2IZ4A

Solution structure of porcine beta-microseminoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
molecule tags Inhibitor
molecule keywords BETA-MICROSEMINOPROTEIN
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz4A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz4A02
5HYPA 1O9AA 4DJZA 2G7IA 4J38B 2XQWC 4PZ5A 2QY0A 3INBC 3M7PA 3MQLA 2CG7A 2BZMA 3SW0X 4B2SA 2MCZA 3OXUD 1HFHA 1E5GA 1Q3XA 2W80A 3R62A 2UWNA 4ONTD 3RJ3D 4F4OC 3KZJA 2MCYA 1E8BA 1Z92B 3GXEA 5HYUB 4LOSA 5FO8C 1QO6A 1GKNA 1SS2A 4JHSA 2RL0A 3OEDC 1SRZA 1MD8A 1ELVA 4MUCA 4WJG2 4K12A 1OJYA 4ZH1D 1H2QP 3TVJA 1VVCA 1C1ZA 1H2PP 3L89M 1TPMA 4B2RA 2IZ4A 4AYEA 2CKUA 2RKZA 1OJVA 1CKLA 1U5MA 1UOTP 3O8EB 1FBRA 2V8EA 1OK2A 1PPQA 3ERBA 2A55A 2XWJI 4FXGG 3T5OA 1GPZA 1OK9A 4AYDA 5JPMG 1HCCA 3ZRZA 3GOVA 2RKYA 2B5ID 1OK1A 2ERJA 3ZD1A 1MD7A 1GHQB 3ZD2A 2JGXA 1LY2A 2RLQA 2RLPA 2JGWA 2KMSA 1GKGA 1ZJKA 1HFIA 1QGBA 1G4FA 1TPGA 4AYIA 3CALA 3IX0A 2YBYA 2O39C 1VVDA 2XRBA 3KXVA 5HZPB 3NFPI 2XRDA 5HYTB 4A5WB 1QUBA 4YNXA 2LOJA 2W81A 1TPNA 4KKDA 4AYMA 1OK3A 4C16A 2WIIC 3IU3I 2IZ3A 1OJWA 2XWBF 4LOTA 3OP8A 2YRAA 2CG6A 2EHFA 1G4GA 1H04P 2JRAA 5I0QB 2EC3A 2KRIA 4IGDA 1H03P 3EJHA 1E88A 4CSYA 1NWVA
chains in the Genus database with same CATH superfamily
4NBBA 4DJZA 2G7IA 3CCR1 4RV9A 4MXUA 1KC81 3F6KA 1YJN1 3I4MI 1L1OC 3GTQI 4E2YA 4E2XA 1K83I 1VQ51 3HOZI 4Y52I 2OZKA 3S16I 1I6HI 4EWCA 4QTUA 2JNYA 3F3FC 1RO2A 3GTMI 5FLXf 2Y0SA 3R62A 1Q811 2UWNA 1WW9A 3KZJA 2OTJ1 1S7MA 1Z92B 2GTIA 3JAMb 3VMHA 1SS2A 3MZKB 4NB8A 4JHSA 1TWCI 4MUCA 2P3YA 4WJG2 4MONA 1OJYA 4ZH1D 2E2II 1C1ZA 3L89M 3I551 2QKDA 1NUIA 1Q862 3JAMf 2F4OA 1CKLA 1FBRA 1VQN1 1OK2A 1PPQA 1VQ81 3ERBA 1WZNA 2QRDB 4FXGG 4BBRI 2AKLA 2PK7A 3D2LA 3CME1 2OTJZ 1Y8CA 1WJ2A 3GOVA 3CCQZ 3I55Z 3CCSZ 2RKYA 1QVGY 3J80b 3OW2Z 1OK1A 4QTTA 2AYDA 3GTOI 2NVTI 4NB9A 1VLAA 1VQMZ 1SFOI 2LFUA 5FLXb 1YIT1 2KMSA 4BY7I 1JJ2Y 3TE5B 4N7EA 1Q7Y1 3CMEZ 3IFUA 1I50I 1QGBA 1G4FA 4E2ZA 3IR7A 1YJWZ 2YBYA 3KXVA 2XRBA 5HZPB 2NVXI 3D6WA 2QEXZ 3MONA 1K732 1SIWA 3ZLEA 1QUBA 4S1TA 4A3II 2X2ZA 3PO2I 1Y1VS 4CL1A 2NAPA 1VQ41 2QREB 3CCE1 1KC82 1P9NA 2WIIC 2BJOA 3IU3I 1YI2Z 1KD12 1OJWA 2HU9A 3G6EZ 3K3TA 3OP8A 1WCMI 3CXCY 2OOYB 4NBFA 4A3CI 3U50C 1QVFZ 4MSLA 1W2BZ 5I0QB 1YI21 1Q822 1VQ71 2EC3A 2KRIA 3NJAA 5T64A 5A2Qb 2R93I 3VB9A 4MH4A 1KQSY 3K7AI 1N8R1 3CCMZ 3S17I 1LQLA 4PZ5A 1K8A1 2OTL1 1RLHA 3MQLA 2O53A 4E32A 1QF8A 2EGTA 