1MD8A

Monomeric structure of the active catalytic domain of complement protease c1r
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
329
structure length
314
Chain Sequence
DCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords C1R COMPLEMENT SERINE PROTEASE
publication title Monomeric structures of the zymogen and active catalytic domain of complement protease c1r: further insights into the c1 activation mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 65
structure length 314
sequence length 329
ec nomenclature ec 3.4.21.41: Complement subcomponent C1r.
pdb deposition date 2002-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1md8A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1md8A01
2KRIA 2XW9A 3RXJA 2AMQA 1HGTH 4LZ4B 1QNJA 1SI5H 1N6YA 4X0WU 2FOBA 3LIWA 2A32A 4BANB 7GCHG 2ZFQH 2CHAC 2ZPSA 2WUCA 1ZRKA 1CQQA 3DA9B 2W3IA 1TPMA 1HCCA 4CRGA 1LQDB 1AKSB 2A2XH 4J38B 1C5OH 4O97A 4NG9H 2IJOB 3SU2A 1GJBB 5C1XA 1ANBA 3RXUA 3MHWU 3ELAH 2BDHA 3MO3A 1HXEH 3B8JA 4ABGA 1P3CA 5GIBA 8GCHG 4NFEA 1IQMA 5DJ7A 1KXDA 1WUNH 2TBSA 1OK2A 2FOFA 4ZAEA 5T6GA 4X1RU 3EA9A 1BUIA 1DSUA 3G01A 2QN5T 1GJ7B 2OTVA 3A85A 5GCHG 4WJG2 4D7FA 3NWUA 2FS9A 1H9LB 1AE8H 1ETSH 2ZEBA 4YOIA 3BTQE 3ENSB 5EW1H 1LVMA 1SHHB 4MDSA 2VIVA 1LHCH 1YP9A 4UD9H 1QL9A 3UR9A 1SL3A 4AB8A 1TAWA 2B0FA 4BAMB 4WMEA 1MCTA 3BIUH 3LU9B 4GPGA 4LOSA 3M3TA 1DWBH 3AW1A 4KELA 2BHGA 2BD7A 5CHAB 1NROH 1THSH 1HFHA 1O3OA 3T26A 1C4Y2 4H6SB 1GBDA 1V6DA 1NRRH 1LTOA 4IS5A 3KF2A 1O3BA 1NRPH 3SI4H 4C16A 3RU4E 3H7OA 2O8TA 5G4BA 1P57B 2V35A 2B9LA 2ZWLH 2ZKSA 5AHGH 2ZU5A 1YPLH 3O8BA 4D9RA 2PR3A 2CKUA 3ESTA 1TQ7B 3PMBB 4IBLH 1QL8A 3V0XA 4D9QA 1P03A 3S0NA 4FVDA 2CF8H 1UTQA 4FXGG 5ESTE 4D7GA 1RJXB 3PYHA 1RFNA 1J8AA 2Z9IA 1S82A 4INLA 2GMTC 3ZVFA 1O5BB 1B0FA 4ABAA 1P01A 1QBNA 2NWNA 1GBCA 3RXGA 1EP6A 1GHBF 2Z9KA 4GUXA 1A61H 1CU1A 4CRBA 1QB9A 3RXKA 2VIQA 4MG3A 1QHRB 1GJ8B 2PUQH 3RC4A 1OYTH 1ELGA 4OS2A 4RSPA 1G2MA 1GHAF 1QA7A 2XC0A 1EP5A 2YRAA 3QGJA 5HMAA 3O8EB 1UCYE 2Z94A 3BTTE 1L1NA 4I8GA 1FMGA 1Z6JH 3KQBA 1SGDE 3MMGA 1RS0A 1YLCA 3SJKA 3ZV9A 3RXVA 3KHVA 3ZZ5A 4TWYA 1HJAB 2R2WU 4CR5A 4DURA 4BOHA 1LVYA 1YKTA 1H4WA 4FUFA 3STIA 1HFDA 4GLYA 2JGXA 2VWOA 3A89A 2XBWA 1ANCA 4CSYA 2Q1JA 1D6WA 2G7IA 4NWLA 3VXFH 1K1IA 1C2DA 5F8XA 4JZFH 1AGJA 1GBKA 1NU7B 1V2RT 3URCA 3RC6A 4X1SU 1L1JA 2WPMS 2JH6D 3GCHC 2Y7XA 1OK3A 4IGDA 1ETRH 3Q3XA 1MUEB 4AX9H 1PQ7A 1TNLA 3E0PB 1O3PB 3MH5A 1YPJH 1AB9C 2ZNKH 4UEHH 4WXIA 2BZMA 1HNEE 1ZPBA 4YLUA 1QY6A 1SGYE 2TPIZ 3O8DA 4DCDA 1O2RA 3SO3A 1LPKB 1HJ8A 2XBXA 2XCFA 1SGQE 2NU4E 2FWWA 3HK6B 1ARCA 3FP7E 4Y71A 2V0BA 1IQNA 1GDUA 1SGCA 2J92A 1MCVA 3TK5A 5EXMA 3GOVB 3TITA 1UVSH 1UO6A 1EUFA 3M7TA 1UK2A 1EPTC 1EX3A 5LH8A 1MTNB 1Q2WA 3KZJA 1P2IA 1A5GH 1W7XH 2SGEE 1C9PA 4X8TH 1CT4E 1TWXB 4HGCA 1O38A 3RDZA 3V7TA 4WMFA 2THFB 4JYUH 2ALVA 3STJA 5A0BA 3A80A 2GZ9A 4ABBA 3M35A 3RXMA 2ZDNA 1EASA 3RXEA 4BTIB 3OP8A 5DP4A 2P16A 1DS2E 2W80A 2F91A 1QFKH 1G32B 1JBUH 1TPPA 8ESTE 1P2MA 4Q2KA 1SS2A 3RJ3D 1RIWC 2OBOA 2YNBA 2TIOA 2BOKA 4D8NA 3PB1E 1E38B 1OOKB 3T5OA 2QY0A 4IMZA 4YZUA 3BEUA 3R62A 3SJ8A 1MD7A 3DUXH 2GX4A 2Y82A 6GCHG 3K6YA 4FUDA 5DP3A 2QY0B 1P2OA 2PTNA 1G3DA 2C93B 4NA7A 3T2NA 2YOLA 1E0FD 1AUTC 1HCGA 3SBKA 3GCOA 2BLQA 3BTDE 1LDTT 2JH5D 1K1MA 4X8UH 2BLWA 1C2MA 5F6MA 4PZ5A 4OS6A 2WV4A 5FPTA 1OX1A 4X8VH 2R0KA 2OBQA 2QC2A 5PTPA 1C5QA 1Y3UA 1O2KA 3MU5A 2ESTE 2PGBB 2C3SA 2G5NA 1FY5A 2ZCKP 4JZEH 1DOJA 3NFPI 4ZH8A 3Q77A 3K9XB 1DX5M 4JZIA 3NXPA 1GHQB 4YOGA 1CKLA 3A8DA 1C5TA 4UFGH 1GBFA 3UQVA 2I6QA 3SNDA 3T29A 2P8OC 4Q7XA 1GJ9B 1E88A 1P9SA 3PMHB 2STBE 1ANEA 1T31A 3IG6B 1T8OA 4FUJA 3RXBA 3IWMA 2F9BH 1DICA 4VGCC 1C4U2 1OKXA 3MTYA 1T4VH 2BD4A 4NA9H 5EPNA 3JZ2B 2ZF0H 1SBWA 1QRZA 1JIMA 1PPGE 5F8TA 1QBVH 2ZI2H 3S7KB 1A7SA 2ZGBH 5JBBS 1AVGH 1Y3VA 3P95A 2Z3CA 4AYIA 2NU2E 5CMXH 1F7ZA 1EPTA 3ATLA 3H5CB 2ZGXH 3HGNA 4DY7B 3HKIB 3CENA 4ISLA 1UTPA 4ZXYH 3SQHE 1KDQB 1JRSA 2OD3B 3UQOA 1ACBE 7LPRA 2A5AA 2QF3A 1NESE 2OLGA 3TPIZ 1SGFA 5IYTA 5FX5A 1NZQH 1O2VA 4XOJA 1GGDB 2CV3A 1SGNE 1EB1H 4K1TA 4K1SA 2K1QA 1BRUP 3U9AH 1XX9A 1CA0B 5F03A 3NUMA 2AGEX 2OINA 2BYAX 1U6QA 4BAKB 2ZDKA 5HYUB 1TBQH 1AWFH 1XUKA 3MNCA 4I8HA 4FUCA 5CE1A 4YOJA 5LPRA 3UIRA 4OGXA 1ZJKA 3HPTB 5FAHA 4ZKOU 2KAIA 3B9FH 3WY8A 1T32A 1SPJA 1QUBA 1KSNA 1C1NA 4AGKA 1YPMH 1CHGA 1ZOMA 3SV9A 1CBWB 3MH4A 2FPZA 1Y5BT 2BXTH 3TLOA 2FOCA 1MKXH 3GCNA 1GVLA 3TJOA 1AFQC 5JPMG 3B23B 2EC3A 2ZA5A 2OC7A 3RXLA 1HRTH 2HNTE 1O3HA 3A82A 2EI7A 4MTBA 1OWJA 1TOCB 1YC0A 3S7HB 3ZZ3A 6CHAC 4PROA 4IN2A 2ZU3A 1A3EH 3SNBA 1FY4A 2WV5A 4A1VA 1TMBH 1ABJH 3F9FA 1W10U 2BVXH 5HYOA 5GWZA 3MU0A 1AHTH 1ID5H 1XVMA 2PW8H 5J4SA 1BBRH 1NFYA 2EEKA 2VNTA 1F5RA 2GDEH 1FQ3A 3SUEA 3BTFE 1HAHH 2PV9B 1DXPA 1HLTH 4GAWA 2WPJS 2EI8A 1SLXB 3T27A 2QXIA 1UK4A 4Y7AA 1UTMA 4U32A 1P0SH 3LJOA 4CRCA 2JETC 3BTEE 2UWPA 2TGTA 2Z9LA 1KTSB 1PPHE 1YCPM 3IX0A 1PYTC 4X1PU 1RTFB 1S0QA 1PFXC 4Q7YA 3ZVDA 3MFJA 1DUAA 2ZDLA 1ZGVA 3AAUA 1TGSZ 1DLEA 1WSSH 3SJ9A 4IC5A 1Z7KA 3GYMA 3A83A 3UOUA 4XSKU 1PYTD 2VH0A 3ZRZA 3P92A 2ZZUH 2SNWA 1O2OA 2B5ID 3E6PH 1NO9H 1C1MA 1EZXC 2VVVA 