2V8EA

Crystal structure of human complement factor h, scr domains 6-8 (h402 risk variant), in complex with ligand.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
187
structure length
187
Chain Sequence
MGLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COMPLEMENT FACTOR H
publication title Structural Basis for Complement Factor H Linked Age-Related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2007-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2v8eA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2v8eA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2v8eA03
4ZH1D 2IZ3A 2XQWC 3ZD2A 4AYDA 1QO6A 3R62A 2JRAA 4KKDA 1E8BA 2XWBF 1GHQB 1E5GA 3IU3I 1TPGA 2O39C 5I0QB 1SS2A 4CSYA 5JPMG 4LOSA 2RKYA 1U5MA 5HYPA 5FO8C 3GOVA 4ONTD 3RJ3D 1GKNA 1PPQA 2ERJA 1ZJKA 1Z92B 1OK9A 1OK2A 5HYTB 1OJVA 1C1ZA 2RLQA 1HCCA 1H2PP 1H2QP 2LOJA 2XRDA 1MD8A 4B2RA 4MUCA 4F4OC 2B5ID 2RKZA 1HFIA 1O9AA 2BZMA 1LY2A 3KZJA 3INBC 3M7PA 4J38B 1QUBA 4WJG2 4AYMA 2W81A 4JHSA 2CG7A 1OK1A 3IX0A 4LOTA 2V8EA 2WIIC 1ELVA 2IZ4A 2JGXA 3TVJA 3KXVA 4AYIA 1NWVA 1TPMA 2A55A 2YBYA 3L89M 4AYEA 3CALA 3OP8A 2RL0A 2XWJI 2QY0A 2JGWA 1SRZA 4C16A 1HFHA 3GXEA 1CKLA 1H03P 2EHFA 1GKGA 1VVDA 3SW0X 1G4GA 4DJZA 4K12A 1H04P 1OJWA 4PZ5A 2MCZA 3ERBA 2CKUA 2UWNA 1GPZA 4A5WB 1Q3XA 2YRAA 4YNXA 1TPNA 3EJHA 1G4FA 1OJYA 2G7IA 1OK3A 3MQLA 2XRBA 3OXUD 3O8EB 3ZRZA 2MCYA 2RLPA 5HZPB 4B2SA 1UOTP 5HYUB 1FBRA 4IGDA 1QGBA 1E88A 3NFPI 3OEDC 2W80A 2CG6A 1VVCA 3ZD1A 3T5OA 1MD7A 4FXGG 2KMSA 2KRIA 2EC3A
chains in the Genus database with same CATH superfamily
4ZH1D 2IZ3A 2XQWC 3ZD2A 4AYDA 1QO6A 3R62A 2JRAA 4KKDA 1E8BA 2XWBF 1GHQB 1E5GA 3IU3I 1TPGA 2O39C 5I0QB 1SS2A 4CSYA 3VWOA 3WSYA 2Y8SA 5JPMG 4LOSA 2RKYA 4BWCA 1U5MA 5HYPA 5FO8C 3GOVA 3ZLEA 4ONTD 3RJ3D 1GKNA 1PPQA 2ERJA 3CI0J 1ZJKA 4YIZA 1Z92B 1OK9A 1OK2A 3ZLDA 5HYTB 1OJVA 3FGRA 1C1ZA 2RLQA 1HCCA 1H2PP 1H2QP 2LOJA 2XRDA 1MD8A 2I2LA 4B2RA 4MUCA 4F4OC 2B5ID 2RKZA 1HFIA 1O9AA 4APLA 2BZMA 1LY2A 3KZJA 3INBC 3M7PA 4J38B 1QUBA 1RLHA 3NJAA 