2W04A 3OXUD 3CC4Z 2JA6I 4HGYA 1E5GA 3PO3I 1Q3XA 2OOXB 1TWFI 1M901 5D1OA 3VTNA 3RJ3D 4F4OC 3FKII 5LL6f 3QWUA 2JA5I 3FQQA 5FO8C 2IV2X 1TWAI 1KQSZ 1GKNA 1VQNZ 2I2LA 5IP7I 2RL0A 1JWHC 5C3EI 1MD8A 5IT9f 4XX2A 3HOVI 1VQ9Z 3TVJA 4MD9A 1H2PP 2R7ZI 1VQP1 3NH8A 1Q7Y2 2JR6A 3S2HI 1VQ61 4RS4A 2CKUA 1OJVA 3O8EB 3CMA1 1ZB8A 2E2JI 5A2Qf 2ZYCA 5C44I 4MRIA 1TFIA 1USPA 1QVFY 5JPMG 4NH1C 2B5ID 3WSYA 4A3JI 4BBSI 2ERJA 3G4SZ 3I07A 1DL6A 3H0GI 4NBAA 2GU2A 2RLPA 1Z01A 2JGWA 1GKGA 3CCU1 1Q861 3FGTA 1QYPA 1JJ2Z 2P28A 1HFIA 2JUBA 2JMOA 2KPIA 3CALA 3IX0A 2VPYA 2XRDA 2JIPA 1Z03A 4E30A 1TWHI 4RVDA 2PM9A 2QA41 3RZOI 3CQZI 2QA4Z 3CCVZ 4NBDA 4A3FI 2LIYA 4KKDA 4E31A 4A3BI 4AYMA 1PFTA 2RT9A 2Y8RA 2IZ3A 2M6NA 2WAQA 2XWBF 3CD61 4HH4A 5CM2M 1RO0A 4BWCA 3CCUZ 3M3YI 4A3MI 2JRAA 1KRLA 4BY1I 4IGDA 3EJHA 1W2BY 2VPZA 1E88A 3CCJZ 3EERA 3S1MI 3CC21 3HOWI 1K8A2 5HYPA 1O9AA 3NFZA 4J38B 2XQWC 2E9HA 2K3RA 2QY0A 2V8KA 4NOZA 3S15I 3GTLI 3M7PA 3T4NB 3S2DI 2BZMA 2YADA 3I561 3CMAZ 3SW0X 4B2SA 3GTKI 5IP9I 2MCZA 3HOUI 3NH5A 3WSXA 1HFHA 1VQPZ 2J6AA 1VQM1 1ML8A 2F4MA 1N2FA 3CCJ1 1M1K2 4A3GI 4ONTD 2JIQA 1VQ7Z 3CCQ1 3CCS1 2PMZA 3FGRA 2V3VA 5FLMI 2R92I 1FDIA 2MCYA 1E8BA 1YHQ1 5T67A 1YHQZ 5HYUB 1X3WA 4LOSA 1QO6A 3G6E1 2GTHA 3KIHA 1YJ91 1I3QI 3GKQA 1YJNZ 1NJI2 2E2HI 1FDOA 3CCEZ 4K12A 3P5JB 3CC71 5D1PA 3CC7Z 1Q16A 1VQK1 1M902 4RVFA 2NVQI 1TPMA 1S721 3GTMS 2IZ4A 4AYEA 2RKZA 5AN9F 2VUGA 1U5MA 2JIMA 3GCFA 4A3EI 3OW2Y 2OTLZ 3VMGA 1AA6A 1GPZA 2LEXA 1WIIA 4NFRA 1Y1VI 2O4HA 1R9TI 2HF1A 5IT9b 1MD7A 3M4OI 1X3ZA 1K9M2 3VMIA 1LY2A 2JS4A 2Q4ZA 2VUMI 4A3KI 3S1NI 3J81f 1M1K1 4NBGA 4NBCA 1Q812 2DE6A 3I4NI 4BXXI 3NFPI 1NP6A 1K731 3HOYI 3G711 2LOJA 2VPWA 3CCM1 1X0TA 2KI7B 1RNIA 2W81A 5DN4A 2QLVB 1NJI1 1OK3A 1VQ5Z 4C16A 2Q51A 3I56Z 1YUKA 3BG0B 3LUSA 4LOTA 2G2KA 1RQFA 4A3DI 1RLYA 3ESWA 2YRAA 4APLA 2NVYI 3CCL1 2CG6A 3CD6Z 2JIOA 3BG1B 1YITZ 1Q821 3CC2Z 4HGZA 3EEDA 2R6MA 1NWVA 2E7ZA 2VF1A 1QXFA 3CXCZ 4YIZA 3G71Z 3D9XA 3HOXI 3J7A4 1VQ8Z 3J81b 2JIRA 2CG7A 1QVGZ 1S72Z 1VQ6Z 2V45A 3Q87A 1VQKZ 2YU9I 2WB1A 1VQO1 3CI0J 1Z02A 2H85A 2ZAEB 3MZLB 2W80A 1YJ9Z 1VQOZ 4PO7A 5D1OB 1TWGI 3GXEA 4MD8A 4AYBA 3ZLDA 2V8IA 3OEDC 2DE5A 1SRZA 3GTPI 2W03A 1ELVA 1VQ4Z 4RVHA 2QRCB 3G4S1 4A3LI 1K9M1 1H2QP 1USPB 1VVCA 3CCV1 2V8JA 3S14I 1RO4A 2K5RA 1Y1WI 3CC41 2RHBA 4B2RA 5C4JI 1UOTP 2Y8TA 2V8EA 4DK1A 1ZH1A 3NDIA 1YIJ1 2A55A 2XWJI 1VQL1 3T5OA 3GTJI 2JA8I 1OK9A 4AYDA 3NDJA 4E2WA 