1FY8E 1ZHPA 2KMSA 1QJ7B 4Y11E 3KXVA 1IHTH 1WU1A 2TRMA 3LGVA 4Y79A 1DSTA 1XUHA 1YPKH 4IMQA 1E37B 4CRDA 1O2LA 1Z1JA 4B75A 1XXDA 3ZYDA 1KLTA 4AYDA 3MNXA 1NN6A 2GV6A 1TA2A 3M5NA 4GCHF 2G8TA 4XBBA 1YLDA 4K8BA 3RXCA 2Z9GA 3A86A 3SV2H 2AGIX 3ZZAA 2A7JA 1NWVA 1LY2A 3RXAA 4X2VA 2ZFPH 1S0RA 2G4TA 4ZKRU 3EJHA 1XKBC 1V2WT 4AZ2B 2Q6DA 1YPHC 3F9HA 2FXRA 4GHQA 3SU5A 2XBVA 2Z9JA 1FV9A 4U01A 1A4WH 1EATA 3SOSA 4ISNA 2BMGB 1TNGA 2VIWA 4A6LA 2CN0H 5H4IB 2ZDMA 1QJ1B 2BD2A 1OXGA 1GBEA 3ZZDA 1BMAA 1DLKB 1TNKA 2A0QB 2FOAA 2FI4E 4ISHH 5C67A 1AFEH 1GI7B 2ZDVH 3M7PA 1PPCE 3IU3I 1A0JA 3RXSA 3SQEE 1ORFA 3ZD1A 1BMLA 2G81E 4JCNA 1YYY1 3SUDA 1IQIA 2G52A 5C1UA 2IPHA 1S5SA 1ZTJA 2AIQA 3T28A 1FY1A 2OC8A 1ZJDA 1C1OA 2GVFA 1NRQH 4CR9A 1J9CH 5CHAC 1OP8A 3CS0A 1C5RA 1WTHD 3Q3YA 1WOFA 3UNSA 4BTTB 3K65B 3GY7A 3TGIE 1HIAB 1G37A 3QUMP 1M9UA 1ESTA 4SGBE 1OJYA 1P9UA 3QK1A 2VH6A 4NIXA 1PQ5A 4HTCH 5EU8A 2H1UA 1KTTB 2VU8E 4B76A 4MPVA 3RM0H 1O32A 3NKKA 2LPRA 3OY6U 4NFFA 1EQ9A 1RGQA 3OX7U 3F9EA 1N8OB 2ODPA 2I6SA 1FN8A 1V2KT 1ELEE 1AD8H 1L0ZA 1ZPCA 1C1TA 1A5IA 3BG4B 3PLBA 5L30H 3V3MA 3SZNA 1Z92B 2GCTB 3LC3A 1VITF 1BTPA 3VB4A 2B5TB 4FUIA 2FMJA 1OP2A 3TU7H 5DK1A 3ODDA 3DT0H 1MQ5A 2BDCA 1P04A 2IZ4A 1C5SA 1W12U 1Y3YA 4JMYA 1SGRE 4NZLA 4AYYB 4WF8A 2PUXB 5AFZH 1C2JA 1UVTH 4GVUA 3PO1B 3GY6A 4XE4A 3KQEA 1AKSA 1N6XA 4H42U 2GTBA 2R9PA 1GI0A 1O3AA 1XM1A 2FESH 4B2RA 1IOEA 3SU1A 1EAUA 3KNXA 3F1SB 2LOJA 1C1UH 4MPXA 1NS3A 2GD4B 4K1EA 1ZYOA 3C27B 1Z1IA 1EOJA 1O3LA 1RD3B 2BD5A 2ZC9H 1P12E 3A8BA 1A0LA 1VVCA 3EGKH 5JB8S 1VGCB 2AGGX 3URDA 1GJ6A 1LKAA 1C1QA 2BDGA 3UREA 1Y5UT 4B2SA 1V2VT 1PPZA 1THRH 3GY5A 3RXFA 4LZ1H 2BVRH 5JPMH 5C3NA 1O2WA 1C5UA 1UCYH 2J2UA 2MCYA 1F0RA 3N7OA 5C5OA 1FIWA 2G55A 2FZZA 1MKXK 1EJNA 3A87A 2A4RA 4Z6AH 5GPIB 1LMWB 3SI3H 4Y0ZE 1EOLA 1V2OT 4INKA 1H9IE 5HYTB 1PQ8A 4AFQA 4HZHA 1GI2A 1U5MA 1W8BH 3QX5H 1FBRA 2ZU4A 3BEIB 1K9OE 4B2CA 1CGJE 1BBRK 1YPHE 3GDVA 4J2YB 4CH8B 4X6OA 4A5TS 2F9OA 1UTJA 4YO9A 3SHAH 1HXFH 3FP8E 2ZU1A 5LGOA 1QTFA 2H2ZA 3HK3B 3TH3H 2AMPA 3BSQA 3SHCH 3UNQA 2UWLA 2WPHS 1ZTLA 2BY5X 4UE7H 1MTNC 4JHSA 2ZDAH 1FNIA 4MNWA 1XUGA 2ZQ2A 5FPYA 1C1VH 4ABJA 4MNXA 2ANWA 2SFAA 2ZP0H 2BOHB 1HBTH 1KLIH 2ANYA 2PHBA 5TCCA 3HATH 1SGEE 2NU1E 3ZVGA 2WINI 2WPKS 1HAVB 1TALA 3SGAE 3RMLH 1ELTA 2TGDA 3U8TH 1GHXH 1UHBB 4WVPE 3TH4H 4WMDA 3K6ZA 1G9IE 3OTJE 2ZTZA 4X1NU 1SQTA 5EGMA 3QDZB 3Q00A 3GXEA 1ESAA 3SNCA 1F2SE 3PROA 1TYNA 4THNH 4I8JA 4R8TB 1LO6A 3M3SA 2ODYB 4MNYA 2AERH 3V13A 2UUKB 5C2ZA 2RKYA 2BQ6B 3ZVCA 3TIUA 2VGCC 1Y8TA 1BZXE 2J38A 2QXGA 1RTLA 5FBIA 3TK6A 4BAHB 3V12A 2CJIA 3INBC 2GV7A 4YTAA 1N1LA 4IN1A 5ETXA 4DJZB 1IQEA 1GHBG 3GY8A 5HYPA 1WYKA 1VVDA 1BITA 1C2HA 1NU9A 2SGAA 1HB0B 3MYWA 4JZ1A 2ZCLP 1H2PP 3ZZ8A 4CHAB 1UOTP 3OXUD 4NIWA 1GHAG 1Y3XA 3M7QA 1B0EA 1SQOA 1BTWA 1JRTA 2HALA 1LHFH 2FEQH 1C1WH 3I77A 4X6MA 1KY9A 3TVJB 1TPAE 1NFXA 2HLCA 2VWMA 2ZFSA 2TGPZ 3ITIA 1NRSH 4UFFH 1QJ6B 2BY8X 1UVOA 4FU9A 4ISIH 4XBDA 5EODA 3VB3A 1FUJA 2FOEA 3SW0X 1TPGA 2CGAA 2XQWC 1FJSA 3E8LA 4HFPB 1P11E 2OC1A 1NT1A 3HKJB 1LHDH 1HUTH 1YCPH 3GOVA 2ANKH 1DY9A 3BV9B 3E91A 2Y81A 9LPRA 1MAXA 4ZHMU 3PV4A 4FUHA 5HZPB 3E1XB 1K1OA 3BEFB 3KQDA 2ZHDA 2XRCA 4BNRA 1ELCA 1UTLM 2NU0E 4KP0A 4XBCA 3LGWA 4Y6DA 1GGDC 3SNEA 1CT2E 3T25A 4FUBA 3DD2H 1CA0C 1HFIA 2HNTC 3LOXA 4TPIZ 1ZMJA 4MPWA 3TK9A 3KQCA 2VINA 4AFZA 1AUJA 1GBJA 1O3MA 1B7XB 2PWXA 2XRBA 1O39A 3RMNH 1O30A 1AU8A 1D3TB 5C1YA 1VITH 2CMYA 1ELFA 2VVCA 3TNTA 1DVAH 1Q31A 5T3HA 4JZDH 4AOQA 1V3XA 1AY6H 1J17T 2V8EA 1CBWC 4X6NA 1DUEA 1WTGH 2QCYA 1Y3WA 1H04P 4UFDH 1O5EH 1SRZA 4RN6A 1UCYK 3SV6A 2IZ3A 1EZSC 1QRXA 2O8LA 1JOUB 3ZVBA 1AVWA 4OS5A 3U8OH 1TOMH 2JGWA 1HAYB 5DPAA 3TGJE 4DGJA 2A4OA 4Y0YE 4LK4A 4JYVH 1LVOA 3IITA 2FTLE 1V2QT 4ISOA 1MZDA 2WPLS 4FU8A 1FIZA 4BAQB 1O3NA 1MZAA 2J34A 4U30A 2XXLA 3TNSA 2RA0A 2FDAA 3SNAA 1O3FA 2JKHA 1BTXA 3VXEH 1AN1E 1BTZA 1H03P 3L33A 2FLRH 1ZMNA 3MU1A 2Q6GA 1ZHRA 4LOYH 1QURH 1OS8A 2CXVA 3S9CA 4A92A 1W3CA 4GHTA 2WYJA 5EXNA 4WH8A 1DY8A 3Q3KA 1TONA 3A8AA 1IHSH 1X7AC 4UONA 1E5GA 5I46H 2JH0D 4Z0KA 1GI6A 1BMNH 3SGBE 1O2QA 3M5OA 1Z6EA 1SVPA 4NWKA 1V2PT 2PKSB 3RM2H 5IDKA 4O3TA 1GCDA 5FXLA 2GDDA 2H5DA 2BX3A 1ZZZA 2WYGA 3TH2H 5A8YA 1GVZA 1KDQA 1SHYA 5T6FA 1MAYA 1OK1A 4YESB 5EQSA 3SJOA 4DOQA 3P8OA 2ZG0H 2ZU2A 3BTWE 3MU8A 1EJAA 1O5AB 1TPNA 2BDAA 3ATKA 3HGPA 2O8UA 4U2WA 1BRCE 3GDSA 1O2PA 1NFWA 1ZRBA 3JZ1B 2BQ7B 1L4DA 3MWIU 5JB9S 1XVOA 4SGAE 1EJMA 2VWNA 1KXBA 5DP8A 5A2MH 3UY9A 3A81A 1MU6B 4CH2B 1QBOA 4OS4A 1C5MD 3CALA 2ZFRH 3PMJA 2SGPE 3EA8A 3M61U 1TRMA 1XMNB 3MH7A 1S85A 1GMCF 2F9PA 4TYDA 1OWKA 1T8MA 3ZZ7A 3O8CA 4AN7A 1O2IA 2R0LA 1XUJA 3ATWA 1ZPZA 4KTCA 2A7HA 3A7ZA 2J9NA 5JYIA 3M3VA 1ESBA 2BLOA 2CG6A 1TB6H 2AFQB 3M7UA 1SFIA 3FZDA 1F5LA 2ZO3H 4RKJB 1S83A 1GPZA 3U98H 1E8BA 1PPBH 1XUFA 4JYTA 2HGTH 1Q3XA 3VEQB 3CS7A 1E35B 4CRAA 2P59A 4MQAA 1ARBA 2A4QA 5EOKA 1RTKA 5B6OA 4E7NA 4CBOA 4K5ZA 1GI5A 2BDBA 1OP0A 1GBHA 3QZQA 2RG3A 2PFEA 1QQ4A 2XWBF 1N8OC 2UUFB 1S81A 1O5GH 2GCHF 3AASA 1F5KU 1Y5AT 3GICB 2GKVE 2FI5E 3BG4C 1F92A 3P8GA 1O2GH 1VZQH 1BJUA 1ZTKA 4AB9A 1GMHF 1YCPK 1GMDF 1ELBA 2GCTC 1AE5A 2W3KA 1H1BA 