2IZ4A

Solution structure of porcine beta-microseminoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
molecule tags Inhibitor
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz4A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz4A02
4F4OC 2CKUA 2JGWA 3OEDC 1SS2A 1GKNA 2QY0A 1OJVA 5HYUB 1U5MA 3NFPI 4AYIA 4FXGG 3CALA 1G4FA 2RKYA 1OK9A 1OK3A 1Z92B 2MCZA 1H03P 1E8BA 2KMSA 3IU3I 3IX0A 3KXVA 4AYMA 2V8EA 4IGDA 1LY2A 2YRAA 2KRIA 4JHSA 1MD7A 2W80A 2YBYA 5HZPB 3RJ3D 1TPMA 2B5ID 1E5GA 4YNXA 4AYDA 1O9AA 3OP8A 5JPMG 4LOTA 1UOTP 1GKGA 2A55A 3O8EB 4KKDA 2IZ3A 1C1ZA 5HYPA 1ZJKA 1QUBA 5HYTB 2W81A 4PZ5A 3L89M 2RL0A 4ONTD 1OK2A 1MD8A 2G7IA 2MCYA 3GXEA 3R62A 1GPZA 2WIIC 1HCCA 2XWJI 2XQWC 1QO6A 3ZD2A 3SW0X 1HFHA 2O39C 2XWBF 1G4GA 1VVDA 3OXUD 1ELVA 3INBC 1QGBA 4K12A 1H04P 4C16A 4B2SA 2RLPA 1TPNA 1SRZA 2XRDA 3TVJA 1GHQB 1H2PP 3ERBA 4AYEA 2EC3A 3GOVA 1NWVA 2CG7A 2LOJA 3KZJA 1Q3XA 1OJYA 3M7PA 2CG6A 2JRAA 1OK1A 3EJHA 3ZRZA 5FO8C 1FBRA 1VVCA 1OJWA 1PPQA 1E88A 2RLQA 2EHFA 2IZ4A 1HFIA 1CKLA 2BZMA 1H2QP 2JGXA 4WJG2 4B2RA 2XRBA 1TPGA 3MQLA 2RKZA 4CSYA 3T5OA 2ERJA 2UWNA 5I0QB 4J38B 4ZH1D 4LOSA 3ZD1A 4DJZA 4A5WB 4MUCA
chains in the Genus database with same CATH superfamily
2JGWA 4E30A 2E2II 3OEDC 3PO3S 1X0TA 1GKNA 4NOZA 1YITZ 2QY0A 3JAMf 4DQYB 4E2WA 1QVFY 2JA5I 1G4FA 2RKYA 1DL6A 5LL6f 3U50C 1NUIA 3KIHA 4E2ZA 1K731 3GTLI 3CPWZ 1VQ51 3KXVA 3PO2I 3CME1 2BJOA 3M3YI 2YADA 1YI21 2YRAA 4BY1I 4JHSA 2W80A 2QR1B 3WSYA 1E5GA 1Q861 1O9AA 1VQ8Z 5D1OB 1YJNZ 3CCQZ 2K5RA 2WB1A 2M48A 2OOYB 3O8EB 1RO4A 3HKZA 1C1ZA 2JA8I 1NP6A 1TWFI 4A3BI 2W81A 1VQKZ 4NBDA 3J7A4 3GXEA 1GPZA 1K8A1 1WZNA 1HCCA 1WIIA 1KQSZ 3QWUA 1YJW1 5C4XI 3GTMI 1QO6A 1W2BY 2F4OA 3S2HI 3H3VJ 3I561 2JNYA 2O53A 2QA41 2LEXA 3OXUD 3I4MI 3CPWY 1RO0A 2QEX1 1QXFA 3VWOA 5D1OA 1H04P 4C16A 1Q822 2QLVB 2NAPA 1TPNA 1Z01A 1SRZA 3NH5A 3GKQA 3GTQI 3TVJA 2RIQA 1QF8A 4QTTA 2CG7A 1Z02A 3KZJA 1YIT1 3RZOI 4APLA 2Y8SA 2OZKA 5CM2M 5A2Qb 2VPYA 1OK1A 3EJHA 3ZRZA 3CCRZ 2E2HI 4RVDA 2O4HA 2JR6A 4TNUA 2IZ4A 2K3RA 3CC71 4NFRA 3MZKB 1FDIA 4N7EA 3CQZI 1CKLA 1N8R1 1KQSY 1TPGA 1YUKA 2R92I 5D1PA 2RKZA 4MONA 3CCSZ 2V8JA 4YIZA 5C4JI 1K8A2 1VQ81 4A3II 2GTHA 4NH1C 4LOSA 3CCLZ 1YJN1 2RHBA 3OW2Z 3CCQ1 1SFOI 2W03A 3CC2Z 1VQNZ 1K9M1 3CMAZ 4F4OC 2NVQI 2CKUA 4NBCA 2VPXA 2NVXI 3JAMb 3EERA 2Q4ZA 3NFPI 4AYIA 1L1OC 3G4SZ 3I55Z 2PMZA 4MH4A 1TWHI 3FQQA 1E8BA 3S1RI 1VQ7Z 5IP9I 2DE5A 3IU3I 4A3LI 3S1QI 4AYMA 1X3ZA 1AA6A 1YIJZ 4RVHA 4IGDA 2KI7B 2QRCB 1LY2A 1VQOZ 1MD7A 3KIFA 1TPMA 2B5ID 4E33A 2B63I 3NDIA 3OP8A 3CXCY 5IT9f 3CD6Z 4LOTA 2IV2X 3ZLDA 4RV9A 4MD7A 2QREB 2A55A 2VPWA 3VMHA 1RLHA 1Q821 2IZ3A 1N8R2 5FLMI 2HU9A 1QUBA 1YUAA 3OW2Y 3CCR1 1WW9A 2G7IA 2MCYA 3S14I 4NB9A 2XWJI 5FLXb 5C3EI 1VQ9Z 3ZD2A 2KPIA 1VQMZ 1K9M2 1Q811 2O39C 