1HCCA 3ZRZA 3CCRZ 1VQ91 3ZD1A 2RPRA 1GHQB 5DN5A 3ZD2A 2JGXA 4MD7A 5T6BA 4NBHA 2RLQA 2QR1B 1ZB9A 1KD11 3FQMA 1ZJKA 3S1RI 3CCLZ 1YUAA 1TPGA 3RZDI 2RIQA 4AYIA 3S1QI 3J80f 1VQLZ 2DE7A 2O39C 1VVDA 3CPWZ 3IF8A 2VPXA 1YIJZ 3NH4A 2JA7I 4TNUA 5HYTB 4A5WB 4X6AI 4RVGA 4YNXA 4DQYB 1N8R2 3GTGI 2I3CA 1TPNA 3TDHB 5C4XI 4NBEA 3CPWY 2QEX1 3PO3S 3KIFA 2Y8SA 3VWOA 1YJW1 3H3VJ 4A93I 2M48A 2RBLA 2EHFA 1G4GA 1H04P 4Y7NI 3HKZA 2B63I 1H03P 3F3PC 4CSYA 4DGLA 4E33A 3INBC
chains in the Genus database with same CATH topology
4NBBA 4DJZA 2G7IA 3CCR1 4RV9A 4MXUA 1KC81 1YJN1 3I4MI 1L1OC 3GTQI 4E2YA 4E2XA 1K83I 1VQ51 3HOZI 4Y52I 2OZKA 3S16I 1I6HI 4EWCA 4QTUA 2JNYA 3F3FC 1RO2A 3GTMI 5FLXf 2Y0SA 3R62A 1Q811 2UWNA 1WW9A 3KZJA 2OTJ1 1S7MA 1Z92B 2GTIA 3JAMb 3VMHA 1SS2A 3MZKB 4NB8A 4JHSA 1TWCI 4MUCA 2P3YA 4WJG2 4MONA 1OJYA 4ZH1D 2E2II 1C1ZA 3L89M 3I551 2QKDA 1NUIA 1Q862 3JAMf 2F4OA 1CKLA 1FBRA 1VQN1 1OK2A 1PPQA 1VQ81 3ERBA 2QRDB 4FXGG 4BBRI 2AKLA 2PK7A 3CME1 2OTJZ 3GOVA 3CCQZ 3I55Z 3CCSZ 2RKYA 1QVGY 3J80b 3OW2Z 1OK1A 4QTTA 3GTOI 2NVTI 4NB9A 1VLAA 1VQMZ 1SFOI 2LFUA 5FLXb 1YIT1 2KMSA 4BY7I 1JJ2Y 3TE5B 1Q7Y1 3CMEZ 3IFUA 1I50I 1QGBA 1G4FA 4E2ZA 1YJWZ 2YBYA 3KXVA 2XRBA 5HZPB 2NVXI 3D6WA 2QEXZ 3MONA 1K732 1QUBA 4S1TA 4A3II 3PO2I 1Y1VS 4CL1A 1VQ41 2QREB 3CCE1 1KC82 1P9NA 2WIIC 2BJOA 3IU3I 1YI2Z 1KD12 1OJWA 2HU9A 3G6EZ 3OP8A 1WCMI 3CXCY 2OOYB 4NBFA 4A3CI 3U50C 1QVFZ 1W2BZ 5I0QB 1YI21 1Q822 1VQ71 2EC3A 2KRIA 5T64A 5A2Qb 2R93I 3VB9A 4MH4A 1KQSY 3K7AI 1N8R1 3CCMZ 3S17I 1LQLA 4PZ5A 1K8A1 2OTL1 3MQLA 2O53A 4E32A 1QF8A 2EGTA 2W04A 3OXUD 3CC4Z 2JA6I 4HGYA 1E5GA 3PO3I 1Q3XA 2OOXB 1TWFI 1M901 5D1OA 3VTNA 3RJ3D 4F4OC 3FKII 5LL6f 3QWUA 2JA5I 3FQQA 5FO8C 1TWAI 1KQSZ 1GKNA 1VQNZ 5IP7I 2RL0A 1JWHC 5C3EI 1MD8A 5IT9f 4XX2A 3HOVI 1VQ9Z 3TVJA 4MD9A 1H2PP 2R7ZI 1VQP1 3NH8A 1Q7Y2 2JR6A 3S2HI 1VQ61 4RS4A 2CKUA 1OJVA 3O8EB 3CMA1 1ZB8A 2E2JI 5A2Qf 5C44I 4MRIA 1TFIA 1USPA 1QVFY 5JPMG 4NH1C 2B5ID 4A3JI 4BBSI 2ERJA 3G4SZ 3I07A 1DL6A 3H0GI 4NBAA 2GU2A 2RLPA 1Z01A 2JGWA 1GKGA 3CCU1 1Q861 1JJ2Z 1QYPA 2P28A 1HFIA 2JUBA 2JMOA 2KPIA 3CALA 3IX0A 2XRDA 1Z03A 4E30A 1TWHI 4RVDA 2PM9A 2QA41 3RZOI 3CQZI 2QA4Z 3CCVZ 4NBDA 4A3FI 2LIYA 4KKDA 4E31A 4A3BI 4AYMA 1PFTA 2RT9A 2IZ3A 2M6NA 2WAQA 2XWBF 3CD61 4HH4A 5CM2M 1RO0A 3CCUZ 3M3YI 4A3MI 2JRAA 1KRLA 4BY1I 4IGDA 3EJHA 1W2BY 1E88A 3CCJZ 3EERA 3S1MI 3CC21 3HOWI 1K8A2 5HYPA 1O9AA 3NFZA 4J38B 2XQWC 2E9HA 