4I31A 3RLYH 2W26A 1DWDH 5DP9A 1A3BH 1TIOA 3GYLB 4ZH1D 1LHGH 1GBBA 3UUZA 4X2WA 2Y5HA 5GDSH 1OYQA 2BDIA 3PO1C 4AYVB 3ZZ4A 4X2XA 1ELDE 1VCQA 3QGNB 2D8WA 1SLVB 3BN9A 1MTUA 3EE0B 1TBZH 1P3EA 2P3FH 3LPRA 1DWCH 3ZZBA 1TLDA 4Y8YA 3AVZA 1TX8A 5L6NH 3MU4A 1IAUA 5EG4A 1AO5A 1V2MT 1P2QA 3C1KA 2XWBI 3D65E 1CE5A 2JRAA 1OJVA 2G5VA 1EAWA 3DFJA 2FOHA 2BQWB 1HPGA 5A8ZA 3EDXB 4DIHH 5GXPA 1JIRA 4NSYA 1O3EA 1C5LH 1GMHG 1LPGB 2PKAB 4K60A 3ATMA 5TJXA 1K1JA 1GHYH 4FU7A 5L2YH 2RA3A 5I25A 1K1PA 4IC6A 2V3HH 5E0JA 3DHKH 4B2BA 2HPPH 2QXHA 1DPOA 2BXUH 2HPQH 4B73A 5JBAS 2H9TH 1D6RA 1C5ZB 3ZZ6A 3ERBA 5HGGA 1Z8GA 4NSVA 2NU3E 3ZD2A 4K3JA 2A45B 3RXQA 4B71A 2XRDA 1S6HA 1GJ5H 2SNVA 1TX7A 2ANMH 4NCYA 1TPOA 1SGIB 4GCHG 3GCTF 3ZZCA 1HIAA 3KCGH 2Y6TA 2C90B 1EKBB 7KMEH 4F49A 3RMMH 3UWIA 3ZYEA 1AZZA 5HM2A 2RLPA 5E0HA 5A0CA 1IQHA 4I33A 3OYPA 3OSYA 2A2QH 4UDWH 2HRVA 1O2XA 2VIPA 1GDNA 1MKWH 1SFQB 3PTNA 5SGAE 1TABE 5DP6A 3GDUA 2GGVB 2AH4X 1DFPA 2A31A 1H2QP 2PTCE 1G3EA 4K8YA 6ESTA 4KKDA 3MNBA 1QB6A 1NPMA 4WXVA 3CP7A 3QWCH 4BXSA 1O3IA 1C2KA 1CA8B 1UTNA 1YPEH 2W5EA 3M36A 2P3UB 4ZUHA 1AQ7A 4J1YA 1FAKH 5E2OA 1TRYA 3LONA 3LGTA 2Z7FE 1MTSA 1EZQA 2RKZA 3A8CA 2V6NA 1WV7H 8LPRA 7GCHF 3VGCB 4ZKSU 3UOPA 5FCKA 1VCPA 3ZV8A 3SV7A 3ZVEA 1LQEA 1SOTA 2DUCA 2FO9A 4RKOB 4ZMAH 4UFEH 2AS9A 3A7YA 2YNAA 1ETTH 2ZIQH 1L2EA 2SGFE 2GZ7A 1F0UA 5DG6A 1ELAA 2A7CA 8GCHF 3S9AA 2HVXA 5DP5A 3SU6A 1YBWA 3RXDA 1GG6B 3VB6A 5EPYA 1TMTH 2A1DB 1A1RA 1HJAC 4YM9A 1G36A 1NC6A 5GCHF 1GL1A 2BM2A 5A8XA 2OUAA 1G4FA 1MBMA 3VPKA 3R0FA 1GJ4H 1J16A 1QB1A 1Z8RA 4NIVA 1G2LA 3BF6H 3M5MA 1VITG 4Y76A 1CSOE 1GBMA 5BRRE 1C5PA 1ABIH 2D1JA 1A5HA 1J14A 2C8ZB 2TGAA 1O3DA 2FLBH 4HI3A 1TNHA 2HNTF 3S69A 4A1XA 1QGFA 4CHAC 2C4FH 2OC0A 5EQRA 5ABWA 1BMMH 2Q6FA 2ZHQH 4TY6A 3RU4T 1DDJA 1V2JT 1HYLA 3QTOH 1SB1H 1BB0B 2FYQA 2Z3EA 5DGJA 3M5LA 2J4IA 3PWCA 3O8RA 1F0SA 2P3TB 5T6DA 1DITH 4E05H 2P95A 3PTBA 4A7IB 3L3TA 1NRNH 3PLKA 4INHA 2FX4A 4I8KA 1ANDA 5LPFA 1O34A 2CG7A 2ZCHP 4OGYA 4M7GA 1KYNA 2W81A 1O2YA 1QQUA 1IQFA 1DWEH 5E8EH 1TBRH 1O5FH 2VB0A 3R3GB 4LOTA 3PWBA 5EXLA 5DO4H 1DXWA 1L4ZA 3A84A 3FP6E 3PM3A 2SGDE 1HDTH 2O9QA 2EI6A 3U8RH 2QGRA 3ZVAA 1SGFG 3TJNA 1LPZB 4O03A 1O2HA 1HAXB 2ZGHA 3RXIA 1OWEA 1TGTA 2UWOA 2QIQA 1HAVA 4CRFA 1AI8H 3LGUA 2C8YB 4R0IA 1S6FA 2GT8A 1W11U 3MO6A 1O5DH 3NZIA 1UHBA 4JK5A 1CVWH 2MCZA 2AIPA 1V2ST 2ZGJA 2ZECA 1V2LT 2O39C 3MNSA 1UTKA 2H9HA 3E0NB 1T8NA 1BCUH 4BAOB 4ZKNU 3SGQE 3A7TA 4Y7BA 1AWHB 4AFSA 1J15A 1Z8IB 1INCA 1PQAA 1XXFA 1K1LA 1O0DH 3SUGA 1ZSLA 2D26C 2BZAA 1ZHMA 1BT7A 1HV7A 1MQ6A 1GHZA 2BY9X 1C2GA 1BHXF 1AZ8A 1P2KA 2Y80A 1GCTB 2QA9E 2OXSA 3EYDA 4MUCA 1T7CA 1HAGE 1D3QB 3RMOH 2FIRH 4Y10E 1EAXA 2XCNA 3U1IB 2FOGA 1K21H 2PSYA 1EAIA 2FM2A 1NM6A 4Y8XA 2ALPA 1O3CA 1IQJA 1O36A 3Q76A 1KXEA 1AIXH 3FAOA 3LJJA 3FZZA 2EHFA 1VR1H 4DJZA 1SG8B 1UVUH 3VB5A 1JMOH 2BD8A 2OCVB 1HAIH 2D2DA 1HAZB 1DM4B 1E36B 4AORA 2ZQ1A 1BTYA 3D49H 4A5WB 2CHAB 4FVBA 3U1JB 2Z3DA 3KN2A 5J4QA 1BIOA 3E90B 1L1GA 2BDYA 1H8DH 3QTVH 4IW4E 2W7SA 3LT3A 1T4UH 1O31A 1K2I1 2PSXA 3P70B 4WY3A 1UK3A 5A09A 3FFGA 3TVJA 2XWJI 5F8ZA 1QRWA 2ERJA 1QGBA 5K0HA 2ZTYA 1TRNA 3W95A 3GY2A 2BX4A 2RDLA 2H9EH 4YT7H 1IQLA 1MKWK 3OU0A 4ESTE 3ZZ9A 1GJAB 2OQUA 4E06H 3F9GA 3H7TA 3KL6A 3L6PA 3E16B 1O5CB 3QN7A 5LPEA 3A88A 1DT2A 3GY3A 1DE7H 3T62A 3VB7A 4B2AA 5AFYH 1JXPA 1LHEH 1EB2A 5AVDA 5HM9A 4H6TA 1BTUA 2PKSC 3FANA 1O2SA 7ESTE 3OY5U 4Q80A 1C4V2 2BD3A 3P6ZB 2ZHWH 1C5NH 5JBCS 1SR5C 1YM0A 2AEIH 2VJ1A 2QF0A 4ABEA 1ZMLA 1G3BA 3RC5A 1RXPA 1OPHB 5FHTA 2ILNA 2VVUA 2BD9A 1LVBA 4Y8ZA 4X2YA 2IOTA 1HAOH 1OJWA 1QCPA 3SU0A 3P17H 3NK8A 5FBEA 1PJPA 2QV1A 4I7YH 3TJUA 1V2NT 1QL7A 2QAAA 1P8VC 2G00A 2QXJA 4H4FA 2FI3E 3LGIA 1WBGB 3MI4A 5L2ZH 1KXCA 1SC8U 5FCRA 2J94A 4CBNA 4B1TA 2XBYA 2EC9H 1GI1A 3K2UA 2AYWA 6GCHF 1MU8B 2XYAA 1ZLRA 2Z6BD 2J95A 3EQ0H 2IN2A 1BRBE 1DANH 2WIIC 4YNXA 3T5FH 3KGPA 2GMTB 2H6MA 2BY7X 3D23A 2ZFTA 3RXPA 4NGAH 5DKMA 2A5IA 4ABIA 1FPHH 1H8IH 1YPGH 1TNIA 3ODFA 3OEDC 1WAYB 1GI9B 1C5VA 1AVXA 4DW2U 1P05A 2FX6A 1FN6A 2RL0A 1W0YH 2VIOA 3QZRA 4OS1A 2BY6X 5JBTA 1V2UT 1BJVA 5I0QB 1O2MA 4D76A 1SOZA 2M5TA 5BPEA 2DE8A 3SU4A 1BQYA 1BOQA 4AG1A 3NPSA 1BRAA 5TCAA 1W0ZU 2ZHFH 2VGCB 4LXBH 1XUIA 5DP7A 1THPB 3BIVH 1YF4A 1TX6A 4FUEA 1TE0A 1OWDA 4AYMA 4FUGA 4OS7A 2STAE 1HAPH 3UFAA 1V2TT 4K69A 1W14U 3LGYA 3MQLA 2BVSH 1TA6A 1O3JA 1PPQA 1EXFA 3U69H 1D3PB 1KLJH 2VWLA 1TGBA 1P09A 1UMAH 2B7DH 1Z8JB 3MH6A 2EA3A 1GBLA 2GT7A 2F9NA 1MBQA 4O9VA 3M37A 1S84A 4MLFB 1MTVA 4A1TA 4CREA 3D62A 4K2YA 1C2EA 4I32A 4BXWA 3EAJA 1MH0A 4KTUA 1NFUA 2ODQA 1WCZA 2XNIA 1C5XB 2RCEA 3GCHB 1WQVH 2FS8A 1ELVA 1O3KA 1GBIA 3ATIA 4WWYA 1ZSKA 3RLWH 2A4GA 1Z71A 4FXGH 1SLWB 4AFUA 4AGJA 1AB9B 2VIDA 3RUOA 2Y5GA 3BG8A 1GI8B 2GP9B 1D9IA 1JWTA 2SGQE 1C5YB 1EZUC 1C2IA 3RP2A 1SQAA 4ZHAA 4K12A 4Q7ZA 1GI4A 4NIYA 1FZZA 1WQSA 1GDQA 3SORA 2Y7ZA 3KIDU 3UR6A 2OQ5A 4JK6A 1OWHA 3KEEA 5HXFA 2W7UA 4F4OC 4MNVA 1MMJN 4YT6H 2Y5FA 3PLPA 1EPTB 4TPYA 1ZGIA 4O3UA 3SV8A 2FP7B 1C1SA 1FY3A 3RXHA 4GSOA 1CHOF 1RRKA 4X8SH 2P93A 1FPCH 2A5KA 1MD8A 1O35A 3I29A 2CF9H 2F9UA 1D3DB 2OP9A 2XWAA 3LDXH 2WUBA 3BTME 1TPSA 3LKWA 6LPRA 