1VQPZ 2XWBF 1YHQZ 3F6KA 4A3CI 3CCJZ 2Y8RA 3HOXI 4CL1A 3INBC 2DE6A 3CCS1 3ESWA 3FGRA 1M1K2 3MZLB 3CCL1 3NJAA 1VQN1 3D2LA 5IP7I 1GHQB 4AYEA 3ERBA 2LIYA 3VMIA 1NWVA 2LOJA 1JWHC 4BBSI 1Q3XA 3PO3I 2JRAA 4MRIA 4A3MI 3HOZI 1X3WA 3VMGA 2Y8TA 2JIMA 3LUSA 3GTGI 3CI0J 3J80f 1OJWA 4HGYA 1PPQA 1E88A 1VQ71 1Z03A 3J81f 2ZYCA 1PFTA 4DGLA 1VQLZ 1TWGI 3H0GI 1WJ2A 2I2LA 2PK7A 2QRDB 3D6WA 2OTLZ 2JGXA 1H2QP 4B2RA 3RZDI 1VQO1 3EEDA 1VQ4Z 2Y0SA 3T5OA 5I0QB 4MD8A 3ZLEA 3I07A 1P9NA 3CD61 4Y7NI 1Q812 2M6NA 3CCMZ 3CC4Z 2VUMI 3G6EZ 2V8IA 1SS2A 4PO7A 1M901 5HYUB 1OJVA 4FXGG 3CCEZ 5C44I 4A3DI 2R93I 2LFUA 4NBBA 1OK3A 1Z92B 1RNIA 2MCZA 2EGTA 1VQ91 3P5JB 1VQM1 2KMSA 5DN5A 4A3KI 1VQP1 2R7ZI 2V8EA 4RVGA 2RT9A 3CCJ1 4E2YA 1USPB 2E9HA 2YBYA 1R9TI 1JJ2Z 5IT9b 1KD11 1YI2Z 1VQK1 1FDOA 4HGZA 2PM9A 3S16I 3S2DI 3NDJA 1VQ6Z 3Q87A 4X6AI 1M1K1 5HYPA 4PZ5A 1YJ9Z 4A3JI 2J6AA 2JA7I 3M4OI 2JA6I 2YU9I 2Q51A 1USPA 3SW0X 2WAQA 2OTL1 2RBLA 1Y8CA 1G4GA 1VVDA 1M902 1ELVA 2W04A 1K83I 2I3CA 1QGBA 1VQ41 1LQLA 4K12A 1Y1WI 3S17I 2RLPA 2OOXB 2JIRA 4MD9A 3S15I 2H85A 4XX2A 2QA4Z 1H2PP 4NBFA 2AYDA 1QYPA 3CCM1 3F3PC 3IR7A 3CC41 4E32A 1JJ2Y 3I4NI 3VB9A 1TFIA 2HF1A 1Y1VI 2NVTI 3S1MI 3M7PA 2CG6A 5AN9F 3CCE1 4NBGA 3T4NB 3GTOI 2NVYI 3NH4A 1NJI1 1ZB9A 4BBRI 3J80b 1SIWA 1FBRA 2E7ZA 1KD12 3J81b 2JIPA 1ML8A 3GCFA 1W2BZ 3GTMS 1HFIA 1RLYA 4BXXI 1RO2A 4WJG2 1ZB8A 3IFUA 4EWCA 2ZAEB 3S1NI 2VUGA 1Q7Y1 2JIQA 3CC21 3CC7Z 3CCUZ 3MQLA 4E31A 3CMA1 2GTIA 4CSYA 3GTKI 4AYBA 2AKLA 2UWNA 4ZH1D 4DK1A 3MONA 4HH4A 4DJZA 4NBHA 4A5WB 2V3VA 3G4S1 1VQ61 1N2FA 3CCVZ 2R6MA 4QTUA 3I551 1I3QI 4A3FI 3NFZA 4BWCA 1YJ91 1U5MA 4MXUA 3CALA 2QKDA 1Q16A 1ZH1A 1OK9A 4MSLA 1YIJ1 3TDHB 4E2XA 1H03P 3HOUI 1VLAA 4NB8A 3IX0A 3K3TA 4NBAA 4Y52I 3HOYI 4RVFA 1S72Z 5FLXf 3G71Z 2KRIA 3VTNA 1NJI2 5HZPB 3RJ3D 5T64A 4YNXA 4AYDA 3FGTA 1KRLA 4BY7I 5JPMG 1UOTP 1GKGA 3FKII 2GU2A 2OTJZ 4KKDA 1K732 3HOWI 1KC81 3BG0B 1ZJKA 1Q7Y2 5HYTB 3L89M 2RL0A 4ONTD 1OK2A 1MD8A 2X2ZA 2E2JI 3R62A 2F4MA 2V8KA 2WIIC 4A3EI 1YHQ1 4A93I 2XQWC 1WCMI 1VQ5Z 4NBEA 1QVGZ 1Q862 2JIOA 1HFHA 1I6HI 3CMEZ 3CCU1 3GTPI 2VF1A 3WSXA 2P3YA 1TWCI 4B2SA 2XRDA 3CXCZ 1I50I 1QVFZ 2EC3A 4A3GI 3GOVA 3CCV1 2JMOA 1OJYA 1TWAI 2DE7A 5A2Qf 1RQFA 1VQL1 2P28A 5DN4A 5T6BA 1Y1VS 5FO8C 3F3FC 3GTJI 3FQMA 1VVCA 3NH8A 2RLQA 2EHFA 1YJWZ 2G2KA 2JUBA 2BZMA 3I56Z 1S721 2JS4A 1KC82 4RS4A 1S7MA 2VPZA 2XRBA 3G711 3K7AI 3D9XA 3TE5B 4S1TA 2QEXZ 1QVGY 2RPRA 2ERJA 5T67A 3G6E1 4J38B 3ZD1A 3BG1B 2V45A 3HOVI 4MUCA 2OTJ1 3IF8A
chains in the Genus database with same CATH topology
