVA 4ISOA 1AB9C 4IBLH 1MBMA 1H9IE 2BVSH 1ZGIA 2H5CA 3ZZ9A 3SGBE 3P8OA 5A09A 1FPHH 4ISHH 2ZF0H 1QRZA 2YRAA 4DJZB 1O30A 2PKAB 5CHAB 3TU7H 2ZFRH 3URDA 1MTUA 2TGAA 1DITH 1V2VT 3CENA 3M5NA 2OQ5A 3SJIA 1A5IA 4A1TA 2GCTC 1FN8A 1SQTA 1SLXB 1TPOA 1HXFH 1HXEH 3ZVDA 2EI8A 1TE0A 1A0JA 2IZ3A 1CKLA 2XRCA 2FI4E 5JBCS 1A5GH 3A85A 1L1NA 3R62A 1S6FA 4IMQA 3E90B 2ZU5A 3BG4B 5EGMA 1TGCA 1AD8H 5ESTE 3MH6A 8GCHG 4Y10E 1C2JA 1DSTA 4A1XA 1ETRH 1T7CA 4LK4A 1QBNA 1A2CH 2F9NA 3A8BA 3SHAH 2H9EH 3MH7A 4BAMB 3DHKH 1TIOA 2IPHA 1IOEA 2CJIA 1GVZA 3SUGA 1QQ4A 3BTME 1ELVA 3SW2B 3DFLA 1HIAA 1GBIA 4MPWA 3D65E 4SGAE 1C4V2 1P11E 3FFGA 1DE7H 3AVZA 3JZ2B 3PMBB 4H42U 1TPGA 1SMFE 1IQEA 2FP7B 3SJOA 1YCPM 1C2DA 2VGCB 1GI7B 3TH2H 3PLPA 2BQWB 6GCHG 1DSUA 3RU4E 1LVOA 1O3CA 2XBWA 5C1YA 3RC6A 4CRGA 4TWYA 2GD4B 1DM4B 3SU1A 5LH8A 3LJJA 4LOSA 2JETC 1UOTP 1XUFA 3PTBA 3BG8A 3OY5U 5E8EH 1H8DH 1TBQH 4C16A 2BMGB 5HGGA 1DWDH 4JHSA 1K1PA 1S81A 1NRSH 2OP9A 4F49A 3RXIA 4D7GA 1N6XA 4B74A 2VWLA 5A2MH 5HYUB 2W3IA 1LY2A 3RXKA 3SN8A 4FXGH 1C1TA 1BTZA 3DT0H 2A7CA 1BRUP 1DOJA 1P3EA 1W7XH 2OD3B 4NFFA 3UOUA 4NG9H 3MO6A 1AGJA 1DS2E 4MNWA 6LPRA 4TWWA 3ATWA 3EE0B 1G3CA 1TGNA 3ZZ8A 1ZPCA 4NIXA 2ZGXH 2R3YA 1K28D 1HDTH 1GBKA 4NA9H 7GCHG 2VGCC 1CHOG 3I77A 2FYRA 2ZQ2A 1C2KA 2A5KA 1RIWC 3AAVA 2H6MA 2ZU2A 1ARCA 3MQLA 4AFQA 1G2LA 3M3TA 1O3PB 1IQIA 3ZZAA 2ZU3A 2PSXA 1DFPA 4ONTD 2ZGJA 1ZOMA 1SGRE 4Y76A 4BTIB 3O8RA 4XBBA 1G4FA 1O3NA 1H03P 2BB4A 1GJDB 1NESE 2FOCA 1FY5A 8ESTE 3BTKE 1HNEE 2K1QA 4UFGH 2YOLA 4PZ5A 1OWDA 2WPHS 3D23A 1TQ0B 5AVDA 1JOUB 1XXFA 3E6PH 1GHYH 1O2WA 2VWNA 4E05H 5HZPB 1F92A 3VFEA 4X6MA 1C5MD 5ABWA 3KF2A 3RXRA 3PMHB 2BM2A 2B5TB 3U8OH 5T6DA 4RSPA 1EAUA 1O3FA 1NROH 1B0EA 1VJ9U 1Z71A 3SNDA 2A0QB 1DT2A 1GDNA 4AN7A 1EPTB 2GP9B 2OC1A 1QY6A 2V8EA 1TGTA 1LHGH 4AYVB 2LPRA 1VGCB 5PTPA 4MTBA 1GBEA 5DP4A 1E36B 3KXVA 1O2IA 1ANBA 2ZHQH 4MQAA 4NSYA 4BAQB 2BLVA 1MU6B 4NZLA 1TNGA 1RJXB 3LGWA 3ERBA 1HFIA 3ZVEA 5CE1A 2ZNKH 2FLRH 3SU2A 1QO6A 2ZZUH 3M7QA 3O8BA 2CN0H 1DX5M 1SGIB 2CG7A 3TH4H 4CRAA 1HJAB 2RKYA 4ISNA 1CA8B 3PV4A 1KLTA 3Q3XA 4THNH 2XYAA 1P2QA 5TCAA 2XNIA 1O5GH 3ESTA 1KXBA 3SU0A 2BDGA 3BTHE 1UVSH 1C1UH 1ELTA 4RKOB 4FUBA 4OGXA 2HVXA 3FZDA 1MQ6A 3MYWA 2BD5A 1G3BA 2FESH 3SNAA 1EPTC 1SGDE 1BT7A 1TBZH 1RRKA 3P70B 3AASA 2YNAA 2DE9A 2ZDNA 1GMCF 4XBCA 4WMDA 1G3DA 2A45B 2FOHA 1ZRBA 5DG6A 1O2TA 1SS2A 3VEQB 3KN2A 3QTOH 4KP0A 1SLWB 1Y3YA 4AYDA 4UE7H 1FY4A 1ZHRA 4NZQA 3GY2A 4Q7ZA 1GBLA 1O33A 1GGDB 2A2QH 3RXJA 5DPAA 1BB0B 1TFXA 1O0DH 3A8DA 1O36A 1V3XA 1V2PT 1QB1A 2BZMA 1AQ7A 1C5VA 1F5LA 2VIVA 1AE5A 1OYTH 1TA6A 2PKSB 2Z3CA 1KIGH 4I33A 5ETXA 4ZMAH 3MNBA 4R8TB 3EA9A 4K1TA 3O8EB 1E0FD 1OJYA 1KXEA 4FUIA 4QT8C 4FUDA 5GCHF 1PQ7A 5HYTB 3FP8E 1Z8JB 2ZC9H 4HI3A 1AE8H 3KEEA 1UTKA 1K1JA 1UVUH 1TPNA 4X1NU 1L2EA 1K1NA 4ASHA 3MO9A 3SNEA 1P10A 1A3EH 2ZG0H 3LGVA 3PM3A 5HM2A 1XVMA 1ETTH 1ELAA 4Y71A 4MUCA 1LTOA 2QC2A 4E06H 2G4UA 2GMTC 4BTTB 3RMOH 1XUHA 1BMAA 3QN7A 2ODQA 4U2WA 1V2MT 2FS8A 3LGIA 3UNRA 1NFWA 1D9IA 1GGDC 3IG6B 3UR6A 3S0NA 2CG6A 1NRQH 4WWYA 9ESTA 3C27B 1FXYA 4AYEA 4WMFA 5E0HA 1QA7A 5F8TA 1BCUH 3IITA 3RXSA 2V0BA 1Q3XA 1DVAH 3MWIU 1KY9A 1P3CA 4X8TH 4IC5A 1THSH 1GBDA 1T8LA 1ANCA 1BTXA 3B8JA 3FP7E 1A46H 4K69A 1W3CA 1XMNB 3M5LA 3FVFB 3F68H 1NU7B 2G4TA 1UVOA 3P8GA 3P92A 4GSOA 1L1GA 3PB1E 4FUFA 1OYQA 2NU0E 4GAWA 2TBSA 2AERH 4I8JA 2Z9IA 2THFB 3M3VA 1CT2E 3S9BA 1N1LA 2D2DA 3RXQA 1ZTJA 2CMYA 1C1ZA 1BHXB 1HIAB 1AUTC 3Q76A 3K65B 1ZSKA 2GTBA 1O2RA 1CA0C 2V6NA 1GJ9B 3E0PB 1SGCA 3Q3KA 2PR3A 4JMYA 3EA8A 3N7OA 2V3OH 2C8WB 1AFQB 1QL9A 4CHAC 1YGCH 4I7YH 1P57B 4AORA 1P2MA 1ANEA 1ELDE 1BOQA 2A2XH 4CRCA 1U6QA 1J8AA 3TVJB 4DURA 1LO6A 2RL0A 1NY22 3KQCA 1Z8GA 1GMHG 2VB0A 5CMXH 4Y0YE 1QIXB 2FMJA 3A7TA 1IQFA 1MTNC 2A5IA 1H04P 3GCHC 4M7GA 2ZHFH 3HK3B 3MNSA 4KELA 2TPIZ 3RUOA 2G7IA 5C2ZA 1GHVH 3LH3A 2QYIA 2BDIA 3SV7A 3TJNA 1TRMA 1TBRH 4TPYA 2G5VA 4JK5A 2XRDA 1EJAA 1TOCB 3FANA 2RDLA 1A1RA 3MU0A 3UY9A 3ODFA 1GJCB 4AGJA 2ZFQH 1YM0A 1PPHE 3M5MA 4IGDA 3WY8A 3U69H 4YT6H 2BZAA 4DIHH 6CHAB 1VVCA 1NFUA 1ZTKA 1GCTB 1QGBA 1LVMA 1LQDB 1O2NA 1MMJN 4I8LA 2PW8H 2VWMA 