1O2UA 5E2PA 5C5NA 5GJ4B 2UWNA 1SGTA 1UJ1A 3MOCA 2F83A 1G4GA 2UUJB 2ZTXA 5K7RA 1C2FA 4X6PA 2QYIA 1GJDB 1QR3E 3A7VA 2KAIB 1RIWB 3BTKE 1OK9A 1XKAC 2R2MB 1GBTA 3S9BA 3TJVA 1GMCG 1Y59T 1P02A 1K1NA 1C1PA 1BDAA 4KTSA 1CHOG 3F68H 1KXFA 3VFEA 4KGAA 2RLQA 1CO7E 3FVFB 4DIIH 2FODA 3PMAB 4XDEA 3MO9A 1SMFE 1VJAU 2G51A 2LNCA 3AAVA 5JDUB 3VGCC 2C8WB 1A46H 3RXTA 2DE9A 1IQKA 1SGPE 3NCLA 1O2JA 3A7WA 4TWWA 2ZHEH 1CGHA 4YLQH 9ESTA 1FLEE 1G3CA 1CGIE 2ULLA 5C20A 3GISB 1FAXA 1UTOA 4BTUB 4E7RG 1C1ZA 3RXOA 4MPUA 1TGNA 3W94A 2PGQB 1T8LA 1GG6C 3UWJH 3GY4A 2F9VA 1W7GH 2AMDA 1GKNA 1O2NA 2P8OB 2O8WA 4ZHLU 2PKAA 2GCHG 4WH6A 4VGCB 1IQGA 1VGCC 1K22H 4DVAU 1BHXB 3F6UH 1GVKB 1UVPA 1P2JA 1GMDG 3AW0A 1C1RA 3BTHE 1KIGH 1TGCA 1QO6A 3E3TA 3DFLA 4ONTD 1C2LA 1LKBA 4ZROA 1H9HE 4DT7B 1KXAA 1PPFE 3LH3A 1FDPA 4ABFA 1FXYA 1SSXA 3SW2B 1GJCB 2F3CE 4XFQA 1K28D 1AMHA 1C5WB 2FTMA 4QT8C 3RXRA 5EW2H 5E0GA 1VJ9U 1D4PB 2UUYA 1O2TA 1A0HB 5FPSA 2ZPQA 3QLPH 2BB4A 2FYRA 1GL0E 4ASHA 1O33A 1QIXB 1CT0E 1W2KH 2XC4A 2XTTB 3UPEA 3P8FA 1NY22 1GBAA 4AG2A 1O3GA 1VCWA 1GHVH 1F0TA 1FI8A 4DG4A 1W13U 3LC5A 1BTHH 4NA8A 1LCYA 1GI3A 4X1QU 2ZGCA 3SN8A 1E34B 1BA8B 2ZFFH 1O37A 2R3YA 4I8LA 2FOMB 2GZ8A 1BBRE 2HOBA 2BTCE 4B74A 4ZXXH 2YBYA 3P8NA 4AYEA 3UTUH 3RU4D 5A0AE 3EA7A 5ESBA 1ZR0A 1PPEE 2BZ6H 4MVNA 1G30B 1AFQB 2HWLB 2R3UA 1GKGA 3UNRA 1A2CH 2C8XB 3I78A 3QO6A 3L89M 2H5CA 1OWIA 1NTPA 6CHAB 2A55A 1TFXA 1O9AA 2XC5A 2PLXA 3A7XA 2ZPRA 1YGCH 3GCTG 2P94A 4TY7A 1MTWA 2G4UA 1SLUB 1O2ZA 4NZQA 1FONA 2O8MA 2ASUB 4ABDA 1B5GH 1P10A 3SJIA 2BLVA 2V3OH 5EQQA 5FX6A 5AF9H 4ABHA 1ZSJA 3SUFA 5FO8C 1OSSA 2JETB 1GCTC 1GWAA 1TQ0B 1QA0A 3SU3A 1HJ9A 1TNJA 3TGKE 3LH1A 1GHWH 1P06A 1TMUH 8KME2 3BTGE 2WPIS 2B8OH 1P2NA 1C9TA
chains in the Genus database with same CATH superfamily
2KRIA 2XW9A 3RXJA 2AMQA 1HGTH 4LZ4B 1QNJA 1SI5H 1N6YA 4X0WU 2FOBA 3LIWA 2A32A 4BANB 7GCHG 2ZFQH 2CHAC 2ZPSA 2WUCA 1ZRKA 1CQQA 3DA9B 2W3IA 1TPMA 1HCCA 4CRGA 1LQDB 1AKSB 2A2XH 4J38B 1C5OH 4O97A 4ASUD 4NG9H 2IJOB 3SU2A 1GJBB 5C1XA 1ANBA 3RXUA 3MHWU 3ELAH 2BDHA 3MO3A 1HXEH 3B8JA 4ABGA 1P3CA 5GIBA 8GCHG 4NFEA 1IQMA 5DJ7A 1KXDA 1WUNH 2TBSA 1OK2A 2FOFA 4ZAEA 5T6GA 4X1RU 5DN6D 3EA9A 1BUIA 1DSUA 3G01A 2QN5T 1GJ7B 2OTVA 3A85A 5GCHG 5C17A 4WJG2 4D7FA 3NWUA 2FS9A 1H9LB 1AE8H 1ETSH 2ZEBA 4YOIA 3BTQE 3ENSB 5EW1H 1LVMA 1SHHB 4MDSA 2VIVA 1LHCH 1YP9A 4UD9H 1QL9A 3UR9A 1SL3A 4AB8A 1TAWA 2B0FA 3OE7D 4WMEA 4BAMB 1MCTA 3BIUH 3LU9B 4GPGA 4LOSA 3M3TA 1DWBH 3AW1A 4KELA 2BHGA 2BD7A 5CHAB 1NROH 1THSH 1HFHA 1O3OA 3T26A 1C4Y2 4H6SB 1GBDA 1V6DA 1NRRH 1LTOA 4IS5A 3KF2A 1O3BA 1NRPH 3SI4H 5KGOA 4C16A 3RU4E 3H7OA 2O8TA 5G4BA 1P57B 2V35A 2B9LA 2ZWLH 2ZKSA 5AHGH 2ZU5A 4P00A 1YPLH 3O8BA 4D9RA 2PR3A 2CKUA 2X2ZA 3ESTA 1TQ7B 3PMBB 4IBLH 1QL8A 3V0XA 4D9QA 1P03A 3S0NA 4FVDA 2CF8H 3WWFA 1UTQA 4FXGG 5ESTE 4D7GA 1RJXB 3PYHA 3K3TA 1RFNA 1J8AA 2Z9IA 1S82A 4INLA 2GMTC 3ZVFA 1O5BB 1B0FA 4ABAA 1P01A 1QBNA 2NWNA 1GBCA 3RXGA 1EP6A 1GHBF 2Z9KA 4GUXA 1A61H 1CU1A 4CRBA 1QB9A 3RXKA 2VIQA 4MG3A 1QHRB 1GJ8B 2PUQH 3RC4A 1OYTH 1ELGA 4OS2A 1NBMD 1G2MA 1GHAF 1QA7A 4RSPA 2XC0A 1EP5A 2YRAA 5EJ1A 3QGJA 5HMAA 3DSOA 3O8EB 1UCYE 2Z94A 3BTTE 1L1NA 4I8GA 1FMGA 1Z6JH 3KQBA 1SGDE 3MMGA 1RS0A 1YLCA 3SJKA 3ZV9A 3RXVA 3KHVA 3ZZ5A 2VBCA 4TWYA 1HJAB 2R2WU 4CR5A 4DURA 4BOHA 1LVYA 1YKTA 1H4WA 4FUFA 3STIA 1HFDA 4GLYA 2JGXA 2VWOA 3A89A 2XBWA 1ANCA 3AK5A 4CSYA 2Q1JA 1D6WA 2G7IA 4NWLA 3VXFH 1K1IA 1C2DA 5F8XA 4JZFH 1AGJA 1GBKA 1NU7B 1V2RT 3URCA 3RC6A 4X1SU 1L1JA 1E79D 2WPMS 2JH6D 3GCHC 2Y7XA 1OK3A 4IGDA 3SZEA 1ETRH 3Q3XA 1MUEB 4AX9H 1PQ7A 1TNLA 3E0PB 1O3PB 3MH5A 1YPJH 1AB9C 2ZNKH 4UEHH 4WXIA 2BZMA 1HNEE 1ZPBA 4YLUA 1QY6A 1SGYE 2TPIZ 3O8DA 4DCDA 1O2RA 3SO3A 1LPKB 1HJ8A 2XBXA 2XCFA 1SGQE 2NU4E 2FWWA 3HK6B 1ARCA 3FP7E 4Y71A 2V0BA 1IQNA 1GDUA 1SGCA 2J92A 1MCVA 3TK5A 5EXMA 3GOVB 3TITA 1UVSH 1UO6A 1EUFA 3M7TA 1UK2A 1EPTC 3KYGA 1EX3A 5LH8A 1MTNB 1Q2WA 3KZJA 1P2IA 1A5GH 1W7XH 2SGEE 1C9PA 4X8TH 1CT4E 1TWXB 4HGCA 1O38A 3RDZA 3V7TA 4WMFA 2THFB 4JYUH 2ALVA 3STJA 5A0BA 3A80A 2M2AA 1BMFD 2GZ9A 4ABBA 3M35A 3RXMA 2ZDNA 1EASA 3RXEA 4BTIB 3OP8A 5DP4A 2P16A 3VG8A 1DS2E 2W80A 2F91A 1QFKH 1G32B 1JBUH 1TPPA 8ESTE 1P2MA 4Q2KA 1SS2A 3RJ3D 1RIWC 2OBOA 2YNBA 2TIOA 5C0TA 2BOKA 4D8NA 3PB1E 1E38B 1OOKB 3T5OA 2QY0A 4IMZA 4YZUA 3BEUA 3R62A 3SJ8A 1MD7A 5DN4A 3DUXH 2GX4A 1NBME 2Y82A 6GCHG 2WPDD 3K6YA 4FUDA 5DP3A 2QY0B 1P2OA 2PTNA 1G3DA 2C93B 4NA7A 3T2NA 2YOLA 1E0FD 1AUTC 1HCGA 3SBKA 3GCOA 2BLQA 3BTDE 1LDTT 2JH5D 1K1MA 4X8UH 2BLWA 1C2MA 5F6MA 4PZ5A 4OS6A 2WV4A 2YMSB 5FPTA 1OX1A 4X8VH 2R0KA 2OBQA 2QC2A 5PTPA 1C5QA 1Y3UA 1O2KA 3MU5A 2ESTE 2PGBB 2C3SA 2G5NA 1FY5A 2ZCKP 4JZEH 1DOJA 3NFPI 4ZH8A 3Q77A 5KECA 3K9XB 1DX5M 4JZIA 3NXPA 1GHQB 4YOGA 5EJZA 1CKLA 3A8DA 3F6KA 1C5TA 1GBFA 4UFGH 3UQVA 2I6QA 3SNDA 3T29A 2P8OC 4Q7XA 1GJ9B 1E88A 1P9SA 2HLDD 3PMHB 2STBE 1ANEA 1T31A 3IG6B 1T8OA 4FUJA 3RXBA 3IWMA 2F9BH 1DICA 3F2HA 4VGCC 1C4U2 1OKXA 3MTYA 1T4VH 2BD4A 4NA9H 5EPNA 3JZ2B 2ZF0H 1SBWA 1QRZA 1JIMA 1PPGE 5F8TA 1QBVH 2ZI2H 3S7KB 1A7SA 2ZGBH 5JBBS 1AVGH 1Y3VA 3P95A 2Z3CA 4AYIA 2NU2E 5CMXH 1F7ZA 1EPTA 3ATLA 3H5CB 2ZGXH 3HGNA 