2JGWA 4E30A 2E2II 3OEDC 3PO3S 1X0TA 1GKNA 4NOZA 1YITZ 2QY0A 3JAMf 4DQYB 4E2WA 1QVFY 2JA5I 1G4FA 2RKYA 1DL6A 5LL6f 3U50C 1NUIA 3KIHA 4E2ZA 1K731 3GTLI 3CPWZ 1VQ51 3KXVA 3PO2I 3CME1 2BJOA 3M3YI 2YADA 1YI21 2YRAA 4BY1I 4JHSA 2W80A 2QR1B 1E5GA 1Q861 1O9AA 1VQ8Z 5D1OB 1YJNZ 3CCQZ 2K5RA 2WB1A 2M48A 2OOYB 3O8EB 1RO4A 3HKZA 1C1ZA 2JA8I 1NP6A 1TWFI 4A3BI 2W81A 1VQKZ 4NBDA 3J7A4 3GXEA 1GPZA 1K8A1 1HCCA 1WIIA 1KQSZ 3QWUA 1YJW1 5C4XI 3GTMI 1QO6A 1W2BY 2F4OA 3S2HI 3H3VJ 3I561 2JNYA 2O53A 2QA41 3OXUD 3I4MI 3CPWY 1RO0A 2QEX1 5D1OA 1H04P 4C16A 1Q822 2QLVB 1TPNA 1Z01A 1SRZA 3NH5A 3GKQA 3GTQI 3TVJA 2RIQA 1QF8A 4QTTA 2CG7A 1Z02A 3KZJA 1YIT1 3RZOI 2OZKA 5CM2M 5A2Qb 1OK1A 3EJHA 3ZRZA 3CCRZ 2E2HI 4RVDA 2O4HA 2JR6A 4TNUA 2IZ4A 2K3RA 3CC71 4NFRA 3MZKB 3CQZI 1CKLA 1N8R1 1KQSY 1TPGA 1YUKA 2R92I 5D1PA 2RKZA 4MONA 3CCSZ 2V8JA 5C4JI 1K8A2 1VQ81 4A3II 2GTHA 4NH1C 4LOSA 3CCLZ 1YJN1 2RHBA 3OW2Z 3CCQ1 1SFOI 2W03A 3CC2Z 1VQNZ 1K9M1 3CMAZ 4F4OC 2NVQI 2CKUA 4NBCA 2NVXI 3JAMb 3EERA 2Q4ZA 3NFPI 4AYIA 1L1OC 3G4SZ 3I55Z 2PMZA 4MH4A 1TWHI 3FQQA 1E8BA 3S1RI 1VQ7Z 5IP9I 2DE5A 3IU3I 4A3LI 3S1QI 4AYMA 1X3ZA 1YIJZ 4RVHA 4IGDA 2KI7B 2QRCB 1LY2A 1VQOZ 1MD7A 3KIFA 1TPMA 2B5ID 4E33A 2B63I 3NDIA 3OP8A 3CXCY 5IT9f 3CD6Z 4LOTA 4RV9A 4MD7A 2QREB 2A55A 3VMHA 1Q821 2IZ3A 1N8R2 5FLMI 2HU9A 1QUBA 1YUAA 3OW2Y 3CCR1 1WW9A 2G7IA 2MCYA 3S14I 4NB9A 2XWJI 5FLXb 5C3EI 1VQ9Z 3ZD2A 2KPIA 1VQMZ 1K9M2 1Q811 2O39C 1VQPZ 2XWBF 1YHQZ 4A3CI 3CCJZ 3HOXI 4CL1A 3INBC 2DE6A 3CCS1 3ESWA 1M1K2 3MZLB 3CCL1 1VQN1 5IP7I 1GHQB 4AYEA 3ERBA 2LIYA 3VMIA 1NWVA 2LOJA 1JWHC 4BBSI 1Q3XA 3PO3I 2JRAA 4MRIA 4A3MI 3HOZI 1X3WA 3VMGA 3LUSA 3GTGI 3J80f 1OJWA 4HGYA 1PPQA 1E88A 1VQ71 1Z03A 3J81f 1PFTA 4DGLA 1VQLZ 1TWGI 3H0GI 2PK7A 2QRDB 3D6WA 2OTLZ 2JGXA 1H2QP 4B2RA 3RZDI 1VQO1 3EEDA 1VQ4Z 2Y0SA 3T5OA 5I0QB 4MD8A 3I07A 1P9NA 3CD61 4Y7NI 1Q812 2M6NA 3CCMZ 3CC4Z 2VUMI 3G6EZ 2V8IA 1SS2A 1M901 5HYUB 1OJVA 4FXGG 3CCEZ 5C44I 4A3DI 2R93I 2LFUA 4NBBA 1OK3A 1Z92B 1RNIA 2MCZA 2EGTA 1VQ91 3P5JB 1VQM1 2KMSA 4A3KI 1VQP1 2R7ZI 2V8EA 4RVGA 2RT9A 3CCJ1 4E2YA 1USPB 2E9HA 2YBYA 1R9TI 1JJ2Z 5IT9b 1KD11 1YI2Z 1VQK1 4HGZA 2PM9A 3S16I 3S2DI 3NDJA 1VQ6Z 3Q87A 4X6AI 1M1K1 5HYPA 4PZ5A 1YJ9Z 4A3JI 2J6AA 2JA7I 3M4OI 2JA6I 2YU9I 2Q51A 1USPA 3SW0X 2WAQA 2OTL1 2RBLA 1G4GA 1VVDA 1M902 1ELVA 2W04A 1K83I 2I3CA 1QGBA 1VQ41 1LQLA 4K12A 1Y1WI 3S17I 2RLPA 2OOXB 4MD9A 3S15I 2H85A 4XX2A 2QA4Z 1H2PP 4NBFA 1QYPA 3CCM1 3F3PC 3CC41 4E32A 1JJ2Y 3I4NI 3VB9A 1TFIA 2HF1A 1Y1VI 2NVTI 3S1MI 3M7PA 2CG6A 5AN9F 3CCE1 4NBGA 3T4NB 3GTOI 2NVYI 3NH4A 1NJI1 1ZB9A 4BBRI 3J80b 1FBRA 1KD12 3J81b 3GTMS 1ML8A 3GCFA 1W2BZ 1HFIA 1RLYA 4BXXI 1RO2A 4WJG2 1ZB8A 3IFUA 4EWCA 2ZAEB 3S1NI 2VUGA 1Q7Y1 3CC7Z 3CC21 3CCUZ 3MQLA 4E31A 3CMA1 2GTIA 4CSYA 3GTKI 4AYBA 2AKLA 2UWNA 4ZH1D 4DK1A 3MONA 4HH4A 4DJZA 4NBHA 4A5WB 3G4S1 1VQ61 1N2FA 3CCVZ 2R6MA 4QTUA 3I551 1I3QI 4A3FI 3NFZA 1YJ91 1U5MA 4MXUA 3CALA 2QKDA 1ZH1A 1OK9A 1YIJ1 3TDHB 4E2XA 1H03P 3HOUI 1VLAA 4NB8A 3IX0A 4NBAA 4Y52I 3HOYI 4RVFA 