1EZQA 2AIQA 1G2MA 4I8HA 1NO9H 1DLKB 6ESTA 2FOGA 4AFZA 1V2LT 1RS0A 4A5TS 1MU8B 7KMEH 3PLKA 1P2JA 1DXWA 1BBRK 1WCZA 3SI3H 1P9SA 1BBRH 3TJUA 1PYTC 4YZUA 1MKWK 2Z6BD 5SGAE 5GWZA 4LXBH 5T6FA 5B6OA 4Q7YA 1J9CH 1FMGA 1WSSH 2P94A 1DANH 3DUXH 3LPRA 1E37B 1MKXH 1HAPH 3CS7A 2R3UA 2ZIQH 1IQMA 4RKJB 1Y5UT 1UHBA 1Q31A 1O32A 5FHTA 2FYQA 3RLWH 3OYPA 5JBTA 1T8NA 2Z94A 4E7RG 4PROA 1IQNA 2EHFA 4WJG2 3SQEE 2XWBF 3O8CA 1BZXE 4KTUA 4XOJA 1FPCH 2ILNA 4MNVA 3A7YA 4XFQA 1P04A 5JPMH 1MD7A 3KQBA 2AEIH 3GXEA 1YLDA 3V0XA 2PV9B 1C9TA 4X8UH 1N8OB 1F0UA 1LVYA 4X8SH 1YPGH 2FOBA 3S7HB 4B2RA 1BTYA 1DWEH 2VVUA 3V13A 1C2EA 1UTOA 4X6PA 3AAUA 1FONA 1D6WA 1V2QT 1GI5A 3GICB 1FBRA 1O2SA 1QJ1B 3P8NA 1SVPA 1O3KA 1HBTH 2OTVA 4R0IA 1F0TA 1YLCA 4GVUA 1SRZA 5LPEA 1SGFA 2R9PA 1SGEE 3M36A 4FUEA 3KQDA 2VIWA 5F03A 2QXJA 1GCDA 3LH1A 3T25A 1JRSA 1P09A 3UNSA 1ZHPA 3MTYA 1CBWB 1HYLA 3NCLA 1QFKH 1QA0A 2OC7A 3M7TA 1TRNA 1QBOA 3UR9A 5JBAS 4I31A 1W2KH 1QJ7B 4Q7XA 1TNIA 4Q2KA 5G4BA 4ABAA 1XUGA 2WPIS 3B9FH 3ZZBA 1UTPA 3PO1B 5LGOA 2QAAA 2V35A 1D3DB 2JGXA 5FBEA 4WH6A 4FUJA 1GL0E 1O2LA 2PTNA 4U01A 2HOBA 3QO6A 2PSYA 3A7XA 5E0JA 1TOMH 4ISLA 1SG8B 4J1YA 1UVPA 2CXVA 1S0RA 3OY6U 4ZUHA 1JMOH 3RXUA 3TNSA 1C5RA 2RCEA 4GCHF 4Z0KA 3SJ9A 2GZ9A 1O2UA 1FIZA 1NWVA 1AWHB 1DLEA 2BY5X 3ZRZA 2ZFSA 4AOQA 4ISIH 3LC3A 5H4IB 2O9QA 2VJ1A 2GV6A 1P05A 1GKGA 2R2WU 5DP7A 5T3HA 3D62A 1GBHA 1QUBA 1RGQA 3OXUD 1ARBA 1SC8U 1VCQA 1NFYA 3SUEA 3TK9A 5JB8S 3VB3A 2J94A 1QHRB 2GVFA 2JKHA 4UONA 5DO4H 2FI5E 3RMMH 1NS3A 1W11U 1C5UA 3PYHA 3QK1A 2MCYA 3ATLA 3UQOA 2BX4A 4K12A 1UTQA 1HAVA 1OP8A 2P95A 4IW4E 3BEFB 5A8ZA 4BANB 2CHAB 2FS9A 1FI8A 2ZHWH 1AWFH 1C5WB 2XQWC 2BX3A 1TALA 1YP9A 2A1DB 1AVWA 3BTTE 1SGQE 1TX7A 3H5CB 5GJ4B 4Y11E 4X2VA 3CP7A 1YCPK 2ZQ1A 3STJA 1V2RT 2IOTA 2BVRH 1KXCA 2XWAA 1PPZA 1O3IA 3AW1A 4K8BA 1EX3A 4CRFA 1SQOA 4D8NA 1F0SA 3EYDA 1AI8H 1MH0A 4X2WA 1ZZZA 5CHAC 3LGTA 2QY0A 2HWLB 2P93A 1P2IA 1SSXA 2NU1E 2GCHF 1V6DA 5FAHA 2TGDA 3GYLB 5I46H 5EQRA 1EZXC 4WY3A 1DWBH 1BBRE 1CT0E 4DGJA 1O3DA 1O3GA 2C8YB 1TNHA 1ELEE 1OJVA 1WU1A 1P06A 1JRTA 1O3JA 3K6ZA 1GMCG 3ZVFA 3IX0A 1QNJA 1HAIH 1ZHMA 2ZDAH 2ALVA 1O3OA 1TRYA 2FIRH 1YPEH 1AVXA 4WVPE 5EU8A 1BMMH 4AYMA 1EATA 1HAZB 2Y5FA 1LHFH 1LHCH 4KTCA 5T6GA 2ANYA 1V2OT 1S0QA 1T8MA 3SO3A 3BG4C 2NU4E 3ZYEA 1DDJA 4J38B 3DFJA 1O2KA 2ZP0H 4MPVA 1RD3B 2QN5T 1IAUA 4I8KA 4XDEA 3E16B 1FUJA 4O3UA 1BMNH 1KSNA 1HGTH 3QZRA 2Y7XA 3VPKA 3ZD1A 4AB9A 1HCCA 2QA9E 3OU0A 4CRDA 4AX9H 3M7PA 1EQ9A 1O3BA 5BRRE 2A4QA 3BV9B 3P17H 3NZIA 5GCHG 3SV9A 2RA3A 3E1XB 1WBGB 4INHA 1O2MA 1ESTA 4YLUA 4ZROA 1GI9B 3KCGH 1C5SA 3NKKA 3TNTA 3A80A 2F9UA 4CRBA 1B5GH 1RXPA 7ESTE 1BTUA 5DP3A 1O2YA 1SLVB 3TJVA 3ZD2A 2A7HA 3LKWA 1CO7E 3M7UA 1AO5A 3ZVAA 4FXGG 2A4RA 1KTSB 1JIMA 1TPMA 1WTGH 2F9BH 4ABGA 3A8CA 1K1LA 4JYVH 2JGWA 4TY6A 4CR9A 3RXTA 1SGFG 3LONA 2ASUB 5FCRA 1TB6H 4D76A 1EOJA 1G9IE 1X7AC 1OXGA 2FTLE 4LOTA 2OBQA 2G00A 3TK5A 1XUKA 2JH5D 4NIYA 3QGJA 3W94A 1E88A 5EOKA 4BTUB 1XX9A 1UO6A 1W0ZU 2FEQH 2A32A 1QTFA 5IDKA 2ZCLP 1O3AA 3RXPA 2SNVA 2ZI2H 1O39A 1YPKH 4ABDA 1UHBB 1CSOE 3ZZCA 3MH4A 4WXIA 3SU6A 2RG3A 1JBUH 5FPYA 1HFHA 1C2MA 1GHAF 1GI3A 4AFSA 2SGPE 4Y0ZE 5J4SA 2PLXA 4FU9A 4X1PU 2OC0A 1UK3A 2ANMH 2WUBA 3OTJE 1HJ9A 2A55A 1LKBA 3HGNA 2BY6X 3GISB 1KDQB 5EPNA 2F9PA 1V2WT 3EA7A 1ZMJA 5F6MA 4ZHMU 1GG6B 1OPHB 2GT7A 2GX4A 3R3GB 3GCOA 1OOKB 2J95A 4B2SA 1AVGH 2O39C 1LHDH 1P03A 2FTMA 3INBC 4X6OA 1O34A 1RFNA 3QZQA 1SOZA 2Y81A 1O2PA 1GBJA 2J9NA 1SLUB 1CVWH 3V12A 1OWKA 2ZKSA 3Q3YA 5DP8A 1G36A 1GJ4H 1AMHA 2BLOA 3SJ8A 1O37A 3E0NB 1PPBH 4AYIA 1VITH 4JZ1A 1XUIA 1C2LA 1BIOA 1MCTA 2ODPA 4B76A 3L3TA 1UVTH 1NRPH 5FX5A 1EJNA 4ZXXH 4JK6A 2KAIA 1NPMA 1WV7H 3VB6A 1VGCC 2V3HH 2G5NA 1E8BA 1DXPA 2AIPA 1F0RA 2P8OB 1ANDA 1OP2A 2SGEE 3A88A 1O2OA 3JZ1B 2W26A 3MI4A 2VIDA 1LPGB 4X2YA 1HJAC 1V2ST 1W0YH 4A5WB 1OKXA 3HK6B 2XRBA 2XC5A 1EP6A 1DWCH 1OWHA 1TNJA 1GBBA 1LKAA 3RXBA 1FY3A 2UUYA 4K1SA 4U32A 1HAYB 3QTVH 1PQAA 1DUEA 1JWTA 1CT4E 3VB4A 2R0LA 4BXWA 2VWOA 2Z9GA 1J14A 1H9LB 1KXFA 3BTGE 2ZCHP 1CE5A 5JYIA 1TX8A 1AKSA 1KLJH 1OSSA 3A7VA 4ZXYH 2JH0D 4H6SB 3A7ZA 3SNBA 3ATMA 1C1PA 