4DY7B 3HKIB 3CENA 4ISLA 1UTPA 4ZXYH 2JIZD 3SQHE 5CDFE 1KDQB 1JRSA 2OD3B 3UQOA 1ACBE 7LPRA 2F43B 2A5AA 2QF3A 1NESE 2OLGA 3TPIZ 1SGFA 5IYTA 5FX5A 1NZQH 1O2VA 4XOJA 1GGDB 2CV3A 1SGNE 1EB1H 4K1TA 4K1SA 2K1QA 3CI0J 1BRUP 3F0OA 3U9AH 4YIZA 1XX9A 1CA0B 5F03A 3NUMA 2AGEX 2OINA 2BYAX 1U6QA 4BAKB 2ZDKA 5HYUB 3WWBA 1TBQH 1AWFH 1XUKA 3MNCA 4I8HA 4FUCA 5CE1A 4YOJA 5LPRA 3UIRA 4OGXA 1ZJKA 3HPTB 5FAHA 4ZKOU 2KAIA 3B9FH 3WY8A 1T32A 1SPJA 1QUBA 1KSNA 1C1NA 4AGKA 1YPMH 2IJD1 1CHGA 1ZOMA 3SV9A 1CBWB 3MH4A 2FPZA 1Y5BT 2BXTH 3TLOA 2FOCA 1MKXH 3GCNA 1GVLA 3TJOA 1AFQC 5JPMG 3B23B 2EC3A 4HG6A 5GNDA 2ZA5A 2OC7A 3RXLA 1HRTH 2HNTE 1O3HA 3A82A 2EI7A 4MTBA 1OWJA 1TOCB 1YC0A 3S7HB 3ZZ3A 6CHAC 4PROA 4IN2A 2I2LA 2ZU3A 1A3EH 3SNBA 1FY4A 2WV5A 4A1VA 1TMBH 1ABJH 3F9FA 1W10U 2BVXH 5HYOA 5GWZA 3MU0A 1AHTH 1ID5H 1XVMA 2PW8H 5J4SA 1BBRH 5C94A 1NFYA 2EEKA 2VNTA 1F5RA 2GDEH 1FQ3A 3SUEA 3BTFE 1HAHH 2PV9B 1DXPA 1HLTH 4GAWA 2WPJS 2EI8A 1SLXB 3PV2A 3T27A 2QXIA 1UK4A 4Y7AA 1UTMA 4U32A 1P0SH 3LJOA 4CRCA 2JETC 3BTEE 2UWPA 2TGTA 2Z9LA 1KTSB 1PPHE 1YCPM 3IX0A 4Z1MD 1PYTC 4X1PU 1RTFB 1S0QA 1PFXC 4Q7YA 3ZVDA 3MFJA 1DUAA 2ZDLA 1ZGVA 3AAUA 1TGSZ 1DLEA 1WSSH 3SJ9A 4IC5A 1Z7KA 3GYMA 3A83A 3UOUA 4XSKU 2KFWA 1PYTD 2VH0A 3ZRZA 3P92A 2ZZUH 2SNWA 1O2OA 2B5ID 3E6PH 1NO9H 1C1MA 1EZXC 2KCYA 2VVVA 1FY8E 1YWUA 2KMSA 1ZHPA 1QJ7B 4Y11E 3KXVA 1IHTH 1WU1A 2TRMA 3LGVA 2EQNA 1DSTA 1KMHB 1XUHA 1YPKH 1E37B 4IMQA 4CRDA 1O2LA 1Z1JA 4B75A 1XXDA 3ZYDA 1KLTA 4AYDA 3MNXA 1NN6A 4ZCNA 2GV6A 1TA2A 3M5NA 4GCHF 2G8TA 4XBBA 4YXWD 1YLDA 4K8BA 3RXCA 2Z9GA 3A86A 3SV2H 2AGIX 3ZZAA 2A7JA 1NWVA 1LY2A 3RXAA 4X2VA 2ZFPH 1S0RA 2G4TA 4ZKRU 3EJHA 1XKBC 2W6JD 1V2WT 4AZ2B 2Q6DA 1YPHC 3F9HA 2FXRA 4GHQA 3SU5A 2XBVA 2Z9JA 1FV9A 4U01A 1A4WH 1EATA 3SOSA 4ISNA 2BMGB 1TNGA 2VIWA 4A6LA 2CN0H 5H4IB 2ZDMA 1QJ1B 2BD2A 1OXGA 1GBEA 3ZZDA 1BMAA 1DLKB 1TNKA 2A0QB 2FOAA 2FI4E 4ISHH 5C67A 1AFEH 1GI7B 2K8IA 3M7PA 1PPCE 2ZDVH 3IU3I 1A0JA 4M9FA 1QZ8A 3RXSA 3SQEE 1ORFA 3ZD1A 1BMLA 2G81E 4JCNA 1YYY1 2J98A 3SUDA 1IQIA 2G52A 5C1UA 2IPHA 1S5SA 1ZTJA 2AIQA 3T28A 1FY1A 2OC8A 1ZJDA 1C1OA 2GVFA 1NRQH 4CR9A 1J9CH 1YLNA 1OP8A 3CS0A 5CHAC 1C5RA 4ACBA 3FKSD 1WTHD 3Q3YA 1WOFA 3UNSA 4BTTB 3K65B 3GY7A 3TGIE 1HIAB 1G37A 3QUMP 1M9UA 1ESTA 4SGBE 1OJYA 1P9UA 3QK1A 3DSGA 2VH6A 4NIXA 1PQ5A 2KCOA 4HTCH 5EU8A 1W0KD 2H1UA 1KTTB 2VU8E 4B76A 4MPVA 3RM0H 1O32A 3NKKA 2LPRA 3OY6U 4NFFA 1EQ9A 1RGQA 3OX7U 3W1EA 3F9EA 1N8OB 2ODPA 2I6SA 1FN8A 2QE7D 1V2KT 1ELEE 1AD8H 1L0ZA 1ZPCA 1C1TA 1A5IA 3BG4B 3PLBA 5B6LA 5L30H 3V3MA 3SZNA 3FO8D 1Z92B 2GCTB 3LC3A 1VITF 4RT1A 1BTPA 3VB4A 2B5TB 4FUIA 2FMJA 1OP2A 3TU7H 5DK1A 3ODDA 3DT0H 1MQ5A 2BDCA 1P04A 2IZ4A 1C5SA 1W12U 1Y3YA 3DSPA 1SGRE 4JMYA 4NZLA 4WF8A 4AYYB 2PUXB 5AFZH 1C2JA 1UVTH 4GVUA 3PO1B 3GY6A 4XE4A 3KQEA 1AKSA 1N6XA 4H42U 2GTBA 2R9PA 1GI0A 1O3AA 1XM1A 2FESH 4B2RA 1IOEA 3SU1A 1EAUA 3KNXA 3F1SB 2LOJA 1C1UH 4MPXA 2RFKC 1NS3A 2GD4B 4K1EA 1ZYOA 3FGRA 3C27B 1Z1IA 4B6FA 1EOJA 1O3LA 4DT4A 1RD3B 2BD5A 2ZC9H 1P12E 3A8BA 1A0LA 1VVCA 3EGKH 5JB8S 1VGCB 2AGGX 3URDA 1GJ6A 1LKAA 1C1QA 2BDGA 3UREA 1Y5UT 4B2SA 1V2VT 1PPZA 4RI0A 1THRH 3GY5A 2WSSD 3RXFA 4LZ1H 2BVRH 5JPMH 1E1RD 5C3NA 1O2WA 1C5UA 1UCYH 2J2UA 2MCYA 4APLA 1F0RA 3N7OA 5C5OA 1FIWA 2G55A 2FZZA 1MKXK 1EJNA 3A87A 2A4RA 4Z6AH 5GPIB 1LMWB 3SI3H 4Y0ZE 1EOLA 1V2OT 4INKA 1H9IE 5HYTB 1PQ8A 4AFQA 5DSFA 4HZHA 1GI2A 1U5MA 1W8BH 3OTPA 3QX5H 1FBRA 2ZU4A 3BEIB 1K9OE 4B2CA 1CGJE 1BBRK 1YPHE 3GDVA 4J2YB 4CH8B 4X6OA 4A5TS 2F9OA 1UTJA 4YO9A 3SHAH 1HXFH 3FP8E 2ZU1A 3N7DA 4F48B 1E1QD 5LGOA 1QTFA 2H2ZA 3HK3B 3TH3H 2AMPA 3BSQA 3SHCH 3UNQA 2W6ID 2UWLA 2WPHS 1ZTLA 2BY5X 4UE7H 1MTNC 4JHSA 2ZDAH 1FNIA 4MNWA 1XUGA 2ZQ2A 5FPYA 1C1VH 4ABJA 4MNXA 1SQRA 2ANWA 2SFAA 2ZP0H 2BOHB 1HBTH 1KLIH 2ANYA 2PHBA 5TCCA 3HATH 1SGEE 2NU1E 3ZVGA 2WINI 2WPKS 1HAVB 1TALA 3SGAE 3RMLH 1ELTA 4F55A 2TGDA 3U8TH 1GHXH 1UHBB 4WVPE 3TH4H 4WMDA 3K6ZA 1G9IE 4XRNA 3PRBA 3OTJE 2ZTZA 4X1NU 1SQTA 5EGMA 3F3BA 3QDZB 3Q00A 3GXEA 1ESAA 3SNCA 1F2SE 3PROA 1TYNA 4THNH 4I8JA 4R8TB 1LO6A 3M3SA 1W0JD 2ODYB 4MNYA 2AERH 3V13A 2UUKB 5C2ZA 2RKYA 2BQ6B 3ZVCA 3TIUA 2VGCC 1Y8TA 1BZXE 3KQ5A 2J38A 2QXGA 1RTLA 5FBIA 3TK6A 4BAHB 3V12A 2CJIA 3INBC 2GV7A 4YTAA 1N1LA 4IN1A 5ETXA 4DJZB 1IQEA 1GHBG 3GY8A 5HYPA 1WYKA 1VVDA 1BITA 1C2HA 1NU9A 2SGAA 1HB0B 2YMSC 3MYWA 4JZ1A 5CHBA 2ZCLP 1H2PP 3CNRA 3ZZ8A 4CHAB 1UOTP 3OXUD 4NIWA 1GHAG 1SKYE 4TSFD 1Y3XA 3SYJA 3M7QA 1B0EA 1SQOA 1BTWA 1JRTA 2HALA 1LHFH 2FEQH 1C1WH 3I77A 2YMSD 4X6MA 1KY9A 3TVJB 1TPAE 1NFXA 2HLCA 2VWMA 2ZFSA 2TGPZ 3ITIA 1NRSH 4UFFH 1QJ6B 2BY8X 1UVOA 4FU9A 4ISIH 4XBDA 5EODA 3VB3A 1FUJA 2FOEA 3SW0X 1MABB 1TPGA 2CGAA 2XQWC 1FJSA 3E8LA 4HFPB 1P11E 2OC1A 1NT1A 3HKJB 1LHDH 1HUTH 1YCPH 3GOVA 2ANKH 1DY9A 3BV9B 3E91A 2Y81A 4Q63A 1MAXA 4ZHMU 9LPRA 2L74A 3PV4A 4FUHA 5HZPB 3E1XB 1K1OA 3BEFB 3KQDA 2ZHDA 2XRCA 4BNRA 1ELCA 1UTLM 2NU0E 4KP0A 4XBCA 3LGWA 4Y6DA 1GGDC 3SNEA 1CT2E 3T25A 4FUBA 3DD2H 1CA0C 1HFIA 2HNTC 3ZLDA 4Y79A 3LOXA 4MSLA 1ZMJA 4TPIZ 4MPWA 3TK9A 3KQCA 2VINA 4AFZA 1AUJA 1GBJA 1O3MA 3WSYA 1B7XB 2PWXA 2XRBA 1O39A 3RMNH 1O30A 2WHXA 1AU8A 1D3TB 5C1YA 1VITH 2CMYA 