4WJG2 4AYMA 2W81A 4JHSA 2CG7A 1OK1A 3IX0A 4LOTA 2V8EA 2WIIC 1ELVA 2IZ4A 2JGXA 3TVJA 3KXVA 4AYIA 1NWVA 1TPMA 2A55A 2YBYA 3L89M 4AYEA 3CALA 3OP8A 2RL0A 2XWJI 2QY0A 2JGWA 2Y8TA 1SRZA 4C16A 1HFHA 3GXEA 1CKLA 1H03P 2EHFA 1GKGA 1VVDA 3SW0X 1G4GA 5DN5A 4DJZA 4K12A 1H04P 1OJWA 4PZ5A 2MCZA 3ERBA 2CKUA 2UWNA 1GPZA 4MSLA 5DN4A 4A5WB 1Q3XA 2X2ZA 2YRAA 4YNXA 1TPNA 3EJHA 1G4FA 1OJYA 2G7IA 1OK3A 3MQLA 2ZYCA 3FGTA 2XRBA 3OXUD 4PO7A 3O8EB 3ZRZA 3F6KA 2MCYA 2RLPA 5HZPB 4B2SA 1UOTP 5HYUB 2Y8RA 1FBRA 4IGDA 1QGBA 3WSXA 1E88A 3NFPI 3OEDC 2W80A 2CG6A 1VVCA 3ZD1A 4N7EA 3T5OA 3K3TA 1MD7A 4FXGG 2KMSA 2KRIA 2EC3A
chains in the Genus database with same CATH topology
4ZH1D 2IZ3A 2XQWC 3ZD2A 4AYDA 1QO6A 3R62A 2JRAA 4KKDA 1E8BA 2XWBF 1GHQB 1E5GA 3IU3I 1TPGA 2O39C 5I0QB 1SS2A 4CSYA 5JPMG 4LOSA 2RKYA 1U5MA 5HYPA 5FO8C 3GOVA 4ONTD 3RJ3D 1GKNA 1PPQA 2ERJA 1ZJKA 1Z92B 1OK9A 1OK2A 5HYTB 1OJVA 1C1ZA 2RLQA 1HCCA 1H2PP 1H2QP 2LOJA 2XRDA 1MD8A 4B2RA 4MUCA 4F4OC 2B5ID 2RKZA 1HFIA 1O9AA 2BZMA 1LY2A 3KZJA 3INBC 3M7PA 4J38B 1QUBA 4WJG2 4AYMA 2W81A 4JHSA 2CG7A 1OK1A 3IX0A 4LOTA 2V8EA 2WIIC 1ELVA 2IZ4A 2JGXA 3TVJA 3KXVA 4AYIA 1NWVA 1TPMA 2A55A 2YBYA 3L89M 4AYEA 3CALA 3OP8A 2RL0A 2XWJI 2QY0A 2JGWA 1SRZA 4C16A 1HFHA 3GXEA 1CKLA 1H03P 2EHFA 1GKGA 1VVDA 3SW0X 1G4GA 4DJZA 4K12A 1H04P 1OJWA 4PZ5A 2MCZA 3ERBA 2CKUA 2UWNA 1GPZA 4A5WB 1Q3XA 2YRAA 4YNXA 1TPNA 3EJHA 1G4FA 1OJYA 2G7IA 1OK3A 3MQLA 2XRBA 3OXUD 3O8EB 3ZRZA 2MCYA 2RLPA 5HZPB 4B2SA 1UOTP 5HYUB 1FBRA 4IGDA 1QGBA 1E88A 3NFPI 3OEDC 2W80A 2CG6A 1VVCA 3ZD1A 3T5OA 1MD7A 4FXGG 2KMSA 2KRIA 2EC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZH1 D;  2IZ3 A;  2XQW C;  3ZD2 A;  4AYD A;  1QO6 A;  3R62 A;  2JRA A;  4KKD A;  1E8B A;  2XWB F;  1GHQ B;  1E5G A;  3IU3 I;  1TPG A;  2O39 C;  5I0Q B;  1SS2 A;  4CSY A;  5JPM G;  4LOS A;  2RKY A;  1U5M A;  5HYP A;  5FO8 C;  3GOV A;  4ONT D;  3RJ3 D;  1GKN A;  1PPQ A;  2ERJ A;  1ZJK A;  1Z92 B;  1OK9 A;  1OK2 A;  5HYT B;  1OJV A;  1C1Z A;  2RLQ A;  1HCC A;  1H2P P;  1H2Q P;  2LOJ A;  2XRD