1GHBG 1GJ7B 1ZPBA 3RMLH 5LPRA 3S9AA 1Y3WA 4ZAEA 5F8XA 2D8WA 1MD8A 5HYOA 1ESBA 1H1BA 4JZIA 4K60A 3L89M 4B71A 4Q80A 1C4Y2 3A84A 1O2JA 1HB0B 2Q6DA 3E91A 1GI1A 3A8AA 2P3TB 1Y3XA 1C1OA 1EB1H 1SGNE 2W7SA 1H8IH 3A7WA 3MMGA 2CV3A 3GY7A 4A6LA 5C1XA 3T2NA 1G37A 2SGDE 2PKSC 1P01A 4X6NA 3VXEH 3B23B 1AZ8A 1GI6A 1OP0A 3ZZ5A 2AMDA 5EQQA 3QGNB 1NTPA 1YPJH 2XXLA 3BTQE 4Y8YA 4ABJA 4BNRA 1W13U 1JXPA 1PQ5A 2HLCA 5DP9A 1UK2A 2VIOA 3U8RH 2RA0A 4DVAU 2TRMA 2BDCA 2VH0A 3MU5A 1T8OA 2QXHA 5EW1H 4OS1A 1PPCE 3S69A 3ZVCA 1IQJA 1DY9A 1UTLM 3G01A 2DUCA 2ESTE 2ZPQA 4OGYA 1E5GA 1YF4A 4CH8B 3RXMA 2FX6A 1K1MA 5K7RA 2O8UA 5FPTA 1WTHD 2PHBA 1L1JA 2A31A 3ZV8A 1QGFA 2FM2A 1NFXA 1KLIH 2AFQB 5L30H 2B8OH 4NA8A 3PROA 2AS9A 1EASA 5C3NA 2HGTH 1Q2WA 1GJBB 4D9RA 1BUIA 3SGAE 4VGCB 2C4FH 3RXHA 3GYMA 4IN1A 1C9PA 1UJ1A 2FI3E 4JCNA
chains in the Genus database with same CATH superfamily
2LOJA 4FUGA 1UMAH 1SFQB 1FZZA 2WYGA 1BA8B 3SZNA 1ZPZA 2ZPRA 3F9GA 4GCHG 2ANKH 1C5NH 3P8FA 1P12E 3EE7A 2GZ8A 4BWCA 2OCVB 3ZZ6A 3PLBA 2NWNA 1XUJA 2PGQB 1ABIH 3BTEE 3T5OA 1GVLA 1BITA 2BD9A 3MNXA 4UEHH 1HAGE 4Y8ZA 1GJAB 2EC3A 1ZSLA 1FJSA 4WMEA 1B7XB 2GDEH 5E0GA 1OK1A 1RLHA 1SB1H 1YYY1 1SPJA 3UB0A 2JH6D 2XBVA 2ZECA 3M61U 2GZ7A 5FX6A 1AFQC 1HRTH 2GKVE 1TYNA 4KGAA 4Y8XA 1Z6EA 5C5NA 2QXIA 1O5EH 1LQEA 4INKA 4INLA 2BTCE 3U1IB 5L6NH 3PTNA 4AZ2B 4O3TA 2C8XB 2YNBA 2Q6FA 3RXCA 4B1TA 3F6UH 5DN6D 2FZZA 5EW2H 1UCYK 4Z6AH 5L2ZH 1IHSH 1GJ6A 5TJXA 1C4U2 2GDDA 3SZEA 1V2UT 3VGCB 1EAIA 2AGIX 2BDHA 4D9QA 1GDUA 3BF6H 1EB2A 5DP6A 4NSVA 4NFEA 1GI2A 2PTCE 1GDQA 1O38A 2QF0A 4BXSA 3RXAA 3PRDA 1TA2A 1QB9A 2ANWA 2XTTB 1W10U 1MKWH 1PJPA 2ODYB 1CU1A 1FIWA 2EI6A 1E35B 2Y6TA 1HAHH 4MG3A 3OFND 4X8VH 2WYJA 1KYNA 2O8LA 4I8GA 6CHAC 5F8ZA 2SGQE 1GHBF 4YNXA 2GCHG 5F53A 2TGPZ 2Z3EA 3ZVBA 1GCTC 1GHQB 2OUAA 3TPIZ 3QWCH 1QCPA 5JDUB 1P8VC 3GOVA 1Y59T 1VVDA 4NWLA 1SKYE 2XCNA 2ZFFH 3GY8A 3P95A 5DK1A 3F2HA 1ZYOA 1HAXB 1TMUH 3Q77A 1BHXF 1TGSZ 3VGCC 1TWXB 1NBMD 3BN9A 3K2UA 1T31A 2JJ2D 1TABE 4WF8A 2IJOB 3SW0X 1PYTD 3U28C 1G30B 1FDPA 4DCDA 2FOMB 1P2KA 1F5KU 3F0PA 3UIRA 2BOHB 1SHHB 1FQ3A 2BVXH 2FODA 4B6EA 2BLWA 2B5ID 1TPAE 3A87A 5JPMG 1C1QA 1EPTA 2W6ID 3ZIAD 5GXPA 2NU3E 1F5RA 1OWEA 3TK6A 1E79D 2IN2A 3RXGA 1SOTA 3LOXA 2ZA5A 1SL3A 4LOYH 4K5ZA 1MBQA 1IQKA 4HFPB 4AYYB 4LZ4B 3ZV9A 3H09A 4IS5A 4ZH1D 1THPB 3GCTF 1CGIE 1VJAU 2OC8A 2BXTH 1GHZA 1ZRKA 4GPGA 1GMDF 3BIVH 1NN6A 1ZJDA 2HALA 4X1RU 4BAHB 1N8OC 1M9UA 1XXDA 3KYFA 3LIWA 1BQYA 4ABEA 1GJ5H 1C5OH 3TIUA 1A4WH 2W3KA 3RM0H 3NJAA 1LCYA 1L4DA 1P9UA 3F1SB 2SGFE 5EJLA 5KECA 2VVCA 3SV8A 1A61H 4ZKOU 4B75A 4DG4A 2OBOA 3MFJA 1C5PA 2WPDD 2BD3A 3O8DA 4BOHA 4JYTA 1O2VA 2OQUA 3T62A 1DY8A 1P0SH 2J2UA 1OK2A 1GKNA 3NUMA 1YPMH 1KTTB 1MAXA 2P59A 4Y7BA 1ID5H 4DIIH 4GHQA 3LC5A 4RT0A 1CBWC 3TLOA 1MTWA 1O3LA 2Z9KA 1Y5AT 1J16A 1S85A 2C93B 3NFPI 1RTFB 2ZGHA 1XM1A 5C5OA 1C1NA 2SFAA 1AKSB 1C5LH 2GCTB 2Z9JA 1WQSA 2CGAA 3OX7U 4HTCH 1ACBE 2A5AA 5A0AE 1ZMLA 5J4QA 2D1JA 3PO1C 2OK5A 2ZFTA 4YTAA 4YOJA 3RXLA 3W1EA 1C2GA 1O3MA 2G81E 2RKZA 1LPKB 2UUJB 1GHAG 1TPSA 3NRLA 1O5FH 1C5TA 3URCA 1Y3UA 4DY7B 3CI0J 1D3TB 1BJVA 5GDSH 2BD8A 1G3EA 2BD7A 4JYUH 3A86A 1IQHA 2FDAA 2Z7FE 1Z8IB 3PMAB 3KIDU 1V2NT 3R0FA 5C67A 4YOIA 2OINA 1UTJA 2ZTZA 2HPPH 1GJ8B 1A5HA 3HKIB 5TCCA 2BDBA 3DD2H 2D26C 1AY6H 1TX6A 1AFEH 3SU4A 2ALPA 9LPRA 3K6YA 3SV6A 3SUDA 3SOSA 3D49H 5EQSA 3LU9B 3MOCA 4Y6DA 3U8TH 3EAJA 2BD4A 1KXDA 2W81A 3GY4A 1H9HE 1YCPH 2KZ4A 4YO9A 4YOGA 1C5YB 4D7FA 1G32B 2O8WA 3ZZ7A 3RU4D 1GHXH 4ZKSU 3GCNA 1O5AB 3SJKA 1OS8A 3ZZDA 5A0CA 1GL1A 2F9VA 4TSFD 1AU8A 3W95A 3L6PA 2ZWLH 4ZCNA 4NCYA 1UCYE 1T4VH 3SV2H 3RLYH 4AB8A 1V2TT 2I6SA 1MAYA 1S6HA 1ELBA 4JZFH 1ZSJA 2BY7X 1GBFA 1N6YA 4UFEH 2XNDD 1CGHA 2CHAC 1XKAC 3T5FH 2FOEA 5T1VA 1C1RA 2EI7A 2JETB 2OXSA 2J97A 3KNXA 3TH3H 4Z1MD 2BDAA 5C20A 1OX1A 2ZDMA 1TGBA 3FP6E 1PPEE 4B2CA 4F4OC 3ITIA 2BDYA 2CF8H 4ZHAA 3ENSB 5EXMA 2BD2A 2VIQA 2QGRA 1NC6A 4Y79A 3KZJA 1Z8RA 1FAKH 5DKMA 1O9AA 2CKUA 3RP2A 3MO3A 5A8YA 5EXNA 4FETA 4BAOB 4LZ1H 4JZDH 1QRWA 5JB9S 3E3TA 2ZO3H 3SU3A 4MPUA 2WPMS 1BMLA 1CHGA 3AK5A 3A81A 3TGIE 1RIWB 3F9FA 1LHEH 2Q6GA 1NM6A 3TVJA 1IHTH 1XKBC 4FU8A 1MTSA 1SQAA 3GDSA 3BTDE 1GI4A 2VIPA 4I86A 3AW0A 4FU7A 3H7TA 3K9XB 1C2HA 1V2JT 3PMJA 1K2I1 2STAE 4KKDA 3NWUA 2FOFA 1OK3A 3MHWU 2FWWA 5EODA 2ZCKP 1MQ5A 2AMQA 4MDSA 2NU2E 3U9AH 4B2AA 2WV5A 2RLPA 1W0JD 1WYKA 2FLBH 5HXFA 5HMAA 1OWIA 1J15A 3E8LA 2XC4A 4I32A 1MZAA 4AFUA 2JRAA 3GDUA 5HYPA 4YLQH 2RLQA 2HLDD 3V7TA 1NRRH 2WV9A 3T27A 1AUJA 2GT8A 3M3SA 3OAAD 5EPYA 3PWCA 3GY6A 2P16A 1FAXA 4UFDH 1W7GH 1ZJKA 4CSYA 1SGPE 2WV4A 5AHGH 1O2XA 1UTMA 1ELCA 2WPJS 3T26A 4IN2A 4K1EA 1O2QA 4CREA 4TY7A 1BRBE 3MU4A 4MPXA 1NT1A 3ZZ4A 1NRNH 5DGJA 1TONA 1EKBB 3Q00A 2UWPA 3OP8A 1O2ZA 1C5QA 3BSQA 3IU3I 1C1WH 1EUFA 3M37A 1HAOH 3STIA 3SORA 2ZDLA 1C2FA 2EEKA 3GOVB 2BYAX 1ZLRA 3BEUA 3HATH 4HGCA 1GI8B 1Z1IA 3ZLDA 3ZYDA 2IJD1 2KCAA 3MU1A 4FVDA 3KQEA 3RXOA 2F3CE 2BZ6H 4XSKU 4PO7A 4HZHA 2PFEA 2BY8X 2V7QD 2ZPSA 3TITA 3KQ5A 1TQ7B 1Z1JA 4X1SU 4A1VA 4B73A 3RDZA 1B0FA 3GS9A 3RC4A 5C0TA 1F2SE 1Z7KA 5B6LA 2O8MA 1PPQA 3M5OA 2ERJA 3F9HA 4H4FA 4O97A 1GBAA 3SGQE 2KMSA 1O5CB 2I6QA 2BLQA 1MUEB 1GHWH 1K1IA 4IC6A 3CNRA 1W12U 1IQGA 5A0BA 1ELFA 2H2ZA 1D3PB 2JDID 3RC5A 2BY9X 4ASUD 1ABJH 3P6ZB 1IQLA 1O2HA 2ZU4A 2PGBB 4ZHLU 2J98A 3M35A 1K0HA 2WUCA 1O31A 1A3BH 5EG4A 1ZMNA 4CR5A 8GCHF 3FO8D 2XCFA 2AH4X 5A8XA 2UWOA 2KRIA 1S84A 1VZQH 2ZHEH 4GHTA 1GG6C 2SGAA 2BOKA 2AGGX 5K0HA 1FN6A 4WXVA 3F9EA 3OSYA 1ZTLA 3UFAA 2W80A 2Y7ZA 4ACBA 1UK4A 1VITG 2WPKS 4ESTE 2QCYA 1SBWA 1TAWA 5AFYH 5GPIB 1A0HB 1BRAA 1HLTH 1XVOA 2ZFPH 1CQQA 2UWLA 3ATKA 3DSGA 1EP5A 5E2PA 2P3FH 1SGYE 3RMNH 5DP5A 1SR5C 4ABHA 3BIUH 3GY5A 2XBYA 3KYGA 1D3QB 5FBIA 4RN6A 3S7KB 1K1OA 3H7OA 4K2YA 1HFDA 1UW7A 4NIVA 2A4OA 3EJHA 1C5ZB 4OS2A 1ESAA 1S83A 4OS6A 5AFZH 1EZUC 1JIRA 1Z6JH 5GIBA 1H2PP 2J38A 1LVBA 2GMTB 2BHGA 1HV7A 2UUFB 6GCHF 1AHTH 3OTPA 3UPEA 3CALA 4X2XA 2Y8RA 4UDWH 5L2YH 1QRXA 1P2NA 2YBYA 2Z9LA 3EDXB 4SGBE 1TLDA 1QB6A 3ATIA 4MVNA 1Y3VA 2W5EA 1C1VH 1BRCE 2HNTC 1BTWA 2R2MB 2P8OC 3FZZA 1EAWA 1K21H 2Y5HA 3GY3A 3LJOA 1INCA 2M5TA 2ULLA 4XBDA 4AGKA 3SU5A 2BQ7B 4Y7AA 2VINA 1FY1A 1HAVB 1HPGA 3UREA 2F83A 3K3TA 4OS5A 4GLYA 3LGYA 3T28A 2VNTA 4DJZA 1O3EA 4K8YA 1DUAA 2XWJI 2PKAA 5ESBA 1QBVH 2FO9A 7GCHF 1CHOF 2L6OA 1LMWB 1O2GH 1L0ZA 1D6RA 4OS7A 1DPOA 4NIWA 1O5BB 2ZGCA 5EXLA 1W8BH 1QL7A 2ZDVH 3RXEA 2WIIC 1CA0B 3WSYA 4KTSA 3KHVA 3TJOA 2EC9H 2QY0B 3DA9B 2Q1JA 3QUMP 4CHAB 2QIQA 3GCTG 2HRVA 4U30A 4TYDA 3TGKE 1GMDG 1O3HA 2BXUH 1VCWA 3UUZA 1SFIA 5LPFA 1BTPA 3UQVA 1TPPA 1A0LA 3U1JB 3I29A 3NXPA 1GI0A 3VB7A 3L33A 4NA7A 1WQVH 2GV7A 4YM9A 4K3JA 3UWIA 1MTNB 4ABFA 3VG8A 1YPHC 4IMZA 2J34A 4UFFH 4MNXA 3GCHB 3HGPA 4DT7B 2F43B 2F91A 1F7ZA 4TPIZ 2HNTF 4ZH8A 1PQ8A 1HJ8A 4A7IB 5BPEA 2HNTE 2VVVA 4MNYA 3IWMA 4UD9H 4AG2A 2PUXB 2BQ6B 1MCVA 2LNCA 1PPFE 4X1QU 3BEIB 2PWXA 3V3MA 1BDAA 4O03A 4E7NA 3NPSA 1WUNH 1D4PB 1LDTT 1SGTA 1TNLA 1TNKA 2QV1A 3ELAH 3KL6A 1S5SA 2FPZA 1YPLH 1YKTA 3NK8A 3CS0A 1AIXH 3QX5H 1EAXA 3EQ0H 3T29A 2P3UB 2G8TA 1KXAA 3UNQA 2QE7D 1J17T 1GWAA 4H6TA 4TT3D 5C1UA 1COWD 5E2OA 2QF4A 1BTHH 5IYTA 1QR3E 1MZDA 2H5DA 2GJGA 4ABBA 3S9CA 2H9TH 1GPZA 2G52A 2QF3A 5I25A 4VGCC 4P00A 2GGVB 2IZ4A 2XC0A 3RXDA 1VITF 1TMTH 4DOQA 3BTFE 1L4ZA 2AHME 3SHCH 1C5XB 1YC0A 1T32A 1ETSH 3FAOA 1ELGA 1W14U 1PFXC 2C3SA 1WOFA 3UWJH 1K22H 1UCYH 4FVBA 3VB5A 1PPGE 2Y82A 1RTLA 3RU4T 1FY8E 3WWBA 4ZKRU 1S82A 1P2OA 3KGPA 1EOLA 2W7UA 4YESB 2HPQH 2ZTXA 2XWBI 2Z3DA 2J5UA 1DICA 5I0QB 1P02A 1YPHE 2AYWA 2G51A 1YY3A 1KMHB 4CBOA 2AMPA 1HUTH 1OK9A 3ODDA 4ZKNU 1G4GA 1E38B 4J2YB 5DJ7A 1V2KT 1OJWA 3DCLA 4X0WU 2KCPA 8LPRA 3F3BA 2SNWA 1H4WA 2FXRA 5FO8C 1MKXK 3VXFH 2MCZA 1SHYA 3GDVA 1C1SA 1UTNA 4BAKB 5HM9A 2H1UA 3UTUH 3SQHE 3LGUA 1QURH 2CF9H 3MH5A 3MU8A 2WINI 1E1QD 2B9LA 2O8TA 2PUQH 1T4UH 1LPZB 2EA3A 4FUCA 3ZVGA 4A92A 2FOAA 2WPLS 1AN1E 3I78A 1FNIA 1E34B 2A4GA 2ZU1A 3BTWE 2TIOA 1RTKA 2Y5GA 3C1KA 3HKJB 4JZEH 5KEDA 1ZGVA 1KDQA 2G55A 5JBBS 3SI4H 3A82A 3SUFA 3EGKH 3A83A 1YBWA 1ZR0A 1QL8A 1QJ6B 2STBE 1GVKB 5AF9H 2QXGA 1NU9A 2J98B 3OEDC 1Y5BT 3RXVA 4GUXA 1HCGA 2J92A 5FPSA 1Z92B 1OWJA 3RXFA 3SBKA 3QLPH 1O35A 2ZHDA 4CH2B 1GBMA 1GBTA 4FUHA 5FXLA 4ABIA 2KAIB 1C2IA 3U98H 2XW9A 1VR1H 3HPTB 1WAYB 3PWBA 