2K3RA 2QY0A 2V8KA 4NOZA 3S15I 3GTLI 3M7PA 3T4NB 3S2DI 2BZMA 2YADA 3I561 3CMAZ 3SW0X 4B2SA 3GTKI 5IP9I 2MCZA 3HOUI 3NH5A 1HFHA 1VQPZ 2J6AA 1VQM1 1ML8A 2F4MA 1N2FA 3CCJ1 1M1K2 4A3GI 4ONTD 1VQ7Z 3CCQ1 3CCS1 2PMZA 5FLMI 2R92I 2MCYA 1E8BA 1YHQ1 5T67A 1YHQZ 5HYUB 1X3WA 4LOSA 1QO6A 3G6E1 2GTHA 3KIHA 1YJ91 1I3QI 3GKQA 1YJNZ 1NJI2 2E2HI 3CCEZ 4K12A 3P5JB 3CC71 5D1PA 3CC7Z 1VQK1 1M902 4RVFA 2NVQI 1TPMA 1S721 3GTMS 2IZ4A 4AYEA 2RKZA 5AN9F 2VUGA 1U5MA 3GCFA 4A3EI 3OW2Y 2OTLZ 3VMGA 1GPZA 1WIIA 4NFRA 1Y1VI 2O4HA 1R9TI 2HF1A 5IT9b 1MD7A 3M4OI 1X3ZA 1K9M2 3VMIA 1LY2A 2JS4A 2Q4ZA 2VUMI 4A3KI 3S1NI 3J81f 1M1K1 4NBGA 4NBCA 1Q812 2DE6A 3I4NI 4BXXI 3NFPI 1NP6A 1K731 3HOYI 3G711 2LOJA 3CCM1 1X0TA 2KI7B 1RNIA 2W81A 2QLVB 1NJI1 1OK3A 1VQ5Z 4C16A 2Q51A 3I56Z 1YUKA 3BG0B 4LOTA 3LUSA 2G2KA 1RQFA 4A3DI 1RLYA 3ESWA 2YRAA 2NVYI 3CCL1 2CG6A 3CD6Z 3BG1B 1YITZ 1Q821 3CC2Z 4HGZA 3EEDA 2R6MA 1NWVA 2VF1A 3CXCZ 3G71Z 3D9XA 3HOXI 3J7A4 1VQ8Z 3J81b 2CG7A 1QVGZ 1S72Z 1VQ6Z 3Q87A 1VQKZ 2YU9I 2WB1A 1VQO1 1Z02A 2H85A 2ZAEB 3MZLB 2W80A 1YJ9Z 1VQOZ 5D1OB 1TWGI 3GXEA 4MD8A 4AYBA 2V8IA 3OEDC 2DE5A 1SRZA 3GTPI 2W03A 1ELVA 1VQ4Z 4RVHA 2QRCB 3G4S1 4A3LI 1K9M1 1H2QP 1USPB 1VVCA 3CCV1 2V8JA 3S14I 1RO4A 2K5RA 1Y1WI 3CC41 2RHBA 4B2RA 5C4JI 1UOTP 1YIJ1 2V8EA 4DK1A 1ZH1A 3NDIA 2A55A 2XWJI 1VQL1 3T5OA 3GTJI 2JA8I 1OK9A 4AYDA 3NDJA 4E2WA 1HCCA 3ZRZA 3CCRZ 1VQ91 3ZD1A 2RPRA 1GHQB 3ZD2A 2JGXA 4MD7A 5T6BA 4NBHA 2RLQA 2QR1B 1ZB9A 1KD11 3FQMA 1ZJKA 3S1RI 3CCLZ 1YUAA 1TPGA 3RZDI 2RIQA 4AYIA 3S1QI 3J80f 1VQLZ 2DE7A 2O39C 1VVDA 3CPWZ 3IF8A 1YIJZ 3NH4A 2JA7I 4TNUA 5HYTB 4A5WB 4X6AI 4RVGA 4YNXA 4DQYB 1N8R2 3GTGI 2I3CA 1TPNA 3TDHB 5C4XI 4NBEA 3CPWY 2QEX1 3PO3S 3KIFA 1YJW1 3H3VJ 4A93I 2M48A 2RBLA 2EHFA 1G4GA 1H04P 4Y7NI 3HKZA 2B63I 1H03P 3F3PC 4CSYA 4DGLA 4E33A 3INBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HYP A;  1O9A A;  4DJZ A;  2G7I A;  4J38 B;  2XQW C;  4PZ5 A;  2QY0 A;  3INB C;  3M7P A;  3MQL A;  2CG7 A;  2BZM A;  3SW0 X;  4B2S A;  2MCZ A;  3OXU D;  1HFH A;  1E5G A;  1Q3X A;  2W80 A;  3R62 A;  2UWN A;  4ONT D;  3RJ3 D;  4F4O C;  3KZJ A;  2MCY A;  1E8B A;  1Z92 B;  3GXE A;  5HYU B;  4LOS A;  5FO8 C;  1QO6 A;  1GKN A;  1SS2 A;  4JHS A;  2RL0 A;  3OED C;  1SRZ A;  1MD8 A;  1ELV A;  4MUC A;  4WJG 2;  4K12 A;  1OJY A;  4ZH1 D;  1H2Q P;  3TVJ A;  1VVC A;  1C1Z A;  1H2P P;  3L89 M;  1TPM A;  4B2R A;  2IZ4 A;  4AYE A;  2CKU A;  