A;  1MD8 A;  4B2R A;  4MUC A;  4F4O C;  2B5I D;  2RKZ A;  1HFI A;  1O9A A;  2BZM A;  1LY2 A;  3KZJ A;  3INB C;  3M7P A;  4J38 B;  1QUB A;  4WJG 2;  4AYM A;  2W81 A;  4JHS A;  2CG7 A;  1OK1 A;  3IX0 A;  4LOT A;  2V8E A;  2WII C;  1ELV A;  2IZ4 A;  2JGX A;  3TVJ A;  3KXV A;  4AYI A;  1NWV A;  1TPM A;  2A55 A;  2YBY A;  3L89 M;  4AYE A;  3CAL A;  3OP8 A;  2RL0 A;  2XWJ I;  2QY0 A;  2JGW A;  1SRZ A;  4C16 A;  1HFH A;  3GXE A;  1CKL A;  1H03 P;  2EHF A;  1GKG A;  1VVD A;  3SW0 X;  1G4G A;  4DJZ A;  4K12 A;  1H04 P;  1OJW A;  4PZ5 A;  2MCZ A;  3ERB A;  2CKU A;  2UWN A;  1GPZ A;  4A5W B;  1Q3X A;  2YRA A;  4YNX A;  1TPN A;  3EJH A;  1G4F A;  1OJY A;  2G7I A;  1OK3 A;  3MQL A;  2XRB A;  3OXU D;  3O8E B;  3ZRZ A;  2MCY A;  2RLP A;  5HZP B;  4B2S A;  1UOT P;  5HYU B;  1FBR A;  4IGD A;  1QGB A;  1E88 A;  3NFP I;  3OED C;  2W80 A;  2CG6 A;  1VVC A;  3ZD1 A;  3T5O A;  1MD7 A;  4FXG G;  2KMS A;  2KRI A;  2EC3 A; 
#chains in the Genus database with same CATH topology
 4ZH1 D;  2IZ3 A;  2XQW C;  3ZD2 A;  4AYD A;  1QO6 A;  3R62 A;  2JRA A;  4KKD A;  1E8B A;  2XWB F;  1GHQ B;  1E5G A;  3IU3 I;  1TPG A;  2O39 C;  5I0Q B;  1SS2 A;  4CSY A;  3VWO A;  3WSY A;  2Y8S A;  5JPM G;  4LOS A;  2RKY A;  4BWC A;  1U5M A;  5HYP A;  5FO8 C;  3GOV A;  3ZLE A;  4ONT D;  3RJ3 D;  1GKN A;  1PPQ A;  2ERJ A;  3CI0 J;  1ZJK A;  4YIZ A;  1Z92 B;  1OK9 A;  1OK2 A;  3ZLD A;  5HYT B;  1OJV A;  3FGR A;  1C1Z A;  2RLQ A;  1HCC A;  1H2P P;  1H2Q P;  2LOJ A;  2XRD A;  1MD8 A;  2I2L A;  4B2R A;  4MUC A;  4F4O C;  2B5I D;  2RKZ A;  1HFI A;  1O9A A;  4APL A;  2BZM A;  1LY2 A;  3KZJ A;  3INB C;  3M7P A;  4J38 B;  1QUB A;  1RLH A;  3NJA A;  4WJG 2;  4AYM A;  2W81 A;  4JHS A;  2CG7 A;  1OK1 A;  3IX0 A;  4LOT A;  2V8E A;  2WII C;  1ELV A;  2IZ4 A;  2JGX A;  3TVJ A;  3KXV A;  4AYI A;  1NWV A;  1TPM A;  2A55 A;  2YBY A;  3L89 M;  4AYE A;  3CAL A;  3OP8 A;  2RL0 A;  2XWJ I;  2QY0 A;  2JGW A;  2Y8T A;  1SRZ A;  4C16 A;  1HFH A;  3GXE A;  1CKL A;  1H03 P;  2EHF A;  1GKG A;  1VVD A;  