1S72Z 5FLXf 3G71Z 2KRIA 3VTNA 1NJI2 5HZPB 3RJ3D 5T64A 4YNXA 4AYDA 1KRLA 4BY7I 5JPMG 1UOTP 1GKGA 3FKII 2GU2A 2OTJZ 4KKDA 1K732 3HOWI 1KC81 3BG0B 1ZJKA 1Q7Y2 5HYTB 3L89M 2RL0A 4ONTD 1OK2A 1MD8A 2E2JI 3R62A 2F4MA 2V8KA 2WIIC 4A3EI 1YHQ1 4A93I 2XQWC 1WCMI 1VQ5Z 4NBEA 1QVGZ 1Q862 1HFHA 1I6HI 3CMEZ 3CCU1 3GTPI 2VF1A 2P3YA 1TWCI 4B2SA 2XRDA 3CXCZ 1I50I 1QVFZ 2EC3A 4A3GI 3GOVA 3CCV1 2JMOA 1OJYA 1TWAI 2DE7A 5A2Qf 1RQFA 1VQL1 2P28A 5T6BA 1Y1VS 5FO8C 3F3FC 3GTJI 3FQMA 1VVCA 3NH8A 2RLQA 2EHFA 1YJWZ 2G2KA 2JUBA 2BZMA 3I56Z 1S721 2JS4A 1KC82 4RS4A 1S7MA 3G711 2XRBA 3K7AI 3D9XA 3TE5B 4S1TA 2QEXZ 1QVGY 2RPRA 2ERJA 5T67A 3G6E1 4J38B 3ZD1A 3BG1B 3HOVI 4MUCA 2OTJ1 3IF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F4O C;  2CKU A;  2JGW A;  3OED C;  1SS2 A;  1GKN A;  2QY0 A;  1OJV A;  5HYU B;  1U5M A;  3NFP I;  4AYI A;  4FXG G;  3CAL A;  1G4F A;  2RKY A;  1OK9 A;  1OK3 A;  1Z92 B;  2MCZ A;  1H03 P;  1E8B A;  2KMS A;  3IU3 I;  3IX0 A;  3KXV A;  4AYM A;  2V8E A;  4IGD A;  1LY2 A;  2YRA A;  2KRI A;  4JHS A;  1MD7 A;  2W80 A;  2YBY A;  5HZP B;  3RJ3 D;  1TPM A;  2B5I D;  1E5G A;  4YNX A;  4AYD A;  1O9A A;  3OP8 A;  5JPM G;  4LOT A;  1UOT P;  1GKG A;  2A55 A;  3O8E B;  4KKD A;  2IZ3 A;  1C1Z A;  5HYP A;  1ZJK A;  1QUB A;  5HYT B;  2W81 A;  4PZ5 A;  3L89 M;  2RL0 A;  4ONT D;  1OK2 A;  1MD8 A;  2G7I A;  2MCY A;  3GXE A;  3R62 A;  1GPZ A;  2WII C;  1HCC A;  2XWJ I;  2XQW C;  1QO6 A;  3ZD2 A;  3SW0 X;  1HFH A;  2O39 C;  2XWB F;  1G4G A;  1VVD A;  3OXU D;  1ELV A;  3INB C;  1QGB A;  4K12 A;  1H04 P;  4C16 A;  4B2S A;  2RLP A;  1TPN A;  1SRZ A;  2XRD A;  3TVJ A;  1GHQ B;  1H2P P;  3ERB A;  4AYE A;  2EC3 A;  3GOV A;  1NWV A;  2CG7 A;  2LOJ A;  3KZJ A;  1Q3X A;  1OJY A;  3M7P A;  2CG6 A;  2JRA A;  1OK1 A;  3EJH A;  3ZRZ A;  5FO8 C;  1FBR A;  1VVC A;  1OJW A;  1PPQ A;  1E88 A;  2RLQ A;  2EHF A;  2IZ4 A;  1HFI A;  1CKL A;  2BZM A;  1H2Q P;  2JGX A;  4WJG 2;  4B2R A;  2XRB A;  1TPG A;  3MQL A;  2RKZ A;  4CSY A;  3T5O A;  2ERJ A;  2UWN A;  5I0Q B;  4J38 B;  4ZH1 D;  4LOS A;  3ZD1 A;  4DJZ A;  4A5W B;  4MUC A; 
#chains in the Genus database with same CATH topology
 2JGW A;  4E30 A;  2E2I I;  3OED C;  3PO3 S;  1X0T A;  1GKN A;  4NOZ A;  1YIT Z;  2QY0 A;  3JAM f;  4DQY B;  4E2W A;  1QVF Y;  2JA5 I;  1G4F A;  2RKY A;  1DL6 A;  5LL6 f;  3U50 C;  1NUI A;  3KIH A;  4E2Z A;  1K73 1;  3GTL I;  3CPW Z;  1VQ5 1;  3KXV A;  3PO2 I;  3CME 1;  2BJO A;  3M3Y I;  2YAD A;  1YI2 1;  2YRA A;  4BY1 I;  4JHS A;  2W80 A;  2QR1 B;  3WSY A;  1E5G A;  1Q86 1;  1O9A A;  1VQ8 Z;  5D1O B;  1YJN Z;  3CCQ Z;  2K5R A;  2WB1 A;  2M48 A;  2OOY B;  3O8E B;  1RO4 A;  3HKZ A;  1C1Z A;  2JA8 I;  1NP6 A;  1TWF I;  4A3B I;  2W81 A;  1VQK Z;  4NBD A;  3J7A 4;  3GXE A;  1GPZ A;  1K8A 1;  1WZN A;  1HCC A;  1WII A;  1KQS Z;  3QWU A;  1YJW 1;  5C4X I;  3GTM I;  1QO6 A;  1W2B Y;  2F4O A;  3S2H I;  3H3V J;  3I56 1;  2JNY A;  2O53 A;  2QA4 1;  2LEX A;  3OXU D;  3I4M I;  3CPW Y;  1RO0 A;  2QEX 1;  1QXF A;  3VWO A;  5D1O A;  1H04 P;  4C16 A;  1Q82 2;  2QLV B;  2NAP A;  1TPN A;  1Z01 A;  1SRZ A;  3NH5 A;  3GKQ A;  3GTQ I;  3TVJ A;  2RIQ A;  1QF8 A;  4QTT A;  2CG7 A;  1Z02 A;  3KZJ A;  1YIT 1;  3RZO I;  4APL A;  2Y8S A;  2OZK A;  5CM2 M;  5A2Q b;  2VPY A;  1OK1 A;  3EJH A;  3ZRZ A;  3CCR Z;  2E2H I;  4RVD A;  2O4H A;  2JR6 A;  4TNU A;  2IZ4 A;  2K3R A;  3CC7 1;  4NFR A;  3MZK B;  1FDI A;  4N7E A;  3CQZ I;  1CKL A;  1N8R 1;  1KQS Y;  1TPG A;  1YUK A;  2R92 I;  5D1P A;  2RKZ A;  4MON A;  3CCS Z;  2V8J A;  4YIZ A;  5C4J I;  1K8A 2;  1VQ8 1;  4A3I I;  2GTH A;  4NH1 C;  4LOS A;  3CCL Z;  1YJN 1;  2RHB A;  3OW2 Z;  3CCQ 1;  1SFO I;  2W03 A;  3CC2 Z;  1VQN Z;  1K9M 1;  3CMA Z;  4F4O C;  2NVQ I;  2CKU A;  4NBC A;  2VPX A;  2NVX I;  3JAM b;  3EER A;  2Q4Z A;  3NFP I;  4AYI A;  1L1O C;  3G4S Z;  3I55 Z;  2PMZ A;  4MH4 A;  1TWH I;  3FQQ A;  1E8B A;  3S1R I;  1VQ7 Z;  5IP9 I;  2DE5 A;  3IU3 I;  4A3L I;  3S1Q I;  4AYM A;  1X3Z A;  1AA6 A;  1YIJ Z;  4RVH A;  4IGD A;  2KI7 B;  2QRC B;  1LY2 A;  1VQO Z;  1MD7 A;  3KIF A;  1TPM A;  2B5I D;  4E33 A;  2B63 I;  3NDI A;  3OP8 A;  3CXC Y;  5IT9 f;  3CD6 Z;  4LOT A;  2IV2 X;  3ZLD A;  4RV9 A;  4MD7 A;  2QRE B;  2A55 A;  2VPW A;  3VMH A;  1RLH A;  1Q82 1;  2IZ3 A;  1N8R 2;  5FLM I;  2HU9 A;  1QUB A;  1YUA A;  3OW2 Y;  3CCR 1;  1WW9 A;  2G7I A;  2MCY A;  3S14 I;  4NB9 A;  2XWJ I;  5FLX b;  5C3E I;  1VQ9 Z;  3ZD2 A;  2KPI A;  1VQM Z;  1K9M 2;  1Q81 1;  2O39 C;  1VQP Z;  2XWB F;  1YHQ Z;  3F6K A;  4A3C I;  3CCJ Z;  2Y8R A;  3HOX I;  4CL1 A;  3INB C;  2DE6 A;  3CCS 1;  3ESW A;  3FGR A;  1M1K 2;  3MZL B;  3CCL 1;  3NJA A;  1VQN 1;  3D2L A;  5IP7 I;  1GHQ B;  4AYE A;  3ERB A;  2LIY A;  3VMI A;  1NWV A;  2LOJ A;  1JWH C;  4BBS I;  1Q3X A;  3PO3 I;  2JRA A;  4MRI A;  4A3M I;  3HOZ I;  1X3W A;  3VMG A;  2Y8T A;  2JIM A;  3LUS A;  3GTG I;  3CI0 J;  3J80 f;  1OJW A;  4HGY A;  1PPQ A;  1E88 A;  1VQ7 1;  1Z03 A;  3J81 f;  2ZYC A;  1PFT A;  4DGL A;  1VQL Z;  1TWG I;  3H0G I;  1WJ2 A;  2I2L A;  2PK7 A;  2QRD B;  3D6W A;  2OTL Z;  2JGX A;  1H2Q P;  4B2R A;  3RZD I;  1VQO 1;  3EED A;  1VQ4 Z;  2Y0S A;  3T5O A;  5I0Q B;  4MD8 A;  3ZLE A;  3I07 A;  1P9N A;  3CD6 1;  4Y7N I;  1Q81 2;  2M6N A;  3CCM Z;  3CC4 Z;  2VUM I;  3G6E Z;  2V8I A;  1SS2 A;  4PO7 A;  1M90 1;  5HYU B;  1OJV A;  4FXG G;  3CCE Z;  5C44 I;  4A3D I;  2R93 I;  2LFU A;  4NBB A;  1OK3 A;  1Z92 B;  1RNI A;  2MCZ A;  2EGT A;  1VQ9 1;  3P5J B;  1VQM 1;  2KMS A;  5DN5 A;  4A3K I;  1VQP 1;  2R7Z I;  2V8E A;  4RVG