1H2QP 1BJUA 2OLGA 2ZEBA 2B0FA 1NBME 1SI5H 3RM2H 5FCKA 1C1MA 3A89A 1GBCA 3RJ3D 2FX4A 2VU8E 2F9OA 2UUKB 4OS4A 1EXFA 1ORFA 1VCPA 1AB9B 2H9HA 4B2BA 2AGEX 1AZZA 2C8ZB 4DW2U 2DE8A 2B7DH 1FLEE 1A7SA 2C90B 2ZTYA 3MNCA 4O9VA 3QDZB 4NWKA 1FV9A 2R0KA 4WH8A 4AG1A 3UOPA 3LT3A 2VH6A 2TGTA 4CBNA 2ZDKA 2Y80A 3TGJE 4XE4A 4YXWD 3ZZ3A 1GMHF 4NGAH 4YT7H 1THRH 2UWNA 1H8ED 1EJMA 8KME2 2ZGBH 1O5DH 1U5MA 1Y8TA 4MLFB 1CGJE 4HG6A 2XBXA 2A7JA 3WWFA 1NZQH 1TMBH 7LPRA 3LDXH 1QQUA 1EZSC 1K9OE 2J4IA 1MTVA 4ISOA 1AB9C 4IBLH 1MBMA 1H9IE 2BVSH 1ZGIA 2H5CA 3ZZ9A 3SGBE 3P8OA 5A09A 1FPHH 4ISHH 2ZF0H 1QRZA 2YRAA 4DJZB 1O30A 2EQNA 2PKAB 5CHAB 3TU7H 2ZFRH 3URDA 1MTUA 2TGAA 1DITH 1V2VT 3CENA 3M5NA 2OQ5A 3SJIA 1A5IA 4M9FA 4A1TA 2GCTC 1FN8A 1SQTA 1SLXB 1TPOA 1HXFH 1HXEH 3ZVDA 2EI8A 1TE0A 1A0JA 2IZ3A 1CKLA 2XRCA 2FI4E 5JBCS 1A5GH 3A85A 1L1NA 3R62A 1S6FA 4IMQA 3E90B 2ZU5A 3F6KA 3BG4B 5EGMA 1TGCA 1AD8H 5ESTE 3MH6A 8GCHG 4Y10E 1C2JA 1DSTA 4A1XA 1ETRH 1T7CA 4LK4A 1QBNA 1A2CH 2F9NA 3A8BA 3SHAH 2H9EH 3MH7A 4BAMB 3DHKH 1TIOA 2IPHA 1IOEA 2CJIA 1GVZA 3SUGA 2Y8TA 1QQ4A 3BTME 1ELVA 3SW2B 3DFLA 1HIAA 4XRNA 1GBIA 4MPWA 3D65E 4SGAE 1C4V2 1P11E 3FFGA 1DE7H 3AVZA 3JZ2B 3PMBB 4H42U 1TPGA 1SMFE 1IQEA 2FP7B 3SJOA 1YCPM 1C2DA 2VGCB 1GI7B 3TH2H 3PLPA 2BQWB 6GCHG 1W0KD 1DSUA 3RU4E 4MSLA 1LVOA 1O3CA 2XBWA 5C1YA 3RC6A 4CRGA 4TWYA 2GD4B 2HVYB 1DM4B 3SU1A 5LH8A 3LJJA 3MQKC 4LOSA 2JETC 1UOTP 1XUFA 3PTBA 3BG8A 3OY5U 5E8EH 1H8DH 1TBQH 4C16A 2BMGB 5HGGA 1DWDH 4JHSA 1K1PA 1S81A 1NRSH 2OP9A 4F49A 3RXIA 4D7GA 1N6XA 4B74A 2VWLA 5A2MH 5HYUB 2W3IA 1LY2A 3RXKA 3SN8A 4FXGH 1C1TA 1BTZA 3DT0H 2A7CA 1BRUP 1DOJA 1P3EA 1W7XH 2OD3B 4NFFA 3UOUA 4NG9H 3MO6A 1AGJA 1DS2E 4MNWA 6LPRA 4TWWA 4OM9A 2WSSD 3ATWA 3EE0B 1G3CA 1TGNA 3ZZ8A 1ZPCA 4NIXA 2ZGXH 2R3YA 1K28D 1HDTH 1GBKA 4NA9H 7GCHG 2VGCC 1CHOG 3I77A 2FYRA 2ZQ2A 1C2KA 3FN8A 4YIZA 3PV2A 2A5KA 1RIWC 3AAVA 2H6MA 2ZU2A 1ARCA 3MQLA 4AFQA 1G2LA 3WSXA 3M3TA 1O3PB 1IQIA 3FKSD 3ZZAA 2ZU3A 2PSXA 1DFPA 4ONTD 2ZGJA 1ZOMA 1SGRE 4Y76A 4BTIB 2XOKD 3O8RA 4XBBA 1G4FA 1YWUA 1O3NA 1H03P 2BB4A 1GJDB 1NESE 2FOCA 1VKYA 1FY5A 8ESTE 3BTKE 1HNEE 2K1QA 4UFGH 2YOLA 4PZ5A 1OWDA 2WPHS 3D23A 1TQ0B 5AVDA 1JOUB 1XXFA 3E6PH 1GHYH 1O2WA 2VWNA 4E05H 5HZPB 1F92A 3VFEA 4X6MA 2KM0A 1C5MD 5ABWA 3KF2A 3RXRA 3PMHB 2BM2A 2B5TB 3U8OH 5T6DA 4RSPA 1EAUA 1O3FA 4AC9A 1NROH 1B0EA 4P02A 3DSPA 1VJ9U 1Z71A 3SNDA 5CDFE 2A0QB 1DT2A 1GDNA 2LELA 4AN7A 1EPTB 2GP9B 2OC1A 1QY6A 2V8EA 1TGTA 1LHGH 4AYVB 4Q4LA 2LPRA 4APLA 1VGCB 1BMFD 2M2AA 5PTPA 4MTBA 1GBEA 5DP4A 1E36B 3KXVA 1O2IA 1ANBA 2ZHQH 4MQAA 4NSYA 4BAQB 2BLVA 1MU6B 3F0OA 4NZLA 1TNGA 1RJXB 2Y8SA 3LGWA 3ERBA 1HFIA 3ZVEA 5CE1A 2ZNKH 2FLRH 3SU2A 1QO6A 2ZZUH 3M7QA 3O8BA 2CN0H 1DX5M 1SGIB 2CG7A 3TH4H 4CRAA 1HJAB 2RKYA 4ISNA 1CA8B 3PV4A 1KLTA 3Q3XA 4THNH 2XYAA 1P2QA 5TCAA 2XNIA 1O5GH 3ESTA 1KXBA 3SU0A 2BDGA 3BTHE 1UVSH 1C1UH 1ELTA 4RKOB 4FUBA 4OGXA 2HVXA 3FZDA 1MQ6A 3MYWA 2BD5A 1G3BA 2FESH 3SNAA 1EPTC 1SGDE 1BT7A 1TBZH 1RRKA 3P70B 3AASA 2YNAA 2DE9A 2ZDNA 1GMCF 4XBCA 2RFKC 4WMDA 1G3DA 2A45B 2FOHA 1ZRBA 5DG6A 1O2TA 4F48B 1SS2A 3VEQB 3KN2A 3QTOH 4KP0A 1SLWB 1Y3YA 4AYDA 4UE7H 2YMSD 1FY4A 1ZHRA 4NZQA 3GY2A 4Q7ZA 1GBLA 1O33A 1GGDB 2A2QH 3RXJA 5DPAA 1BB0B 1TFXA 1O0DH 3A8DA 1O36A 1V3XA 1V2PT 1QB1A 2BZMA 1AQ7A 1C5VA 1F5LA 2VIVA 1AE5A 1OYTH 1TA6A 2PKSB 2Z3CA 1KIGH 4I33A 5ETXA 4ZMAH 3MNBA 4R8TB 3EA9A 4K1TA 3O8EB 1E0FD 1OJYA 1KXEA 4FUIA 4QT8C 4FUDA 5DN4A 5GCHF 4B6FA 1PQ7A 5HYTB 3FP8E 1Z8JB 2ZC9H 4HI3A 1AE8H 3KEEA 1UTKA 1K1JA 1UVUH 1TPNA 4X1NU 1L2EA 1K1NA 3F2FA 4ASHA 3MO9A 3SNEA 1P10A 1A3EH 2ZG0H 3LGVA 3PM3A 5HM2A 1XVMA 1ETTH 1ELAA 4Y71A 4MUCA 1LTOA 2QC2A 4E06H 2G4UA 2GMTC 4BTTB 3RMOH 1XUHA 1BMAA 3QN7A 2ODQA 4U2WA 1V2MT 2FS8A 3LGIA 3UNRA 1NFWA 1D9IA 1GGDC 3IG6B 3UR6A 3S0NA 3ZLEA 2CG6A 1NRQH 4WWYA 9ESTA 3C27B 1FXYA 2QF5A 4AYEA 4WMFA 5E0HA 1QA7A 5F8TA 1BCUH 3IITA 3RXSA 2V0BA 1Q3XA 1DVAH 3MWIU 1KY9A 1P3CA 4X8TH 4IC5A 1THSH 1GBDA 5HIZA 2KX4A 1T8LA 1ANCA 1BTXA 3B8JA 3FP7E 1A46H 4K69A 1W3CA 1XMNB 3M5LA 3FVFB 3F68H 1NU7B 2G4TA 1UVOA 3P8GA 3P92A 3VWOA 4GSOA 1L1GA 3PB1E 4FUFA 1OYQA 2NU0E 4GAWA 2TBSA 