1ELFA 2VVCA 3TNTA 1DVAH 1Q31A 5T3HA 4JZDH 4AOQA 1V3XA 1AY6H 1J17T 2V8EA 1CBWC 4X6NA 1DUEA 1WTGH 2QCYA 1FX0B 1Y3WA 1H04P 4UFDH 1O5EH 1SRZA 4RN6A 1UCYK 3SV6A 2IZ3A 1EZSC 1QRXA 2O8LA 1JOUB 3ZVBA 1AVWA 4OS5A 3U8OH 1TOMH 2JGWA 1HAYB 5DPAA 3TGJE 4DGJA 2A4OA 4Y0YE 4LK4A 4JYVH 1LVOA 3IITA 2FTLE 1V2QT 4ISOA 1MZDA 2KCAA 2WPLS 4FU8A 1EFRD 1FIZA 4BAQB 1O3NA 1MZAA 2J34A 4U30A 2XXLA 3TNSA 2RA0A 2FDAA 3SNAA 1O3FA 2JKHA 1BTXA 3VXEH 1AN1E 1BTZA 1H03P 3L33A 2FLRH 1ZMNA 3FN8A 3MU1A 2Q6GA 1ZHRA 4LOYH 1QURH 1OS8A 2CXVA 3S9CA 4A92A 1W3CA 4GHTA 2WYJA 5EXNA 4WH8A 1DY8A 3Q3KA 1TONA 3A8AA 1IHSH 1X7AC 4UONA 1E5GA 5I46H 2JH0D 4Z0KA 1GI6A 1BMNH 3SGBE 1O2QA 3M5OA 1Z6EA 1SVPA 4NWKA 1V2PT 2PKSB 3RM2H 5IDKA 4O3TA 1GCDA 5FXLA 2GDDA 2H5DA 2BX3A 1ZZZA 2WYGA 3KYFA 3TH2H 5A8YA 1GVZA 1KDQA 1SHYA 5T6FA 1MAYA 1OK1A 4YESB 5EQSA 3SJOA 4DOQA 3P8OA 2ZG0H 2ZU2A 3BTWE 3MU8A 1EJAA 1O5AB 1TPNA 2BDAA 3ATKA 3HGPA 4N7EA 2O8UA 4U2WA 1BRCE 3GDSA 1O2PA 1NFWA 1ZRBA 3JZ1B 2BQ7B 1L4DA 3MWIU 5JB9S 1XVOA 4SGAE 1EJMA 2VWNA 1KXBA 5DP8A 5A2MH 3UY9A 2J5UA 3A81A 3UB0A 1MU6B 4CH2B 1QBOA 4OS4A 1C5MD 3CALA 2ZFRH 3PMJA 2SGPE 3EA8A 3M61U 1TRMA 1XMNB 3MH7A 1S85A 1GMCF 2F9PA 4TYDA 1OWKA 1T8MA 3ZZ7A 3O8CA 4FOUC 4AN7A 1O2IA 2R0LA 1XUJA 3ATWA 1ZPZA 4KTCA 2A7HA 3A7ZA 2J9NA 5JYIA 3M3VA 1ESBA 2BLOA 2CG6A 1TB6H 2AFQB 3M7UA 1SFIA 3FZDA 1F5LA 2ZO3H 4RKJB 1S83A 1GPZA 3U98H 1E8BA 1PPBH 1XUFA 4JYTA 2HGTH 1Q3XA 3VEQB 3CS7A 1E35B 4CRAA 2P59A 4MQAA 1ARBA 1S6LA 2A4QA 5EOKA 1UW7A 1RTKA 5B6OA 4E7NA 4CBOA 4K5ZA 1GI5A 2BDBA 1OP0A 3ZLEA 1GBHA 3QZQA 2RG3A 2PFEA 1QQ4A 2XWBF 1N8OC 2UUFB 1S81A 1O5GH 2KZ4A 2GCHF 3AASA 1F5KU 1Y5AT 3GICB 2GKVE 2FI5E 3BG4C 1F92A 3P8GA 1O2GH 1VZQH 1BJUA 1ZTKA 4AB9A 1GMHF 1YCPK 1GMDF 1ELBA 2GCTC 1AE5A 2W3KA 1H1BA 4I31A 3RLYH 2W26A 1DWDH 3NJAA 5DP9A 2RDEA 1A3BH 1TIOA 3GYLB 4ZH1D 2ZYCA 1LHGH 1GBBA 3NRLA 3UUZA 4X2WA 2Y5HA 5GDSH 3OAAD 1OYQA 2BDIA 3OEED 2JDID 3PO1C 4AYVB 3ZZ4A 4X2XA 1ELDE 1VCQA 3QGNB 2D8WA 1SLVB 3BN9A 1MTUA 3EE0B 1TBZH 2WZQA 1P3EA 2P3FH 3LPRA 1DWCH 3ZZBA 5HKKD 1TLDA 4Y8YA 3AVZA 1TX8A 5L6NH 3MU4A 1IAUA 5EG4A 1AO5A 3OFND 1V2MT 1P2QA 3C1KA 2XWBI 3D65E 1CE5A 2JRAA 1OJVA 2G5VA 1EAWA 3DFJA 2FOHA 2BQWB 1HPGA 5A8ZA 3EDXB 4DIHH 5GXPA 1JIRA 4NSYA 1O3EA 1C5LH 1GMHG 1LPGB 2PKAB 3DCLA 3ATMA 4K60A 5TJXA 1K1JA 1GHYH 4FU7A 5L2YH 2RA3A 5I25A 1K1PA 4IC6A 2V3HH 5E0JA 3DHKH 4B2BA 2HPPH 2QXHA 1DPOA 2BXUH 2HPQH 4B73A 5JBAS 2H9TH 2EY4C 1D6RA 2F4LA 2GJGA 1C5ZB 3ZZ6A 3ERBA 5HGGA 1Z8GA 4NSVA 2NU3E 3ZD2A 4K3JA 2A45B 3RXQA 4B71A 2XRDA 1S6HA 1GJ5H 2SNVA 1TX7A 2ANMH 4NCYA 1TPOA 1SGIB 4GCHG 3ZIAD 3GCTF 3ZZCA 1HIAA 3KCGH 2Y6TA 2C90B 1EKBB 7KMEH 4F49A 3RMMH 3UWIA 1VKYA 3ZYEA 1AZZA 5HM2A 2RLPA 2J97A 5E0HA 5A0CA 1IQHA 4I33A 3OYPA 3OSYA 2A2QH 4UDWH 2HRVA 5HIZA 1O2XA 2VIPA 1GDNA 1MKWH 1SFQB 3PTNA 4RT0A 5SGAE 1TABE 5DP6A 3GDUA 2GGVB 2AH4X 1DFPA 2A31A 3PRDA 1H2QP 2PTCE 1G3EA 4K8YA 6ESTA 3UAIC 4KKDA 3MNBA 1QB6A 1NPMA 4WXVA 3CP7A 3QWCH 4BXSA 1O3IA 1C2KA 1CA8B 3MQKC 1UTNA 1YPEH 2W5EA 3M36A 2P3UB 4ZUHA 1AQ7A 4J1YA 1FAKH 5E2OA 1TRYA 3LONA 3LGTA 2Z7FE 1MTSA 1EZQA 2RKZA 3A8CA 2V6NA 1WV7H 8LPRA 7GCHF 3VGCB 4ZKSU 3UOPA 5FCKA 1VCPA 3ZV8A 3SV7A 3ZVEA 1LQEA 1SOTA 2DUCA 2FO9A 4RKOB 4ZMAH 4UFEH 2AS9A 3A7YA 2YNAA 1ETTH 2ZIQH 1L2EA 2SGFE 2GZ7A 1F0UA 5DG6A 1ELAA 2A7CA 8GCHF 3S9AA 2HVXA 1H8ED 5DP5A 3SU6A 1YBWA 3RXDA 1GG6B 3VB6A 5EPYA 3F0PA 1TMTH 2A1DB 2K0QA 1A1RA 1HJAC 4YM9A 1G36A 1NC6A 5GCHF 1GL1A 2BM2A 5A8XA 2OUAA 1G4FA 1MBMA 3VPKA 3R0FA 1GJ4H 1J16A 1QB1A 1Z8RA 4NIVA 1G2LA 3BF6H 3M5MA 1VITG 3EE7A 4Y76A 1CSOE 1GBMA 2V3MA 1C5PA 5BRRE 1ABIH 1A5HA 2D1JA 1J14A 2C8ZB 2TGAA 1O3DA 2FLBH 3GS9A 4HI3A 1TNHA 2HNTF 3S69A 4A1XA 1QGFA 4CHAC 2C4FH 2OC0A 5EQRA 5ABWA 1BMMH 2Q6FA 1YY3A 2ZHQH 4TY6A 3RU4T 1DDJA 1V2JT 1HYLA 3QTOH 1SB1H 1BB0B 2FYQA 2Z3EA 5DGJA 3PV5A 3M5LA 2J4IA 3PWCA 3O8RA 1F0SA 2P3TB 5T6DA 1DITH 4E05H 2P95A 3PTBA 4A7IB 3L3TA 1NRNH 3PLKA 4INHA 2FX4A 4I8KA 1ANDA 5LPFA 1O34A 2CG7A 2ZCHP 4OGYA 4M7GA 1KYNA 2W81A 1O2YA 1QQUA 1IQFA 1DWEH 5E8EH 1TBRH 1O5FH 2VB0A 3R3GB 4LOTA 3PWBA 5EXLA 5DO4H 1DXWA 1L4ZA 3A84A 3FP6E 3PM3A 2SGDE 1HDTH 2O9QA 2EI6A 3U8RH 2QGRA 3ZVAA 1SGFG 3TJNA 4P02A 1LPZB 4O03A 1O2HA 1HAXB 2ZGHA 3RXIA 1OWEA 1TGTA 2UWOA 2QIQA 1HAVA 4CRFA 1AI8H 3LGUA 2C8YB 4R0IA 1S6FA 2GT8A 1W11U 3MO6A 1O5DH 3NZIA 1UHBA 4JK5A 1CVWH 2MCZA 2AIPA 1V2ST 2ZGJA 2ZECA 1V2LT 2O39C 3MNSA 1UTKA 2H9HA 3E0NB 1T8NA 1BCUH 4BAOB 4ZKNU 3SGQE 3A7TA 4Y7BA 1AWHB 4AFSA 1J15A 1Z8IB 1INCA 1PQAA 1XXFA 1K1LA 1O0DH 3SUGA 1ZSLA 2D26C 2BZAA 1ZHMA 1BT7A 2L6OA 1HV7A 1MQ6A 1GHZA 2BY9X 1C2GA 1BHXF 1AZ8A 1P2KA 2Y80A 1GCTB 2QA9E 2OXSA 3EYDA 4MUCA 1T7CA 1HAGE 1D3QB 3RMOH 2FIRH 4Y10E 1EAXA 2XCNA 3U1IB 2FOGA 1K21H 2PSYA 1EAIA 1NM6A 2FM2A 4Y8XA 2ALPA 1O3CA 1IQJA 1O36A 3Q76A 1KXEA 1AIXH 3FAOA 3LJJA 3FZZA 2EHFA 1VR1H 4DJZA 1SG8B 1UVUH 3VB5A 1JMOH 2BD8A 2OCVB 1HAIH 2D2DA 1HAZB 1DM4B 1E36B 4AORA 2ZQ1A 1BTYA 3D49H 4A5WB 2CHAB 4FVBA 3U1JB 2Z3DA 3KN2A 5J4QA 1BIOA 3E90B 1L1GA 2BDYA 1H8DH 3QTVH 4IW4E 2W7SA 3LT3A 1T4UH 1O31A 1K2I1 2PSXA 3P70B 4WY3A 1UK3A 5A09A 3FFGA 3TVJA 2XWJI 5F8ZA 1QRWA 2ERJA 1QGBA 5IK2D 5K0HA 2ZTYA 1TRNA 3W95A 