2RKZ A;  1OJV A;  1CKL A;  1U5M A;  1UOT P;  3O8E B;  1FBR A;  2V8E A;  1OK2 A;  1PPQ A;  3ERB A;  2A55 A;  2XWJ I;  4FXG G;  3T5O A;  1GPZ A;  1OK9 A;  4AYD A;  5JPM G;  1HCC A;  3ZRZ A;  3GOV A;  2RKY A;  2B5I D;  1OK1 A;  2ERJ A;  3ZD1 A;  1MD7 A;  1GHQ B;  3ZD2 A;  2JGX A;  1LY2 A;  2RLQ A;  2RLP A;  2JGW A;  2KMS A;  1GKG A;  1ZJK A;  1HFI A;  1QGB A;  1G4F A;  1TPG A;  4AYI A;  3CAL A;  3IX0 A;  2YBY A;  2O39 C;  1VVD A;  2XRB A;  3KXV A;  5HZP B;  3NFP I;  2XRD A;  5HYT B;  4A5W B;  1QUB A;  4YNX A;  2LOJ A;  2W81 A;  1TPN A;  4KKD A;  4AYM A;  1OK3 A;  4C16 A;  2WII C;  3IU3 I;  2IZ3 A;  1OJW A;  2XWB F;  4LOT A;  3OP8 A;  2YRA A;  2CG6 A;  2EHF A;  1G4G A;  1H04 P;  2JRA A;  5I0Q B;  2EC3 A;  2KRI A;  4IGD A;  1H03 P;  3EJH A;  1E88 A;  4CSY A;  1NWV A; 
#chains in the Genus database with same CATH topology
 4NBB A;  4DJZ A;  2G7I A;  3CCR 1;  4RV9 A;  4MXU A;  1KC8 1;  3F6K A;  1YJN 1;  3I4M I;  1L1O C;  3GTQ I;  4E2Y A;  4E2X A;  1K83 I;  1VQ5 1;  3HOZ I;  4Y52 I;  2OZK A;  3S16 I;  1I6H I;  4EWC A;  4QTU A;  2JNY A;  3F3F C;  1RO2 A;  3GTM I;  5FLX f;  2Y0S A;  3R62 A;  1Q81 1;  2UWN A;  1WW9 A;  3KZJ A;  2OTJ 1;  1S7M A;  1Z92 B;  2GTI A;  3JAM b;  3VMH A;  1SS2 A;  3MZK B;  4NB8 A;  4JHS A;  1TWC I;  4MUC A;  2P3Y A;  4WJG 2;  4MON A;  1OJY A;  4ZH1 D;  2E2I I;  1C1Z A;  3L89 M;  3I55 1;  2QKD A;  1NUI A;  1Q86 2;  3JAM f;  2F4O A;  1CKL A;  1FBR A;  1VQN 1;  1OK2 A;  1PPQ A;  1VQ8 1;  3ERB A;  1WZN A;  2QRD B;  4FXG G;  4BBR I;  2AKL A;  2PK7 A;  3D2L A;  3CME 1;  2OTJ Z;  1Y8C A;  1WJ2 A;  3GOV A;  3CCQ Z;  3I55 Z;  3CCS Z;  2RKY A;  1QVG Y;  3J80 b;  3OW2 Z;  1OK1 A;  4QTT A;  2AYD A;  3GTO I;  2NVT I;  4NB9 A;  1VLA A;  1VQM Z;  1SFO I;  2LFU A;  5FLX b;  1YIT 1;  2KMS A;  4BY7 I;  1JJ2 Y;  3TE5 B;  4N7E A;  1Q7Y 1;  3CME Z;  3IFU A;  1I50 I;  1QGB A;  1G4F A;  4E2Z A;  3IR7 A;  1YJW Z;  2YBY A;  3KXV A;  2XRB A;  5HZP B;  2NVX I;  3D6W A;  2QEX Z;  3MON A;  1K73 2;  1SIW A;  3ZLE A;  1QUB A;  4S1T A;  4A3I I;  2X2Z A;  3PO2 I;  1Y1V S;  4CL1 A;  2NAP A;  1VQ4 1;  2QRE B;  3CCE 1;  1KC8 2;  1P9N A;  2WII C;  2BJO A;  3IU3 I;  1YI2 Z;  1KD1 2;  1OJW A;  2HU9 A;  3G6E Z;  3K3T A;  3OP8 A;  1WCM I;  3CXC Y;  2OOY B;  4NBF A;  4A3C I;  3U50 C;  1QVF Z;  4MSL A;  1W2B Z;  5I0Q B;  1YI2 1;  1Q82 2;  1VQ7 1;  2EC3 A;  2KRI A;  3NJA A;  5T64 A;  5A2Q b;  