2AERH 4I8JA 2Z9IA 2THFB 3M3VA 1CT2E 3S9BA 1N1LA 2D2DA 3RXQA 1ZTJA 2CMYA 1C1ZA 1BHXB 1HIAB 1AUTC 3Q76A 3K65B 1ZSKA 2GTBA 1O2RA 1CA0C 2V6NA 1GJ9B 3E0PB 1SGCA 3Q3KA 2PR3A 4JMYA 3EA8A 3N7OA 2V3OH 5C17A 2C8WB 1AFQB 2JIZD 1QL9A 4CHAC 1YGCH 4I7YH 1P57B 4AORA 2K0QA 1P2MA 1ANEA 1ELDE 1BOQA 2A2XH 2KR7A 4CRCA 1U6QA 1J8AA 3TVJB 4DURA 1LO6A 2RL0A 1NY22 3KQCA 1Z8GA 1GMHG 2VB0A 5CMXH 4Y0YE 1QIXB 2FMJA 3A7TA 4XD7D 2EY4C 1IQFA 1MTNC 2A5IA 1H04P 4ACAA 3GCHC 4M7GA 2ZHFH 3HK3B 3MNSA 4KELA 2TPIZ 3RUOA 2G7IA 5C2ZA 4RI0A 1GHVH 3LH3A 2QYIA 2BDIA 3SV7A 3TJNA 1TRMA 1TBRH 4TPYA 2G5VA 4JK5A 2XRDA 2F4LA 1EJAA 1TOCB 3FANA 2RDLA 1A1RA 3MU0A 3UY9A 3ODFA 1GJCB 4AGJA 2ZFQH 1YM0A 1PPHE 3M5MA 4IGDA 3WY8A 3U69H 4YT6H 2BZAA 4DIHH 6CHAB 1VVCA 1NFUA 2ZYCA 4F55A 1ZTKA 1GCTB 2W6JD 1QGBA 1LVMA 1LQDB 1O2NA 1MMJN 2PP6A 2PW8H 2VWMA 1EZQA 2AIQA 1G2MA 4I8HA 1NO9H 1DLKB 3F2GA 2FOGA 4AFZA 1V2LT 1RS0A 4A5TS 1MU8B 7KMEH 3PLKA 1P2JA 2V3MA 1DXWA 1BBRK 1WCZA 3N7EA 1P9SA 3SI3H 5EJ1A 1BBRH 3TJUA 1PYTC 4YZUA 1MKWK 2Z6BD 5SGAE 5GWZA 4LXBH 5T6FA 5B6OA 4Q7YA 1J9CH 1FMGA 1WSSH 2P94A 6ESTA 1DANH 3DUXH 3LPRA 4RT1A 1E37B 1MKXH 1HAPH 3CS7A 2R3UA 2ZIQH 1IQMA 4RKJB 1Y5UT 1UHBA 1Q31A 1O32A 5FHTA 2FYQA 3RLWH 3OYPA 5JBTA 1T8NA 2Z94A 4E7RG 4PROA 1IQNA 2EHFA 4WJG2 3SQEE 5C0UA 2XWBF 3O8CA 1BZXE 4KTUA 4XOJA 1FPCH 2ILNA 4MNVA 3A7YA 4XFQA 1P04A 5JPMH 1MD7A 3KQBA 2AEIH 3GXEA 1YLDA 3V0XA 2PV9B 1C9TA 4X8UH 1N8OB 1F0UA 1LVYA 4X8SH 1YPGH 2FOBA 3S7HB 4B2RA 1BTYA 1DWEH 2VVUA 3V13A 1C2EA 1UTOA 4X6PA 3AAUA 1FONA 1D6WA 1V2QT 1GI5A 3GICB 1FBRA 1O2SA 1QJ1B 3P8NA 1SVPA 2X2ZA 1O3KA 1HBTH 2OTVA 4R0IA 1F0TA 1YLCA 4GVUA 5IK2D 1SRZA 5LPEA 1SGFA 2R9PA 1SGEE 3M36A 4FUEA 3KQDA 3FOAA 2VIWA 5F03A 2QXJA 1GCDA 3LH1A 3T25A 1JRSA 1P09A 3UNSA 1ZHPA 4DT4A 3MTYA 1CBWB 1HYLA 3NCLA 1QFKH 1QA0A 2OC7A 2CK3D 3M7TA 1TRNA 1QBOA 2LP6A 3UR9A 5JBAS 4I31A 1W2KH 1QJ7B 4Q7XA 1TNIA 4Q2KA 5G4BA 4ABAA 1XUGA 2WPIS 1WXRA 3B9FH 3ZZBA 1UTPA 3PO1B 5LGOA 2QAAA 2V35A 1D3DB 2JGXA 5FBEA 4WH6A 4FUJA 1GL0E 1O2LA 2PTNA 4U01A 2HOBA 4Q63A 3QO6A 2PSYA 3A7XA 5E0JA 1TOMH 5KGOA 4ISLA 1SG8B 3PV5A 4J1YA 1UVPA 2CXVA 1S0RA 3OY6U 4ZUHA 1JMOH 3RXUA 3TNSA 1C5RA 2RCEA 4GCHF 4Z0KA 3SJ9A 2GZ9A 1O2UA 1FIZA 1NWVA 1AWHB 1DLEA 2BY5X 3ZRZA 2ZFSA 4AOQA 4ISIH 3LC3A 5H4IB 2O9QA 1MABB 2VJ1A 2GV6A 1P05A 1GKGA 2R2WU 5DP7A 5T3HA 3D62A 1GBHA 1QUBA 1RGQA 3OXUD 1ARBA 1SC8U 1VCQA 1NFYA 3SUEA 3TK9A 5JB8S 3VB3A 2J94A 1QHRB 2GVFA 2JKHA 4UONA 5DO4H 2FI5E 3RMMH 1NS3A 1W11U 1C5UA 3PYHA 3QK1A 2MCYA 3ATLA 3UQOA 2BX4A 4K12A 1UTQA 1HAVA 1OP8A 2P95A 4IW4E 3BEFB 5A8ZA 4BANB 2CHAB 2FS9A 1FI8A 2ZHWH 2RDEA 1AWFH 1C5WB 2XQWC 5CHBA 2BX3A 1TALA 1YP9A 2A1DB 1AVWA 3BTTE 1SGQE 1TX7A 5EJZA 3H5CB 5GJ4B 4Y11E 4X2VA 3CP7A 1YCPK 2ZQ1A 3STJA 1V2RT 2IOTA 2BVRH 2K8IA 1KXCA 2XWAA 1PPZA 1O3IA 3AW1A 4K8BA 1WDIA 1EX3A 4CRFA 1SQOA 4D8NA 1F0SA 3EYDA 1AI8H 1MH0A 4X2WA 1ZZZA 5CHAC 3LGTA 2QY0A 2HWLB 2P93A 1P2IA 1SSXA 2NU1E 2GCHF 1V6DA 5FAHA 2TGDA 3GYLB 5I46H 5EQRA 1EZXC 4WY3A 1DWBH 5HKKD 1BBRE 1CT0E 1H8HD 1O3DA 5GNDA 4DGJA 1O3GA 2C8YB 1TNHA 3PRBA 1ELEE 1OJVA 1WU1A 1P06A 1JRTA 1O3JA 3K6ZA 1GMCG 3ZVFA 3IX0A 1QNJA 1HAIH 3FGRA 1ZHMA 2ZDAH 2ALVA 1E1RD 1O3OA 1TRYA 2FIRH 1YPEH 1AVXA 4WVPE 5EU8A 1BMMH 4AYMA 1EATA 1HAZB 2Y5FA 1LHFH 1LHCH 2VBCA 4KTCA 5T6GA 2ANYA 1V2OT 1S0QA 1T8MA 3SO3A 3BG4C 1FX0B 2NU4E 3ZYEA 1DDJA 4J38B 3DFJA 1O2KA 2ZP0H 4MPVA 1RD3B 2QN5T 1IAUA 4I8KA 4XDEA 5C94A 3E16B 1FUJA 4O3UA 1BMNH 1KSNA 1HGTH 3OE7D 2Y7XA 3QZRA 3ZD1A 3VPKA 4AB9A 1HCCA 2QA9E 3OU0A 4CRDA 4AX9H 3M7PA 1EQ9A 1O3BA 5BRRE 2A4QA 3BV9B 3P17H 3NZIA 5GCHG 3SV9A 2RA3A 3E1XB 1WBGB 4INHA 1O2MA 1ESTA 4YLUA 4ZROA 1GI9B 3KCGH 1C5SA 3NKKA 3TNTA 3A80A 2F9UA 4CRBA 1B5GH 1RXPA 7ESTE 1BTUA 5DP3A 3OEED 1O2YA 1SLVB 3TJVA 3ZD2A 2A7HA 3LKWA 1CO7E 3M7UA 1AO5A 2KFWA 3ZVAA 4FXGG 2A4RA 1KTSB 1JIMA 1TPMA 1WTGH 2F9BH 2IPQX 4ABGA 3A8CA 1K1LA 4JYVH 2JGWA 4TY6A 4CR9A 3RXTA 1S6LA 1SGFG 3LONA 2ASUB 4I8LA 5FCRA 1TB6H 4D76A 1EOJA 1G9IE 1X7AC 1OXGA 2FTLE 4LOTA 2OBQA 2G00A 3TK5A 1XUKA 2JH5D 4NIYA 2WHXA 3QGJA 3W94A 1E88A 5EOKA 4BTUB 1XX9A 1UO6A 1W0ZU 2FEQH 2A32A 1QTFA 5IDKA 2ZCLP 1O3AA 3RXPA 