A;  2RT9 A;  3CCJ 1;  4E2Y A;  1USP B;  2E9H A;  2YBY A;  1R9T I;  1JJ2 Z;  5IT9 b;  1KD1 1;  1YI2 Z;  1VQK 1;  1FDO A;  4HGZ A;  2PM9 A;  3S16 I;  3S2D I;  3NDJ A;  1VQ6 Z;  3Q87 A;  4X6A I;  1M1K 1;  5HYP A;  4PZ5 A;  1YJ9 Z;  4A3J I;  2J6A A;  2JA7 I;  3M4O I;  2JA6 I;  2YU9 I;  2Q51 A;  1USP A;  3SW0 X;  2WAQ A;  2OTL 1;  2RBL A;  1Y8C A;  1G4G A;  1VVD A;  1M90 2;  1ELV A;  2W04 A;  1K83 I;  2I3C A;  1QGB A;  1VQ4 1;  1LQL A;  4K12 A;  1Y1W I;  3S17 I;  2RLP A;  2OOX B;  2JIR A;  4MD9 A;  3S15 I;  2H85 A;  4XX2 A;  2QA4 Z;  1H2P P;  4NBF A;  2AYD A;  1QYP A;  3CCM 1;  3F3P C;  3IR7 A;  3CC4 1;  4E32 A;  1JJ2 Y;  3I4N I;  3VB9 A;  1TFI A;  2HF1 A;  1Y1V I;  2NVT I;  3S1M I;  3M7P A;  2CG6 A;  5AN9 F;  3CCE 1;  4NBG A;  3T4N B;  3GTO I;  2NVY I;  3NH4 A;  1NJI 1;  1ZB9 A;  4BBR I;  3J80 b;  1SIW A;  1FBR A;  2E7Z A;  1KD1 2;  3J81 b;  2JIP A;  1ML8 A;  3GCF A;  1W2B Z;  3GTM S;  1HFI A;  1RLY A;  4BXX I;  1RO2 A;  4WJG 2;  1ZB8 A;  3IFU A;  4EWC A;  2ZAE B;  3S1N I;  2VUG A;  1Q7Y 1;  2JIQ A;  3CC2 1;  3CC7 Z;  3CCU Z;  3MQL A;  4E31 A;  3CMA 1;  2GTI A;  4CSY A;  3GTK I;  4AYB A;  2AKL A;  2UWN A;  4ZH1 D;  4DK1 A;  3MON A;  4HH4 A;  4DJZ A;  4NBH A;  4A5W B;  2V3V A;  3G4S 1;  1VQ6 1;  1N2F A;  3CCV Z;  2R6M A;  4QTU A;  3I55 1;  1I3Q I;  4A3F I;  3NFZ A;  4BWC A;  1YJ9 1;  1U5M A;  4MXU A;  3CAL A;  2QKD A;  1Q16 A;  1ZH1 A;  1OK9 A;  4MSL A;  1YIJ 1;  3TDH B;  4E2X A;  1H03 P;  3HOU I;  1VLA A;  4NB8 A;  3IX0 A;  3K3T A;  4NBA A;  4Y52 I;  3HOY I;  4RVF A;  1S72 Z;  5FLX f;  3G71 Z;  2KRI A;  3VTN A;  1NJI 2;  5HZP B;  3RJ3 D;  5T64 A;  4YNX A;  4AYD A;  3FGT A;  1KRL A;  4BY7 I;  5JPM G;  1UOT P;  1GKG A;  3FKI I;  2GU2 A;  2OTJ Z;  4KKD A;  1K73 2;  3HOW I;  1KC8 1;  3BG0 B;  1ZJK A;  1Q7Y 2;  5HYT B;  3L89 M;  2RL0 A;  4ONT D;  1OK2 A;  1MD8 A;  2X2Z A;  2E2J I;  3R62 A;  2F4M A;  2V8K A;  2WII C;  4A3E I;  1YHQ 1;  4A93 I;  2XQW C;  1WCM I;  1VQ5 Z;  4NBE A;  1QVG Z;  1Q86 2;  2JIO A;  1HFH A;  1I6H I;  3CME Z;  3CCU 1;  3GTP I;  2VF1 A;  3WSX A;  2P3Y A;  1TWC I;  4B2S A;  2XRD A;  3CXC Z;  1I50 I;  1QVF Z;  2EC3 A;  4A3G I;  3GOV A;  3CCV 1;  2JMO A;  1OJY A;  1TWA I;  2DE7 A;  5A2Q f;  1RQF A;  1VQL 1;  2P28 A;  5DN4 A;  5T6B A;  1Y1V S;  5FO8 C;  3F3F C;  3GTJ I;  3FQM A;  1VVC A;  3NH8 A;  2RLQ A;  2EHF A;  1YJW Z;  2G2K A;  2JUB A;  2BZM A;  3I56 Z;  1S72 1;  2JS4 A;  1KC8 2;  4RS4 A;  1S7M A;  2VPZ A;  2XRB A;  3G71 1;  3K7A I;  3D9X A;  3TE5 B;  4S1T A;  2QEX Z;  1QVG Y;  2RPR A;  2ERJ A;  5T67 A;  3G6E 1;  4J38 B;  3ZD1 A;  3BG1 B;  2V45 A;  3HOV I;  4MUC A;  2OTJ 1;  3IF8 A; 
#chains in the Genus database with same CATH homology