2R93 I;  3VB9 A;  4MH4 A;  1KQS Y;  3K7A I;  1N8R 1;  3CCM Z;  3S17 I;  1LQL A;  4PZ5 A;  1K8A 1;  2OTL 1;  1RLH A;  3MQL A;  2O53 A;  4E32 A;  1QF8 A;  2EGT A;  2W04 A;  3OXU D;  3CC4 Z;  2JA6 I;  4HGY A;  1E5G A;  3PO3 I;  1Q3X A;  2OOX B;  1TWF I;  1M90 1;  5D1O A;  3VTN A;  3RJ3 D;  4F4O C;  3FKI I;  5LL6 f;  3QWU A;  2JA5 I;  3FQQ A;  5FO8 C;  2IV2 X;  1TWA I;  1KQS Z;  1GKN A;  1VQN Z;  2I2L A;  5IP7 I;  2RL0 A;  1JWH C;  5C3E I;  1MD8 A;  5IT9 f;  4XX2 A;  3HOV I;  1VQ9 Z;  3TVJ A;  4MD9 A;  1H2P P;  2R7Z I;  1VQP 1;  3NH8 A;  1Q7Y 2;  2JR6 A;  3S2H I;  1VQ6 1;  4RS4 A;  2CKU A;  1OJV A;  3O8E B;  3CMA 1;  1ZB8 A;  2E2J I;  5A2Q f;  2ZYC A;  5C44 I;  4MRI A;  1TFI A;  1USP A;  1QVF Y;  5JPM G;  4NH1 C;  2B5I D;  3WSY A;  4A3J I;  4BBS I;  2ERJ A;  3G4S Z;  3I07 A;  1DL6 A;  3H0G I;  4NBA A;  2GU2 A;  2RLP A;  1Z01 A;  2JGW A;  1GKG A;  3CCU 1;  1Q86 1;  3FGT A;  1QYP A;  1JJ2 Z;  2P28 A;  1HFI A;  2JUB A;  2JMO A;  2KPI A;  3CAL A;  3IX0 A;  2VPY A;  2XRD A;  2JIP A;  1Z03 A;  4E30 A;  1TWH I;  4RVD A;  2PM9 A;  2QA4 1;  3RZO I;  3CQZ I;  2QA4 Z;  3CCV Z;  4NBD A;  4A3F I;  2LIY A;  4KKD A;  4E31 A;  4A3B I;  4AYM A;  1PFT A;  2RT9 A;  2Y8R A;  2IZ3 A;  2M6N A;  2WAQ A;  2XWB F;  3CD6 1;  4HH4 A;  5CM2 M;  1RO0 A;  4BWC A;  3CCU Z;  3M3Y I;  4A3M I;  2JRA A;  1KRL A;  4BY1 I;  4IGD A;  3EJH A;  1W2B Y;  2VPZ A;  1E88 A;  3CCJ Z;  3EER A;  3S1M I;  3CC2 1;  3HOW I;  1K8A 2;  5HYP A;  1O9A A;  3NFZ A;  4J38 B;  2XQW C;  2E9H A;  2K3R A;  2QY0 A;  2V8K A;  4NOZ A;  3S15 I;  3GTL I;  3M7P A;  3T4N B;  3S2D I;  2BZM A;  2YAD A;  3I56 1;  3CMA Z;  3SW0 X;  4B2S A;  3GTK I;  5IP9 I;  2MCZ A;  3HOU I;  3NH5 A;  3WSX A;  1HFH A;  1VQP Z;  2J6A A;  1VQM 1;  1ML8 A;  2F4M A;  1N2F A;  3CCJ 1;  1M1K 2;  4A3G I;  4ONT D;  2JIQ A;  1VQ7 Z;  3CCQ 1;  3CCS 1;  2PMZ A;  3FGR A;  2V3V A;  5FLM I;  2R92 I;  1FDI A;  2MCY A;  1E8B A;  1YHQ 1;  5T67 A;  1YHQ Z;  5HYU B;  1X3W A;  4LOS A;  1QO6 A;  3G6E 1;  2GTH A;  3KIH A;  1YJ9 1;  1I3Q I;  3GKQ A;  1YJN Z;  1NJI 2;  2E2H I;  1FDO A;  3CCE Z;  4K12 A;  3P5J B;  3CC7 1;  5D1P A;  3CC7 Z;  1Q16 A;  1VQK 1;  1M90 2;  4RVF A;  2NVQ I;  1TPM A;  1S72 1;  3GTM S;  2IZ4 A;  4AYE A;  2RKZ A;  5AN9 F;  2VUG A;  1U5M A;  2JIM A;  3GCF A;  4A3E I;  3OW2 Y;  2OTL Z;  3VMG A;  1AA6 A;  1GPZ A;  2LEX A;  1WII A;  4NFR A;  1Y1V I;  2O4H A;  