2SNVA 2ZI2H 1O39A 1YPKH 4ABDA 1UHBB 2L74A 1CSOE 3ZZCA 3MH4A 4WXIA 3SU6A 2RG3A 2WZQA 1JBUH 1OHHD 1YLNA 5FPYA 1HFHA 1C2MA 2KCYA 1GHAF 1GI3A 4AFSA 2SGPE 4Y0ZE 5J4SA 2YMSB 2PLXA 4FU9A 4X1PU 4FOUC 2OC0A 1UK3A 2ANMH 2WUBA 3N7DA 3OTJE 1HJ9A 2A55A 1LKBA 3HGNA 2BY6X 3GISB 1KDQB 5EPNA 2F9PA 1V2WT 3EA7A 1ZMJA 5F6MA 4ZHMU 1GG6B 1OPHB 2GT7A 2GX4A 3R3GB 3GCOA 1OOKB 2J95A 4B2SA 1AVGH 2O39C 1LHDH 2KCOA 1P03A 2FTMA 3INBC 4X6OA 5DSFA 1O34A 1RFNA 3QZQA 1SOZA 2Y81A 1O2PA 1GBJA 2J9NA 1SLUB 1CVWH 3V12A 1OWKA 2ZKSA 3Q3YA 5DP8A 1G36A 1GJ4H 1AMHA 2BLOA 3SJ8A 1O37A 3E0NB 1PPBH 4AYIA 1VITH 4JZ1A 1XUIA 2YMSC 1C2LA 1BIOA 1MCTA 2ODPA 4B76A 3L3TA 1UVTH 1NRPH 3FGTA 5FX5A 1EJNA 4ZXXH 4JK6A 2KAIA 3N99A 1NPMA 1WV7H 3VB6A 1VGCC 2V3HH 5DN5A 2G5NA 1E8BA 3UAIC 1DXPA 1EFRD 2AIPA 1F0RA 2P8OB 1ANDA 1OP2A 2SGEE 3A88A 1O2OA 3JZ1B 2W26A 3MI4A 2VIDA 1LPGB 3SYJA 4X2YA 1HJAC 1V2ST 1W0YH 4A5WB 1OKXA 3HK6B 2XRBA 2XC5A 1EP6A 1DWCH 1OWHA 1TNJA 3OEHD 1GBBA 1LKAA 3RXBA 1FY3A 2UUYA 4K1SA 4U32A 1HAYB 3QTVH 1PQAA 1DUEA 1JWTA 1CT4E 3VB4A 2R0LA 4BXWA 2VWOA 2Z9GA 5EIYA 1J14A 1H9LB 1KXFA 3BTGE 2ZCHP 1CE5A 5JYIA 1TX8A 1AKSA 1KLJH 1OSSA 3A7VA 4ZXYH 2JH0D 4H6SB 3A7ZA 3SNCA 3SNBA 3ATMA 1C1PA 1GHBG 1GJ7B 2I2LA 1ZPBA 3RMLH 5LPRA 3S9AA 1Y3WA 4ZAEA 5F8XA 1MD8A 2D8WA 5HYOA 1ESBA 1H1BA 4JZIA 4K60A 3L89M 4B71A 2JJ1D 4Q80A 1C4Y2 3A84A 1O2JA 1HB0B 2Q6DA 5HIYA 3E91A 1GI1A 3A8AA 2P3TB 1Y3XA 4N7EA 1C1OA 1EB1H 1SGNE 2W7SA 1H8IH 3A7WA 3MMGA 2CV3A 3GY7A 4A6LA 5C1XA 3T2NA 1G37A 2SGDE 2PKSC 1P01A 4X6NA 3VXEH 3B23B 1AZ8A 3WW7A 1GI6A 1OP0A 3ZZ5A 2AMDA 5EQQA 3QGNB 1NTPA 1YPJH 2XXLA 3BTQE 4Y8YA 4ABJA 4BNRA 1W13U 1JXPA 1PQ5A 2HLCA 5DP9A 1UK2A 2VIOA 3U8RH 2RA0A 4DVAU 2TRMA 2BDCA 2VH0A 3MU5A 1T8OA 2QXHA 5EW1H 4OS1A 1PPCE 3S69A 3ZVCA 1IQJA 1DY9A 1UTLM 3G01A 2DUCA 2ESTE 2ZPQA 4OGYA 5FL7D 1E5GA 1YF4A 4CH8B 3RXMA 2FX6A 1K1MA 3DSOA 5K7RA 2O8UA 5FPTA 1WTHD 2PHBA 1L1JA 2A31A 3ZV8A 1QGFA 2FM2A 1NFXA 1KLIH 2AFQB 5L30H 2B8OH 4NA8A 3PROA 2AS9A 1EASA 5C3NA 2HGTH 1Q2WA 1GJBB 4D9RA 1BUIA 3SGAE 4VGCB 1SQRA 1QZ8A 2C4FH 3RXHA 3GYMA 4IN1A 1C9PA 1UJ1A 2FI3E 4JCNA
chains in the Genus database with same CATH topology
2LOJA 4FUGA 1UMAH 1SFQB 1FZZA 2WYGA 1BA8B 3SZNA 1ZPZA 2ZPRA 3F9GA 4GCHG 2ANKH 1C5NH 3P8FA 1P12E 2GZ8A 2OCVB 3ZZ6A 3PLBA 2NWNA 1XUJA 2PGQB 1ABIH 3BTEE 3T5OA 1GVLA 1BITA 2BD9A 3MNXA 4UEHH 1HAGE 4Y8ZA 1GJAB 2EC3A 1ZSLA 1FJSA 4WMEA 1B7XB 2GDEH 5E0GA 1OK1A 1SB1H 1YYY1 1SPJA 2JH6D 2XBVA 2ZECA 3M61U 2GZ7A 5FX6A 1AFQC 1HRTH 2GKVE 1TYNA 4KGAA 4Y8XA 1Z6EA 5C5NA 2QXIA 1O5EH 1LQEA 4INKA 4INLA 2BTCE 3U1IB 5L6NH 3PTNA 4AZ2B 4O3TA 2C8XB 2YNBA 2Q6FA 3RXCA 4B1TA 3F6UH 2FZZA 5EW2H 1UCYK 4Z6AH 5L2ZH 1IHSH 1GJ6A 5TJXA 1C4U2 2GDDA 1V2UT 3VGCB 1EAIA 2AGIX 2BDHA 4D9QA 1GDUA 3BF6H 1EB2A 5DP6A 4NSVA 4NFEA 1GI2A 2PTCE 1GDQA 1O38A 2QF0A 4BXSA 3RXAA 1TA2A 1QB9A 2ANWA 2XTTB 1W10U 1MKWH 1PJPA 2ODYB 1CU1A 1FIWA 2EI6A 1E35B 2Y6TA 1HAHH 4MG3A 4X8VH 2WYJA 1KYNA 2O8LA 4I8GA 6CHAC 5F8ZA 2SGQE 1GHBF 4YNXA 2GCHG 2TGPZ 2Z3EA 3ZVBA 1GCTC 1GHQB 2OUAA 3TPIZ 3QWCH 1QCPA 5JDUB 1P8VC 3GOVA 1Y59T 1VVDA 4NWLA 2ZFFH 2XCNA 3GY8A 3P95A 5DK1A 1ZYOA 1HAXB 1TMUH 3Q77A 1BHXF 1TGSZ 3VGCC 1TWXB 3BN9A 3K2UA 1T31A 4WF8A 1TABE 2IJOB 3SW0X 1PYTD 4DCDA 1G30B 1FDPA 2FOMB 1P2KA 1F5KU 3UIRA 2BOHB 1SHHB 1FQ3A 2BVXH 2FODA 2BLWA 2B5ID 1TPAE 3A87A 5JPMG 1C1QA 1EPTA 5GXPA 2NU3E 1F5RA 1OWEA 3TK6A 2IN2A 3RXGA 1SOTA 3LOXA 2ZA5A 1SL3A 4LOYH 4K5ZA 1MBQA 1IQKA 4HFPB 4AYYB 4LZ4B 3ZV9A 4IS5A 4ZH1D 1THPB 3GCTF 1CGIE 1VJAU 2OC8A 2BXTH 1GHZA 1ZRKA 4GPGA 1GMDF 3BIVH 1NN6A 1ZJDA 2HALA 4X1RU 4BAHB 1N8OC 1M9UA 1XXDA 3LIWA 1BQYA 4ABEA 1GJ5H 1C5OH 3TIUA 1A4WH 2W3KA 3RM0H 1LCYA 1L4DA 1P9UA 3F1SB 2SGFE 2VVCA 3SV8A 1A61H 4ZKOU 4B75A 4DG4A 2OBOA 3MFJA 1C5PA 3O8DA 2BD3A 4BOHA 4JYTA 1O2VA 2OQUA 3T62A 1DY8A 1P0SH 2J2UA 1OK2A 1GKNA 3NUMA 1YPMH 1KTTB 1MAXA 2P59A 4Y7BA 1ID5H 4DIIH 4GHQA 3LC5A 1CBWC 3TLOA 1MTWA 1O3LA 2Z9KA 1Y5AT 1J16A 1S85A 2C93B 3NFPI 1RTFB 2ZGHA 1XM1A 5C5OA 1C1NA 2SFAA 1AKSB 1C5LH 2GCTB 2Z9JA 1WQSA 2CGAA 3OX7U 4HTCH 1ACBE 2A5AA 5A0AE 1ZMLA 5J4QA 2D1JA 3PO1C 2ZFTA 4YTAA 4YOJA 3RXLA 1C2GA 1O3MA 2G81E 