3SW0 X;  1G4G A;  5DN5 A;  4DJZ A;  4K12 A;  1H04 P;  1OJW A;  4PZ5 A;  2MCZ A;  3ERB A;  2CKU A;  2UWN A;  1GPZ A;  4MSL A;  5DN4 A;  4A5W B;  1Q3X A;  2X2Z A;  2YRA A;  4YNX A;  1TPN A;  3EJH A;  1G4F A;  1OJY A;  2G7I A;  1OK3 A;  3MQL A;  2ZYC A;  3FGT A;  2XRB A;  3OXU D;  4PO7 A;  3O8E B;  3ZRZ A;  3F6K A;  2MCY A;  2RLP A;  5HZP B;  4B2S A;  1UOT P;  5HYU B;  2Y8R A;  1FBR A;  4IGD A;  1QGB A;  3WSX A;  1E88 A;  3NFP I;  3OED C;  2W80 A;  2CG6 A;  1VVC A;  3ZD1 A;  4N7E A;  3T5O A;  3K3T A;  1MD7 A;  4FXG G;  2KMS A;  2KRI A;  2EC3 A; 
#chains in the Genus database with same CATH homology
 4ZH1 D;  2IZ3 A;  2XQW C;  3ZD2 A;  4AYD A;  1QO6 A;  3R62 A;  2JRA A;  4KKD A;  1E8B A;  2XWB F;  1GHQ B;  1E5G A;  3IU3 I;  1TPG A;  2O39 C;  5I0Q B;  1SS2 A;  4CSY A;  5JPM G;  4LOS A;  2RKY A;  1U5M A;  5HYP A;  5FO8 C;  3GOV A;  4ONT D;  3RJ3 D;  1GKN A;  1PPQ A;  2ERJ A;  1ZJK A;  1Z92 B;  1OK9 A;  1OK2 A;  5HYT B;  1OJV A;  1C1Z A;  2RLQ A;  1HCC A;  1H2P P;  1H2Q P;  2LOJ A;  2XRD A;  1MD8 A;  4B2R A;  4MUC A;  4F4O C;  2B5I D;  2RKZ A;  1HFI A;  1O9A A;  2BZM A;  1LY2 A;  3KZJ A;  3INB C;  3M7P A;  4J38 B;  1QUB A;  4WJG 2;  4AYM A;  2W81 A;  4JHS A;  2CG7 A;  1OK1 A;  3IX0 A;  4LOT A;  2V8E A;  2WII C;  1ELV A;  2IZ4 A;  2JGX A;  3TVJ A;  3KXV A;  4AYI A;  1NWV A;  1TPM A;  2A55 A;  2YBY A;  3L89 M;  4AYE A;  3CAL A;  3OP8 A;  2RL0 A;  2XWJ I;  2QY0 A;  2JGW A;  1SRZ A;  4C16 A;  1HFH A;  3GXE A;  1CKL A;  1H03 P;  2EHF A;  1GKG A;  1VVD A;  3SW0 X;  1G4G A;  4DJZ A;  4K12 A;  1H04 P;  1OJW A;  4PZ5 A;  2MCZ A;  3ERB A;  2CKU A;  2UWN A;  1GPZ A;  4A5W B;  1Q3X A;  2YRA A;  4YNX A;  1TPN A;  3EJH A;  1G4F A;  1OJY A;  2G7I A;  1OK3 A;  3MQL A;  2XRB A;  3OXU D;  3O8E B;  3ZRZ A;  2MCY A;  2RLP A;  5HZP B;  4B2S A;  1UOT P;  5HYU B;  1FBR A;  4IGD A;  1QGB A;  1E88 A;  3NFP I;  3OED C;  2W80 A;  2CG6 A;  1VVC A;  3ZD1 A;  3T5O A;  1MD7 A;  4FXG G;  2KMS A;  2KRI A;  2EC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...