1R9T I;  2HF1 A;  5IT9 b;  1MD7 A;  3M4O I;  1X3Z A;  1K9M 2;  3VMI A;  1LY2 A;  2JS4 A;  2Q4Z A;  2VUM I;  4A3K I;  3S1N I;  3J81 f;  1M1K 1;  4NBG A;  4NBC A;  1Q81 2;  2DE6 A;  3I4N I;  4BXX I;  3NFP I;  1NP6 A;  1K73 1;  3HOY I;  3G71 1;  2LOJ A;  2VPW A;  3CCM 1;  1X0T A;  2KI7 B;  1RNI A;  2W81 A;  5DN4 A;  2QLV B;  1NJI 1;  1OK3 A;  1VQ5 Z;  4C16 A;  2Q51 A;  3I56 Z;  1YUK A;  3BG0 B;  3LUS A;  4LOT A;  2G2K A;  1RQF A;  4A3D I;  1RLY A;  3ESW A;  2YRA A;  4APL A;  2NVY I;  3CCL 1;  2CG6 A;  3CD6 Z;  2JIO A;  3BG1 B;  1YIT Z;  1Q82 1;  3CC2 Z;  4HGZ A;  3EED A;  2R6M A;  1NWV A;  2E7Z A;  2VF1 A;  1QXF A;  3CXC Z;  4YIZ A;  3G71 Z;  3D9X A;  3HOX I;  3J7A 4;  1VQ8 Z;  3J81 b;  2JIR A;  2CG7 A;  1QVG Z;  1S72 Z;  1VQ6 Z;  2V45 A;  3Q87 A;  1VQK Z;  2YU9 I;  2WB1 A;  1VQO 1;  3CI0 J;  1Z02 A;  2H85 A;  2ZAE B;  3MZL B;  2W80 A;  1YJ9 Z;  1VQO Z;  4PO7 A;  5D1O B;  1TWG I;  3GXE A;  4MD8 A;  4AYB A;  3ZLD A;  2V8I A;  3OED C;  2DE5 A;  1SRZ A;  3GTP I;  2W03 A;  1ELV A;  1VQ4 Z;  4RVH A;  2QRC B;  3G4S 1;  4A3L I;  1K9M 1;  1H2Q P;  1USP B;  1VVC A;  3CCV 1;  2V8J A;  3S14 I;  1RO4 A;  2K5R A;  1Y1W I;  3CC4 1;  2RHB A;  4B2R A;  5C4J I;  1UOT P;  2Y8T A;  2V8E A;  4DK1 A;  1ZH1 A;  3NDI A;  1YIJ 1;  2A55 A;  2XWJ I;  1VQL 1;  3T5O A;  3GTJ I;  2JA8 I;  1OK9 A;  4AYD A;  3NDJ A;  4E2W A;  1HCC A;  3ZRZ A;  3CCR Z;  1VQ9 1;  3ZD1 A;  2RPR A;  1GHQ B;  5DN5 A;  3ZD2 A;  2JGX A;  4MD7 A;  5T6B A;  4NBH A;  2RLQ A;  2QR1 B;  1ZB9 A;  1KD1 1;  3FQM A;  1ZJK A;  3S1R I;  3CCL Z;  1YUA A;  1TPG A;  3RZD I;  2RIQ A;  4AYI A;  3S1Q I;  3J80 f;  1VQL Z;  2DE7 A;  2O39 C;  1VVD A;  3CPW Z;  3IF8 A;  2VPX A;  1YIJ Z;  3NH4 A;  2JA7 I;  4TNU A;  5HYT B;  4A5W B;  4X6A I;  4RVG A;  4YNX A;  4DQY B;  1N8R 2;  3GTG I;  2I3C A;  1TPN A;  3TDH B;  5C4X I;  4NBE A;  3CPW Y;  2QEX 1;  3PO3 S;  3KIF A;  2Y8S A;  3VWO A;  1YJW 1;  3H3V J;  4A93 I;  2M48 A;  2RBL A;  2EHF A;  1G4G A;  1H04 P;  4Y7N I;  3HKZ A;  2B63 I;  1H03 P;  3F3P C;  4CSY A;  4DGL A;  4E33 A;  3INB C; 
#chains in the Genus database with same CATH homology