3GY2A 2BX4A 2RDLA 2H9EH 4YT7H 1IQLA 1MKWK 3OU0A 4ESTE 3ZZ9A 1GJAB 2OQUA 4E06H 3F9GA 3H7TA 3KL6A 3L6PA 3E16B 1O5CB 3QN7A 3U28C 5LPEA 1WXRA 3A88A 1DT2A 3GY3A 3FGTA 1DE7H 3T62A 3VB7A 4B2AA 5AFYH 1JXPA 1LHEH 1EB2A 4BWCA 5AVDA 5HM9A 4H6TA 2V7QD 3H09A 1BTUA 2PKSC 5F53A 4FETA 3FANA 1O2SA 7ESTE 3OY5U 4Q80A 1C4V2 2BD3A 3P6ZB 2ZHWH 1C5NH 5JBCS 1SR5C 1YM0A 2AEIH 2VJ1A 2Y8RA 2QF0A 4ABEA 1ZMLA 1G3BA 3RC5A 1RXPA 1OPHB 5FHTA 2ILNA 2VVUA 2BD9A 1LVBA 4Y8ZA 4X2YA 2WV9A 5DN5A 2IOTA 1HAOH 1OJWA 1QCPA 5C0UA 4XD7D 3SU0A 3P17H 3NK8A 5FBEA 2XOKD 1PJPA 3F2FA 2QV1A 4I7YH 3TJUA 1V2NT 1QL7A 2QAAA 1P8VC 2G00A 2LELA 2QXJA 4H4FA 2FI3E 3LGIA 1WBGB 3MI4A 5L2ZH 1KXCA 1SC8U 5FCRA 2J94A 4CBNA 4B1TA 3WW7A 2XBYA 2EC9H 1GI1A 3K2UA 2AYWA 6GCHF 1MU8B 2XYAA 1ZLRA 2KR7A 1OHHD 2Z6BD 2J95A 3EQ0H 2IN2A 1BRBE 1DANH 2WIIC 4YNXA 3T5FH 3KGPA 2GMTB 2H6MA 2BY7X 3D23A 2ZFTA 3RXPA 4NGAH 5DKMA 4ACAA 2A5IA 4ABIA 1FPHH 1H8IH 1YPGH 1TNIA 3ODFA 3OEDC 1WAYB 1GI9B 1C5VA 1AVXA 4DW2U 1P05A 2FX6A 3WSXA 2RL0A 1FN6A 1W0YH 2VIOA 3QZRA 4OS1A 2BY6X 5JBTA 1V2UT 1BJVA 5I0QB 1O2MA 4D76A 1SOZA 2M5TA 5BPEA 2DE8A 3N7EA 3SU4A 3FOAA 1BQYA 4I86A 1BOQA 4AG1A 3NPSA 1BRAA 5TCAA 1W0ZU 2ZHFH 2VGCB 4LXBH 1XUIA 5DP7A 2KX4A 1THPB 3BIVH 1YF4A 1TX6A 4FUEA 1TE0A 1OWDA 4AYMA 4FUGA 4OS7A 2STAE 1HAPH 3UFAA 1V2TT 4K69A 1W14U 3LGYA 3MQLA 2BVSH 1TA6A 1O3JA 1PPQA 1EXFA 3U69H 1D3PB 1KLJH 2VWLA 1TGBA 1P09A 1UMAH 2B7DH 1Z8JB 3MH6A 2EA3A 1GBLA 2GT7A 3OEHD 4OM9A 2F9NA 1MBQA 4O9VA 3M37A 5KEDA 1S84A 4MLFB 1MTVA 4A1TA 4CREA 3D62A 4K2YA 1C2EA 4I32A 4BXWA 3EAJA 1MH0A 4KTUA 1NFUA 2ODQA 1WCZA 2XNIA 1C5XB 2RCEA 3GCHB 1WQVH 2FS8A 1ELVA 1O3KA 1GBIA 3ATIA 4WWYA 1ZSKA 3RLWH 2A4GA 1Z71A 4FXGH 1SLWB 4AFUA 4AGJA 2XNDD 1AB9B 2VIDA 3RUOA 2Y5GA 3BG8A 1GI8B 2GP9B 1D9IA 1JWTA 2SGQE 1C5YB 1EZUC 1C2IA 3RP2A 1SQAA 4ZHAA 4K12A 4Q7ZA 1GI4A 1K0HA 4NIYA 1FZZA 1WQSA 1GDQA 3SORA 2Y7ZA 3KIDU 3UR6A 2OQ5A 4JK6A 1OWHA 3KEEA 5HXFA 2W7UA 2CK3D 4F4OC 4MNVA 1MMJN 4YT6H 2Y5FA 3PLPA 1EPTB 4TPYA 1ZGIA 4O3UA 3SV8A 2FP7B 1C1SA 1FY3A 3RXHA 4GSOA 4PO7A 1CHOF 1RRKA 4X8SH 2P93A 1FPCH 2A5KA 1MD8A 1O35A 3I29A 2CF9H 2F9UA 1D3DB 2OP9A 2XWAA 3LDXH 5HIYA 2WUBA 3BTME 1TPSA 5EIYA 5EJLA 3LKWA 6LPRA 1O2UA 5E2PA 5C5NA 5GJ4B 2UWNA 1SGTA 1UJ1A 3MOCA 2AHME 2F83A 1G4GA 2UUJB 2ZTXA 5K7RA 1C2FA 4X6PA 2QYIA 1GJDB 1QR3E 3A7VA 2KAIB 1RIWB 2QF4A 3BTKE 1OK9A 1XKAC 2R2MB 1GBTA 3S9BA 3TJVA 1GMCG 1Y59T 1P02A 1K1NA 1C1PA 1BDAA 4KTSA 1CHOG 3F68H 2KCPA 1KXFA 3VFEA 4KGAA 2RLQA 1CO7E 3FVFB 4DIIH 2FODA 3PMAB 4XDEA 3MO9A 1SMFE 1VJAU 2G51A 2LNCA 3AAVA 5JDUB 2JJ2D 3VGCC 2C8WB 2IPQX 1A46H 3RXTA 1WDIA 2DE9A 1IQKA 1SGPE 3NCLA 1O2JA 3A7WA 4TWWA 2ZHEH 1CGHA 4YLQH 4B6EA 2Y8SA 1FLEE 1G3CA 9ESTA 3VWOA 1CGIE 2ULLA 5C20A 3GISB 1FAXA 1UTOA 4BTUB 3N99A 4E7RG 1C1ZA 3RXOA 4MPUA 1TGNA 3W94A 2PGQB 1T8LA 1GG6C 3UWJH 3GY4A 1W7GH 2F9VA 2AMDA 1GKNA 1O2NA 2P8OB 2O8WA 4ZHLU 2LP6A 4AC9A 2PKAA 2GCHG 4WH6A 4VGCB 1IQGA 1VGCC 1K22H 4DVAU 1BHXB 3F6UH 1GVKB 1UVPA 1P2JA 1GMDG 3AW0A 1C1RA 3BTHE 1KIGH 1TGCA 1QO6A 3E3TA 3DFLA 4ONTD 1C2LA 1LKBA 4ZROA 1H9HE 4DT7B 1KXAA 1PPFE 3LH3A 2KM0A 1FDPA 4ABFA 1FXYA 1SSXA 3SW2B 2HVYB 1GJCB 1RLHA 2F3CE 4XFQA 1K28D 1AMHA 1C5WB 2JJ1D 2FTMA 4QT8C 2PP6A 3RXRA 5EW2H 5E0GA 1VJ9U 1D4PB 2UUYA 1O2TA 1A0HB 5FPSA 2ZPQA 3QLPH 4Q4LA 2BB4A 3F2GA 2FYRA 1GL0E 4ASHA 1O33A 1QIXB 5T1VA 1CT0E 1W2KH 2XC4A 2XTTB 3UPEA 3P8FA 1NY22 1GBAA 4AG2A 1O3GA 1VCWA 1GHVH 1F0TA 1FI8A 4DG4A 1W13U 3LC5A 1BTHH 4NA8A 5FL7D 1LCYA 1GI3A 4X1QU 2ZGCA 3SN8A 1E34B 1BA8B 2ZFFH 1O37A 2R3YA 4I8LA 2FOMB 2GZ8A 1BBRE 2HOBA 2BTCE 4B74A 4ZXXH 2YBYA 3P8NA 4AYEA 3UTUH 3RU4D 5A0AE 3EA7A 5ESBA 1ZR0A 1PPEE 2BZ6H 4MVNA 1G30B 1AFQB 2J98B 4TT3D 1COWD 2HWLB 2R3UA 1GKGA 3UNRA 1A2CH 2C8XB 3I78A 3QO6A 3L89M 2H5CA 1OWIA 1NTPA 6CHAB 2A55A 1TFXA 1O9AA 2XC5A 2PLXA 3A7XA 2ZPRA 1YGCH 3GCTG 2P94A 4TY7A 1MTWA 2G4UA 1SLUB 1O2ZA 4NZQA 1FONA 2O8MA 2ASUB 4ABDA 1B5GH 1P10A 2OK5A 3SJIA 2BLVA 2V3OH 5EQQA 5FX6A 5AF9H 4ABHA 1H8HD 1ZSJA 2Y8TA 5FO8C 3SUFA 1OSSA 2JETB 1GCTC 1GWAA 1TQ0B 2QF5A 1QA0A 3SU3A 1HJ9A 1TNJA 3TGKE 3LH1A 1GHWH 1P06A 1TMUH 8KME2 3BTGE 2WPIS 2B8OH 1P2NA 1C9TA
chains in the Genus database with same CATH topology
2KRIA 2XW9A 3RXJA 2AMQA 1HGTH 4LZ4B 1QNJA 1SI5H 1N6YA 4X0WU 2FOBA 3LIWA 2A32A 4BANB 7GCHG 2ZFQH 2CHAC 2ZPSA 2WUCA 1ZRKA 1CQQA 3DA9B 2W3IA 1TPMA 1HCCA 4CRGA 1LQDB 1AKSB 2A2XH 4J38B 1C5OH 4O97A 4NG9H 2IJOB 3SU2A 1GJBB 5C1XA 1ANBA 3RXUA 3MHWU 3ELAH 2BDHA 3MO3A 1HXEH 3B8JA 4ABGA 1P3CA 5GIBA 8GCHG 4NFEA 1IQMA 5DJ7A 1KXDA 1WUNH 2TBSA 1OK2A 2FOFA 4ZAEA 5T6GA 4X1RU 3EA9A 1BUIA 1DSUA 3G01A 2QN5T 1GJ7B 2OTVA 3A85A 5GCHG 4WJG2 4D7FA 3NWUA 2FS9A 1H9LB 1AE8H 1ETSH 2ZEBA 4YOIA 3BTQE 3ENSB 5EW1H 1LVMA 1SHHB 4MDSA 2VIVA 1LHCH 1YP9A 4UD9H 1QL9A 3UR9A 1SL3A 4AB8A 1TAWA 2B0FA 4BAMB 4WMEA 1MCTA 3BIUH 3LU9B 4GPGA 4LOSA 3M3TA 1DWBH 3AW1A 4KELA 2BHGA 2BD7A 5CHAB 1NROH 1THSH 1HFHA 1O3OA 3T26A 1C4Y2 4H6SB 1GBDA 1V6DA 1NRRH 1LTOA 4IS5A 3KF2A 1O3BA 1NRPH 3SI4H 4C16A 3RU4E 3H7OA 2O8TA 5G4BA 1P57B 2V35A 2B9LA 2ZWLH 2ZKSA 5AHGH 2ZU5A 1YPLH 3O8BA 4D9RA 2PR3A 2CKUA 3ESTA 1TQ7B 3PMBB 4IBLH 1QL8A 3V0XA 4D9QA 1P03A 3S0NA 4FVDA 