 2JGW A;  4E30 A;  2E2I I;  3OED C;  3PO3 S;  1X0T A;  1GKN A;  4NOZ A;  1YIT Z;  2QY0 A;  3JAM f;  4DQY B;  4E2W A;  1QVF Y;  2JA5 I;  1G4F A;  2RKY A;  1DL6 A;  5LL6 f;  3U50 C;  1NUI A;  3KIH A;  4E2Z A;  1K73 1;  3GTL I;  3CPW Z;  1VQ5 1;  3KXV A;  3PO2 I;  3CME 1;  2BJO A;  3M3Y I;  2YAD A;  1YI2 1;  2YRA A;  4BY1 I;  4JHS A;  2W80 A;  2QR1 B;  1E5G A;  1Q86 1;  1O9A A;  1VQ8 Z;  5D1O B;  1YJN Z;  3CCQ Z;  2K5R A;  2WB1 A;  2M48 A;  2OOY B;  3O8E B;  1RO4 A;  3HKZ A;  1C1Z A;  2JA8 I;  1NP6 A;  1TWF I;  4A3B I;  2W81 A;  1VQK Z;  4NBD A;  3J7A 4;  3GXE A;  1GPZ A;  1K8A 1;  1HCC A;  1WII A;  1KQS Z;  3QWU A;  1YJW 1;  5C4X I;  3GTM I;  1QO6 A;  1W2B Y;  2F4O A;  3S2H I;  3H3V J;  3I56 1;  2JNY A;  2O53 A;  2QA4 1;  3OXU D;  3I4M I;  3CPW Y;  1RO0 A;  2QEX 1;  5D1O A;  1H04 P;  4C16 A;  1Q82 2;  2QLV B;  1TPN A;  1Z01 A;  1SRZ A;  3NH5 A;  3GKQ A;  3GTQ I;  3TVJ A;  2RIQ A;  1QF8 A;  4QTT A;  2CG7 A;  1Z02 A;  3KZJ A;  1YIT 1;  3RZO I;  2OZK A;  5CM2 M;  5A2Q b;  1OK1 A;  3EJH A;  3ZRZ A;  3CCR Z;  2E2H I;  4RVD A;  2O4H A;  2JR6 A;  4TNU A;  2IZ4 A;  2K3R A;  3CC7 1;  4NFR A;  3MZK B;  3CQZ I;  1CKL A;  1N8R 1;  1KQS Y;  1TPG A;  1YUK A;  2R92 I;  5D1P A;  2RKZ A;  4MON A;  3CCS Z;  2V8J A;  5C4J I;  1K8A 2;  1VQ8 1;  4A3I I;  2GTH A;  4NH1 C;  4LOS A;  3CCL Z;  1YJN 1;  2RHB A;  3OW2 Z;  3CCQ 1;  1SFO I;  2W03 A;  3CC2 Z;  1VQN Z;  1K9M 1;  3CMA Z;  4F4O C;  2NVQ I;  2CKU A;  4NBC A;  2NVX I;  3JAM b;  3EER A;  2Q4Z A;  3NFP I;  4AYI A;  1L1O C;  3G4S Z;  3I55 Z;  2PMZ A;  4MH4 A;  1TWH I;  3FQQ A;  1E8B A;  3S1R I;  1VQ7 Z;  5IP9 I;  2DE5 A;  3IU3 I;  4A3L I;  3S1Q I;  4AYM A;  1X3Z A;  1YIJ Z;  4RVH A;  4IGD A;  2KI7 B;  2QRC B;  1LY2 A;  1VQO Z;  1MD7 A;  3KIF A;  1TPM A;  2B5I D;  4E33 A;  2B63 I;  3NDI A;  3OP8 A;  3CXC Y;  5IT9 f;  3CD6 Z;  4LOT A;  4RV9 A;  4MD7 A;  2QRE B;  2A55 A;  3VMH A;  1Q82 1;  2IZ3 A;  1N8R 2;  5FLM I;  2HU9 A;  1QUB A;  1YUA A;  3OW2 Y;  3CCR 1;  1WW9 A;  2G7I A;  2MCY A;  3S14 I;  4NB9 A;  2XWJ I;  5FLX b;  5C3E I;  1VQ9 Z;  3ZD2 A;  2KPI A;  1VQM Z;  1K9M 2;  1Q81 1;  2O39 C;  1VQP Z;  2XWB F;  1YHQ Z;  4A3C I;  3CCJ Z;  3HOX I;  4CL1 A;  3INB C;  2DE6 A;  3CCS 1;  3ESW A;  1M1K 2;  3MZL B;  3CCL 1;  1VQN 1;  5IP7 I;  1GHQ B;  4AYE A;  3ERB A;  2LIY A;  3VMI A;  1NWV A;  2LOJ A;  1JWH C;  4BBS I;  1Q3X A;  3PO3 I;  2JRA A;  4MRI A;  4A3M I;  3HOZ I;  1X3W A;  3VMG A;  3LUS A;  3GTG I;  3J80 f;  1OJW A;  4HGY A;  1PPQ A;  1E88 A;  1VQ7 1;  1Z03 A;  3J81 f;  1PFT A;  4DGL A;  1VQL Z;  1TWG I;  3H0G I;  2PK7 A;  2QRD B;  3D6W A;  2OTL Z;  2JGX A;  1H2Q P;  4B2R A;  3RZD I;  1VQO 1;  3EED A;  1VQ4 Z;  2Y0S A;  3T5O A;  5I0Q B;  4MD8 A;  3I07 A;  1P9N A;  3CD6 1;  4Y7N I;  1Q81 2;  2M6N A;  3CCM Z;  3CC4 Z;  2VUM