2RKZA 1LPKB 2UUJB 1GHAG 1TPSA 1O5FH 1C5TA 3URCA 1Y3UA 4DY7B 1D3TB 1BJVA 5GDSH 2BD8A 1G3EA 2BD7A 4JYUH 3A86A 1IQHA 2FDAA 2Z7FE 1Z8IB 3PMAB 3KIDU 1V2NT 3R0FA 5C67A 4YOIA 2OINA 1UTJA 2ZTZA 2HPPH 1GJ8B 1A5HA 3HKIB 5TCCA 2BDBA 3DD2H 2D26C 1AY6H 1TX6A 1AFEH 3SU4A 2ALPA 9LPRA 3K6YA 3SV6A 3SUDA 3SOSA 3D49H 5EQSA 3LU9B 3MOCA 4Y6DA 3U8TH 3EAJA 2BD4A 1KXDA 2W81A 3GY4A 1H9HE 1YCPH 4YO9A 4YOGA 1C5YB 4D7FA 1G32B 2O8WA 3ZZ7A 3RU4D 1GHXH 4ZKSU 3GCNA 1O5AB 3SJKA 1OS8A 3ZZDA 5A0CA 1GL1A 2F9VA 3W95A 1AU8A 3L6PA 2ZWLH 4NCYA 1UCYE 1T4VH 3SV2H 3RLYH 4AB8A 1V2TT 2I6SA 1MAYA 1S6HA 1ELBA 4JZFH 1ZSJA 2BY7X 1GBFA 1N6YA 4UFEH 1CGHA 2CHAC 1XKAC 3T5FH 2FOEA 1C1RA 2EI7A 2JETB 2OXSA 3KNXA 3TH3H 5C20A 2BDAA 1OX1A 2ZDMA 1TGBA 3FP6E 1PPEE 4B2CA 4F4OC 3ITIA 2BDYA 2CF8H 4ZHAA 3ENSB 5EXMA 2BD2A 2VIQA 2QGRA 1NC6A 4Y79A 3KZJA 1Z8RA 1FAKH 5DKMA 1O9AA 2CKUA 3RP2A 3MO3A 5A8YA 5EXNA 4BAOB 4LZ1H 4JZDH 1QRWA 5JB9S 3E3TA 2ZO3H 3SU3A 4MPUA 2WPMS 1BMLA 1CHGA 3A81A 3TGIE 1RIWB 3F9FA 1LHEH 2Q6GA 1NM6A 3TVJA 1IHTH 1XKBC 4FU8A 1MTSA 1SQAA 3GDSA 3BTDE 1GI4A 2VIPA 3AW0A 4FU7A 3H7TA 3K9XB 1C2HA 1V2JT 3PMJA 1K2I1 2STAE 4KKDA 3NWUA 2FOFA 1OK3A 3MHWU 2FWWA 5EODA 2ZCKP 1MQ5A 2AMQA 4MDSA 2NU2E 3U9AH 4B2AA 2WV5A 2RLPA 1WYKA 2FLBH 5HXFA 5HMAA 1OWIA 1J15A 3E8LA 2XC4A 4I32A 1MZAA 4AFUA 2JRAA 3GDUA 5HYPA 4YLQH 2RLQA 3V7TA 1NRRH 3T27A 1AUJA 2GT8A 3M3SA 5EPYA 3PWCA 3GY6A 2P16A 1FAXA 4UFDH 1W7GH 1ZJKA 4CSYA 1SGPE 2WV4A 5AHGH 1O2XA 1UTMA 1ELCA 2WPJS 3T26A 4IN2A 4K1EA 1O2QA 4CREA 4TY7A 1BRBE 3MU4A 4MPXA 1NT1A 3ZZ4A 1NRNH 5DGJA 1TONA 1EKBB 3Q00A 2UWPA 3OP8A 1O2ZA 1C5QA 3BSQA 3IU3I 1C1WH 1EUFA 3M37A 1HAOH 3STIA 3SORA 2ZDLA 2EEKA 1C2FA 3GOVB 2BYAX 1ZLRA 3BEUA 3HATH 4HGCA 1GI8B 1Z1IA 3ZYDA 3MU1A 4FVDA 3KQEA 3RXOA 2F3CE 2BZ6H 4XSKU 4HZHA 2PFEA 2BY8X 3TITA 2ZPSA 1TQ7B 1Z1JA 4X1SU 4A1VA 4B73A 3RDZA 1B0FA 3RC4A 1F2SE 1Z7KA 2O8MA 1PPQA 3M5OA 2ERJA 3F9HA 4H4FA 4O97A 1GBAA 3SGQE 2KMSA 1O5CB 2I6QA 2BLQA 1MUEB 1GHWH 1K1IA 4IC6A 1W12U 1IQGA 5A0BA 1ELFA 2H2ZA 1D3PB 3RC5A 2BY9X 1ABJH 3P6ZB 1IQLA 1O2HA 2ZU4A 2PGBB 4ZHLU 3M35A 2WUCA 1O31A 1A3BH 5EG4A 1ZMNA 4CR5A 8GCHF 2XCFA 2AH4X 5A8XA 2UWOA 2KRIA 1S84A 1VZQH 2ZHEH 4GHTA 1GG6C 2SGAA 2BOKA 2AGGX 5K0HA 1FN6A 4WXVA 3F9EA 3OSYA 1ZTLA 3UFAA 2W80A 2Y7ZA 1UK4A 1VITG 2WPKS 4ESTE 2QCYA 1SBWA 1TAWA 5AFYH 5GPIB 1A0HB 1BRAA 1HLTH 1XVOA 2ZFPH 1CQQA 2UWLA 3ATKA 5E2PA 1EP5A 3SNCA 2P3FH 1SGYE 3RMNH 5DP5A 1SR5C 4ABHA 3BIUH 3GY5A 2XBYA 1D3QB 5FBIA 4RN6A 3S7KB 1K1OA 3H7OA 4K2YA 1HFDA 4NIVA 2A4OA 3EJHA 1C5ZB 4OS2A 1ESAA 1S83A 4OS6A 5AFZH 1EZUC 1JIRA 1Z6JH 5GIBA 1H2PP 2J38A 1LVBA 2GMTB 2BHGA 1HV7A 2UUFB 6GCHF 1AHTH 3UPEA 3CALA 4X2XA 4UDWH 5L2YH 1QRXA 1P2NA 2YBYA 2Z9LA 3EDXB 4SGBE 1TLDA 1QB6A 3ATIA 4MVNA 1Y3VA 2W5EA 1C1VH 1BRCE 2HNTC 1BTWA 2R2MB 2P8OC 3FZZA 1EAWA 1K21H 2Y5HA 3GY3A 3LJOA 1INCA 2M5TA 2ULLA 4XBDA 4AGKA 3SU5A 2BQ7B 4Y7AA 2VINA 1FY1A 1HAVB 1HPGA 3UREA 2F83A 4OS5A 4GLYA 3LGYA 3T28A 2VNTA 4DJZA 1O3EA 4K8YA 1DUAA 2XWJI 2PKAA 5ESBA 1QBVH 2FO9A 7GCHF 1CHOF 1LMWB 1O2GH 1L0ZA 1D6RA 4OS7A 1DPOA 4NIWA 1O5BB 2ZGCA 5EXLA 1W8BH 1QL7A 2ZDVH 3RXEA 2WIIC 1CA0B 4KTSA 3KHVA 3TJOA 2EC9H 2QY0B 3DA9B 2Q1JA 3QUMP 4CHAB 2QIQA 3GCTG 2HRVA 4U30A 4TYDA 3TGKE 1GMDG 1O3HA 2BXUH 1VCWA 3UUZA 1SFIA 5LPFA 1BTPA 3UQVA 1TPPA 1A0LA 3U1JB 3I29A 3NXPA 1GI0A 3VB7A 3L33A 4NA7A 1WQVH 2GV7A 4YM9A 4K3JA 3UWIA 1MTNB 4ABFA 1YPHC 4IMZA 2J34A 4UFFH 4MNXA 3GCHB 3HGPA 4DT7B 2F91A 1F7ZA 4TPIZ 2HNTF 4ZH8A 1PQ8A 1HJ8A 4A7IB 5BPEA 2HNTE 2VVVA 4MNYA 3IWMA 4UD9H 4AG2A 2PUXB 2BQ6B 1MCVA 2LNCA 1PPFE 4X1QU 3BEIB 2PWXA 3V3MA 1BDAA 4O03A 4E7NA 3NPSA 1WUNH 1D4PB 1LDTT 1SGTA 1TNLA 1TNKA 2QV1A 3ELAH 3KL6A 1S5SA 2FPZA 1YPLH 1YKTA 3NK8A 3CS0A 1AIXH 3QX5H 1EAXA 3EQ0H 3T29A 2P3UB 2G8TA 1KXAA 3UNQA 1J17T 1GWAA 4H6TA 5C1UA 5E2OA 1BTHH 5IYTA 1QR3E 1MZDA 2H5DA 4ABBA 3S9CA 2H9TH 1GPZA 2G52A 2QF3A 5I25A 4VGCC 2GGVB 2IZ4A 2XC0A 3RXDA 1VITF 1TMTH 4DOQA 3BTFE 1L4ZA 3SHCH 1C5XB 1YC0A 1T32A 1ETSH 3FAOA 1ELGA 1W14U 1PFXC 2C3SA 1WOFA 3UWJH 1K22H 1UCYH 4FVBA 3VB5A 1PPGE 2Y82A 1RTLA 3RU4T 1FY8E 4ZKRU 1S82A 1P2OA 3KGPA 1EOLA 2W7UA 4YESB 2HPQH 2ZTXA 2XWBI