2CF8H 1UTQA 4FXGG 5ESTE 4D7GA 1RJXB 3PYHA 1RFNA 1J8AA 2Z9IA 1S82A 4INLA 2GMTC 3ZVFA 1O5BB 1B0FA 4ABAA 1P01A 1QBNA 2NWNA 1GBCA 3RXGA 1EP6A 1GHBF 2Z9KA 4GUXA 1A61H 1CU1A 4CRBA 1QB9A 3RXKA 2VIQA 4MG3A 1QHRB 1GJ8B 2PUQH 3RC4A 1OYTH 1ELGA 4OS2A 4RSPA 1G2MA 1GHAF 1QA7A 2XC0A 1EP5A 2YRAA 3QGJA 5HMAA 3O8EB 1UCYE 2Z94A 3BTTE 1L1NA 4I8GA 1FMGA 1Z6JH 3KQBA 1SGDE 3MMGA 1RS0A 1YLCA 3SJKA 3ZV9A 3RXVA 3KHVA 3ZZ5A 4TWYA 1HJAB 2R2WU 4CR5A 4DURA 4BOHA 1LVYA 1YKTA 1H4WA 4FUFA 3STIA 1HFDA 4GLYA 2JGXA 2VWOA 3A89A 2XBWA 1ANCA 4CSYA 2Q1JA 1D6WA 2G7IA 4NWLA 3VXFH 1K1IA 1C2DA 5F8XA 4JZFH 1AGJA 1GBKA 1NU7B 1V2RT 3URCA 3RC6A 4X1SU 1L1JA 2WPMS 2JH6D 3GCHC 2Y7XA 1OK3A 4IGDA 1ETRH 3Q3XA 1MUEB 4AX9H 1PQ7A 1TNLA 3E0PB 1O3PB 3MH5A 1YPJH 1AB9C 2ZNKH 4UEHH 4WXIA 2BZMA 1HNEE 1ZPBA 4YLUA 1QY6A 1SGYE 2TPIZ 3O8DA 4DCDA 1O2RA 3SO3A 1LPKB 1HJ8A 2XBXA 2XCFA 1SGQE 2NU4E 2FWWA 3HK6B 1ARCA 3FP7E 4Y71A 2V0BA 1IQNA 1GDUA 1SGCA 2J92A 1MCVA 3TK5A 5EXMA 3GOVB 3TITA 1UVSH 1UO6A 1EUFA 3M7TA 1UK2A 1EPTC 1EX3A 5LH8A 1MTNB 1Q2WA 3KZJA 1P2IA 1A5GH 1W7XH 2SGEE 1C9PA 4X8TH 1CT4E 1TWXB 4HGCA 1O38A 3RDZA 3V7TA 4WMFA 2THFB 4JYUH 2ALVA 3STJA 5A0BA 3A80A 2GZ9A 4ABBA 3M35A 3RXMA 2ZDNA 1EASA 3RXEA 4BTIB 3OP8A 5DP4A 2P16A 1DS2E 2W80A 2F91A 1QFKH 1G32B 1JBUH 1TPPA 8ESTE 1P2MA 4Q2KA 1SS2A 3RJ3D 1RIWC 2OBOA 2YNBA 2TIOA 2BOKA 4D8NA 3PB1E 1E38B 1OOKB 3T5OA 2QY0A 4IMZA 4YZUA 3BEUA 3R62A 3SJ8A 1MD7A 3DUXH 2GX4A 2Y82A 6GCHG 3K6YA 4FUDA 5DP3A 2QY0B 1P2OA 2PTNA 1G3DA 2C93B 4NA7A 3T2NA 2YOLA 1E0FD 1AUTC 1HCGA 3SBKA 3GCOA 2BLQA 3BTDE 1LDTT 2JH5D 1K1MA 4X8UH 2BLWA 1C2MA 5F6MA 4PZ5A 4OS6A 2WV4A 5FPTA 1OX1A 4X8VH 2R0KA 2OBQA 2QC2A 5PTPA 1C5QA 1Y3UA 1O2KA 3MU5A 2ESTE 2PGBB 2C3SA 2G5NA 1FY5A 2ZCKP 4JZEH 1DOJA 3NFPI 4ZH8A 3Q77A 3K9XB 1DX5M 4JZIA 3NXPA 1GHQB 4YOGA 1CKLA 3A8DA 1C5TA 4UFGH 1GBFA 3UQVA 2I6QA 3SNDA 3T29A 2P8OC 4Q7XA 1GJ9B 1E88A 1P9SA 3PMHB 2STBE 1ANEA 1T31A 3IG6B 1T8OA 4FUJA 3RXBA 3IWMA 2F9BH 1DICA 4VGCC 1C4U2 1OKXA 3MTYA 1T4VH 2BD4A 4NA9H 5EPNA 3JZ2B 2ZF0H 1SBWA 1QRZA 1JIMA 1PPGE 5F8TA 1QBVH 2ZI2H 3S7KB 1A7SA 2ZGBH 5JBBS 1AVGH 1Y3VA 3P95A 2Z3CA 4AYIA 2NU2E 5CMXH 1F7ZA 1EPTA 3ATLA 3H5CB 2ZGXH 3HGNA 4DY7B 3HKIB 3CENA 4ISLA 1UTPA 4ZXYH 3SQHE 1KDQB 1JRSA 2OD3B 3UQOA 1ACBE 7LPRA 2A5AA 2QF3A 1NESE 2OLGA 3TPIZ 1SGFA 5IYTA 5FX5A 1NZQH 1O2VA 4XOJA 1GGDB 2CV3A 1SGNE 1EB1H 4K1TA 4K1SA 2K1QA 1BRUP 3U9AH 1XX9A 1CA0B 5F03A 3NUMA 2AGEX 2OINA 2BYAX 1U6QA 4BAKB 2ZDKA 5HYUB 1TBQH 1AWFH 1XUKA 3MNCA 4I8HA 4FUCA 5CE1A 4YOJA 5LPRA 3UIRA 4OGXA 1ZJKA 3HPTB 5FAHA 4ZKOU 2KAIA 3B9FH 3WY8A 1T32A 1SPJA 1QUBA 1KSNA 1C1NA 4AGKA 1YPMH 1CHGA 1ZOMA 3SV9A 1CBWB 3MH4A 2FPZA 1Y5BT 2BXTH 3TLOA 2FOCA 1MKXH 3GCNA 1GVLA 3TJOA 1AFQC 5JPMG 3B23B 2EC3A 2ZA5A 2OC7A 3RXLA 1HRTH 2HNTE 1O3HA 3A82A 2EI7A 4MTBA 1OWJA 1TOCB 1YC0A 3S7HB 3ZZ3A 6CHAC 4PROA 4IN2A 2ZU3A 1A3EH 3SNBA 1FY4A 2WV5A 4A1VA 1TMBH 1ABJH 3F9FA 1W10U 2BVXH 5HYOA 5GWZA 3MU0A 1AHTH 1ID5H 1XVMA 2PW8H 5J4SA 1BBRH 1NFYA 2EEKA 2VNTA 1F5RA 2GDEH 1FQ3A 3SUEA 3BTFE 1HAHH 2PV9B 1DXPA 1HLTH 4GAWA 2WPJS 2EI8A 1SLXB 3T27A 2QXIA 1UK4A 4Y7AA 1UTMA 4U32A 1P0SH 3LJOA 4CRCA 2JETC 3BTEE 2UWPA 2TGTA 2Z9LA 1KTSB 1PPHE 1YCPM 3IX0A 1PYTC 4X1PU 1RTFB 1S0QA 1PFXC 4Q7YA 3ZVDA 3MFJA 1DUAA 2ZDLA 1ZGVA 3AAUA 1TGSZ 1DLEA 1WSSH 3SJ9A 4IC5A 1Z7KA 3GYMA 3A83A 3UOUA 4XSKU 1PYTD 2VH0A 3ZRZA 3P92A 2ZZUH 2SNWA 1O2OA 2B5ID 3E6PH 1NO9H 1C1MA 1EZXC 2VVVA 1FY8E 1ZHPA 2KMSA 1QJ7B 4Y11E 3KXVA 1IHTH 1WU1A 2TRMA 3LGVA 4Y79A 1DSTA 1XUHA 1YPKH 4IMQA 1E37B 4CRDA 1O2LA 1Z1JA 4B75A 1XXDA 3ZYDA 1KLTA 4AYDA 3MNXA 1NN6A 2GV6A 1TA2A 3M5NA 4GCHF 2G8TA 4XBBA 1YLDA 4K8BA 3RXCA 2Z9GA 3A86A 3SV2H 2AGIX 3ZZAA 2A7JA 1NWVA 1LY2A 3RXAA 4X2VA 2ZFPH 1S0RA 2G4TA 4ZKRU 3EJHA 1XKBC 1V2WT 4AZ2B 2Q6DA 1YPHC 3F9HA 2FXRA 4GHQA 3SU5A 2XBVA 2Z9JA 1FV9A 4U01A 1A4WH 1EATA 3SOSA 4ISNA 2BMGB 1TNGA 2VIWA 4A6LA 2CN0H 5H4IB 2ZDMA 1QJ1B 2BD2A 1OXGA 1GBEA 3ZZDA 1BMAA 1DLKB 1TNKA 2A0QB 2FOAA 2FI4E 4ISHH 5C67A 1AFEH 1GI7B 2ZDVH 3M7PA 1PPCE 3IU3I 1A0JA 3RXSA 3SQEE 1ORFA 3ZD1A 1BMLA 2G81E 4JCNA 1YYY1 3SUDA 1IQIA 2G52A 5C1UA 2IPHA 1S5SA 1ZTJA 2AIQA 3T28A 1FY1A 2OC8A 1ZJDA 1C1OA 2GVFA 1NRQH 4CR9A 1J9CH 5CHAC 1OP8A 3CS0A 1C5RA 1WTHD 3Q3YA 1WOFA 3UNSA 4BTTB 3K65B 3GY7A 3TGIE 1HIAB 1G37A 3QUMP 1M9UA 1ESTA 4SGBE 1OJYA 1P9UA 3QK1A 2VH6A 4NIXA 1PQ5A 4HTCH 5EU8A 2H1UA 1KTTB 2VU8E 4B76A 4MPVA 3RM0H 1O32A 3NKKA 2LPRA 3OY6U 4NFFA 1EQ9A 1RGQA 3OX7U 3F9EA 1N8OB 2ODPA 2I6SA 1FN8A 1V2KT 1ELEE 1AD8H 1L0ZA 1ZPCA 1C1TA 1A5IA 3BG4B 3PLBA 5L30H 3V3MA 3SZNA 1Z92B 2GCTB 3LC3A 1VITF 1BTPA 3VB4A 2B5TB 4FUIA 2FMJA 1OP2A 3TU7H 5DK1A 3ODDA 3DT0H 1MQ5A 2BDCA 1P04A 2IZ4A 1C5SA 1W12U 1Y3YA 4JMYA 1SGRE 4NZLA 4AYYB 4WF8A 2PUXB 5AFZH 1C2JA 1UVTH 4GVUA 3PO1B 3GY6A 4XE4A 3KQEA 1AKSA 1N6XA 4H42U 2GTBA 2R9PA 1GI0A 1O3AA 1XM1A 2FESH 4B2RA 1IOEA 3SU1A 1EAUA 3KNXA 3F1SB 2LOJA 1C1UH 4MPXA 1NS3A 2GD4B 4K1EA 1ZYOA 3C27B 1Z1IA 1EOJA 1O3LA 1RD3B 2BD5A 2ZC9H 1P12E 3A8BA 1A0LA 1VVCA 3EGKH 5JB8S 1VGCB 2AGGX 3URDA 1GJ6A 1LKAA 1C1QA 2BDGA 3UREA 1Y5UT 4B2SA 1V2VT 1PPZA 1THRH 3GY5A 3RXFA 4LZ1H 2BVRH 5JPMH 5C3NA 1O2WA 1C5UA 1UCYH 2J2UA 2MCYA 1F0RA