I;  3G6E Z;  2V8I A;  1SS2 A;  1M90 1;  5HYU B;  1OJV A;  4FXG G;  3CCE Z;  5C44 I;  4A3D I;  2R93 I;  2LFU A;  4NBB A;  1OK3 A;  1Z92 B;  1RNI A;  2MCZ A;  2EGT A;  1VQ9 1;  3P5J B;  1VQM 1;  2KMS A;  4A3K I;  1VQP 1;  2R7Z I;  2V8E A;  4RVG A;  2RT9 A;  3CCJ 1;  4E2Y A;  1USP B;  2E9H A;  2YBY A;  1R9T I;  1JJ2 Z;  5IT9 b;  1KD1 1;  1YI2 Z;  1VQK 1;  4HGZ A;  2PM9 A;  3S16 I;  3S2D I;  3NDJ A;  1VQ6 Z;  3Q87 A;  4X6A I;  1M1K 1;  5HYP A;  4PZ5 A;  1YJ9 Z;  4A3J I;  2J6A A;  2JA7 I;  3M4O I;  2JA6 I;  2YU9 I;  2Q51 A;  1USP A;  3SW0 X;  2WAQ A;  2OTL 1;  2RBL A;  1G4G A;  1VVD A;  1M90 2;  1ELV A;  2W04 A;  1K83 I;  2I3C A;  1QGB A;  1VQ4 1;  1LQL A;  4K12 A;  1Y1W I;  3S17 I;  2RLP A;  2OOX B;  4MD9 A;  3S15 I;  2H85 A;  4XX2 A;  2QA4 Z;  1H2P P;  4NBF A;  1QYP A;  3CCM 1;  3F3P C;  3CC4 1;  4E32 A;  1JJ2 Y;  3I4N I;  3VB9 A;  1TFI A;  2HF1 A;  1Y1V I;  2NVT I;  3S1M I;  3M7P A;  2CG6 A;  5AN9 F;  3CCE 1;  4NBG A;  3T4N B;  3GTO I;  2NVY I;  3NH4 A;  1NJI 1;  1ZB9 A;  4BBR I;  3J80 b;  1FBR A;  1KD1 2;  3J81 b;  3GTM S;  1ML8 A;  3GCF A;  1W2B Z;  1HFI A;  1RLY A;  4BXX I;  1RO2 A;  4WJG 2;  1ZB8 A;  3IFU A;  4EWC A;  2ZAE B;  3S1N I;  2VUG A;  1Q7Y 1;  3CC7 Z;  3CC2 1;  3CCU Z;  3MQL A;  4E31 A;  3CMA 1;  2GTI A;  4CSY A;  3GTK I;  4AYB A;  2AKL A;  2UWN A;  4ZH1 D;  4DK1 A;  3MON A;  4HH4 A;  4DJZ A;  4NBH A;  4A5W B;  3G4S 1;  1VQ6 1;  1N2F A;  3CCV Z;  2R6M A;  4QTU A;  3I55 1;  1I3Q I;  4A3F I;  3NFZ A;  1YJ9 1;  1U5M A;  4MXU A;  3CAL A;  2QKD A;  1ZH1 A;  1OK9 A;  1YIJ 1;  3TDH B;  4E2X A;  1H03 P;  3HOU I;  1VLA A;  4NB8 A;  3IX0 A;  4NBA A;  4Y52 I;  3HOY I;  4RVF A;  1S72 Z;  5FLX f;  3G71 Z;  2KRI A;  3VTN A;  1NJI 2;  5HZP B;  3RJ3 D;  5T64 A;  4YNX A;  4AYD A;  1KRL A;  4BY7 I;  5JPM G;  1UOT P;  1GKG A;  3FKI I;  2GU2 A;  2OTJ Z;  4KKD A;  1K73 2;  3HOW I;  1KC8 1;  3BG0 B;  1ZJK A;  1Q7Y 2;  5HYT B;  3L89 M;  2RL0 A;  4ONT D;  1OK2 A;  1MD8 A;  2E2J I;  3R62 A;  2F4M A;  2V8K A;  2WII C;  4A3E I;  1YHQ 1;  4A93 I;  2XQW C;  1WCM I;  1VQ5 Z;  4NBE A;  1QVG Z;  1Q86 2;  1HFH A;  1I6H I;  3CME Z;  3CCU 1;  3GTP I;  2VF1 A;  2P3Y A;  1TWC I;  4B2S A;  2XRD A;  3CXC Z;  1I50 I;  1QVF Z;  2EC3 A;  4A3G I;  3GOV A;  3CCV 1;  2JMO A;  1OJY A;  1TWA I;  2DE7 A;  5A2Q f;  1RQF A;  1VQL 1;  2P28 A;  5T6B A;  1Y1V S;  5FO8 C;  3F3F C;  3GTJ I;  3FQM A;  1VVC A;  3NH8 A;  2RLQ A;  2EHF A;  1YJW Z;  2G2K A;  2JUB A;  2BZM A;  3I56 Z;  1S72 1;  2JS4 A;  1KC8 2;  4RS4 A;  1S7M A;  3G71 1;  2XRB A;  3K7A I;  3D9X A;  3TE5 B;  4S1T A;  2QEX Z;  1QVG Y;  2RPR A;  2ERJ A;  5T67 A;  3G6E 1;  4J38 B;  3ZD1 A;  3BG1 B;  3HOV I;  4MUC A;  2OTJ 1;  3IF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...