 4NBB A;  4DJZ A;  2G7I A;  3CCR 1;  4RV9 A;  4MXU A;  1KC8 1;  1YJN 1;  3I4M I;  1L1O C;  3GTQ I;  4E2Y A;  4E2X A;  1K83 I;  1VQ5 1;  3HOZ I;  4Y52 I;  2OZK A;  3S16 I;  1I6H I;  4EWC A;  4QTU A;  2JNY A;  3F3F C;  1RO2 A;  3GTM I;  5FLX f;  2Y0S A;  3R62 A;  1Q81 1;  2UWN A;  1WW9 A;  3KZJ A;  2OTJ 1;  1S7M A;  1Z92 B;  2GTI A;  3JAM b;  3VMH A;  1SS2 A;  3MZK B;  4NB8 A;  4JHS A;  1TWC I;  4MUC A;  2P3Y A;  4WJG 2;  4MON A;  1OJY A;  4ZH1 D;  2E2I I;  1C1Z A;  3L89 M;  3I55 1;  2QKD A;  1NUI A;  1Q86 2;  3JAM f;  2F4O A;  1CKL A;  1FBR A;  1VQN 1;  1OK2 A;  1PPQ A;  1VQ8 1;  3ERB A;  2QRD B;  4FXG G;  4BBR I;  2AKL A;  2PK7 A;  3CME 1;  2OTJ Z;  3GOV A;  3CCQ Z;  3I55 Z;  3CCS Z;  2RKY A;  1QVG Y;  3J80 b;  3OW2 Z;  1OK1 A;  4QTT A;  3GTO I;  2NVT I;  4NB9 A;  1VLA A;  1VQM Z;  1SFO I;  2LFU A;  5FLX b;  1YIT 1;  2KMS A;  4BY7 I;  1JJ2 Y;  3TE5 B;  1Q7Y 1;  3CME Z;  3IFU A;  1I50 I;  1QGB A;  1G4F A;  4E2Z A;  1YJW Z;  2YBY A;  3KXV A;  2XRB A;  5HZP B;  2NVX I;  3D6W A;  2QEX Z;  3MON A;  1K73 2;  1QUB A;  4S1T A;  4A3I I;  3PO2 I;  1Y1V S;  4CL1 A;  1VQ4 1;  2QRE B;  3CCE 1;  1KC8 2;  1P9N A;  2WII C;  2BJO A;  3IU3 I;  1YI2 Z;  1KD1 2;  1OJW A;  2HU9 A;  3G6E Z;  3OP8 A;  1WCM I;  3CXC Y;  2OOY B;  4NBF A;  4A3C I;  3U50 C;  1QVF Z;  1W2B Z;  5I0Q B;  1YI2 1;  1Q82 2;  1VQ7 1;  2EC3 A;  2KRI A;  5T64 A;  5A2Q b;  2R93 I;  3VB9 A;  4MH4 A;  1KQS Y;  3K7A I;  1N8R 1;  3CCM Z;  3S17 I;  1LQL A;  4PZ5 A;  1K8A 1;  2OTL 1;  3MQL A;  2O53 A;  4E32 A;  1QF8 A;  2EGT A;  2W04 A;  3OXU D;  3CC4 Z;  2JA6 I;  4HGY A;  1E5G A;  3PO3 I;  1Q3X A;  2OOX B;  1TWF I;  1M90 1;  5D1O A;  3VTN A;  3RJ3 D;  4F4O C;  3FKI I;  5LL6 f;  3QWU A;  2JA5 I;  3FQQ A;  5FO8 C;  1TWA I;  1KQS Z;  1GKN A;  1VQN Z;  5IP7 I;  2RL0 A;  1JWH C;  5C3E I;  1MD8 A;  5IT9 f;  4XX2 A;  3HOV I;  1VQ9 Z;  3TVJ A;  4MD9 A;  1H2P P;  2R7Z I;  1VQP 1;  3NH8 A;  1Q7Y 2;  2JR6 A;  3S2H I;  1VQ6 1;  4RS4 A;  2CKU A;  1OJV A;  3O8E B;  3CMA 1;  1ZB8 A;  2E2J I;  5A2Q f;  5C44 I;  4MRI A;  1TFI A;  1USP A;  1QVF Y;  5JPM G;  4NH1 C;  2B5I D;  4A3J I;  4BBS I;  2ERJ A;  3G4S Z;  3I07 A;  1DL6 A;  3H0G I;  4NBA A;  2GU2 A;  2RLP A;  1Z01 A;  2JGW A;  1GKG A;  3CCU 1;  1Q86 1;  1JJ2 Z;  1QYP A;  2P28 A;  1HFI A;  2JUB A;  2JMO A;  2KPI A;  3CAL A;  3IX0 A;  2XRD A;  1Z03 A;  4E30 A;  1TWH I;  4RVD A;  2PM9 A;  2QA4 1;  3RZO I;  3CQZ I;  2QA4 Z;  3CCV Z;  4NBD A;  4A3F I;  2LIY A;  4KKD A;  4E31 A;  4A3B I;  4AYM A;  1PFT A;  2RT9 A;  2IZ3 A;  2M6N A;  2WAQ A;  2XWB F;  3CD6 1;  4HH4 A;  5CM2 M;  1RO0 A;  3CCU Z;  3M3Y I;  4A3M I;  2JRA A;  1KRL A;  4BY1 I;  4IGD A;  3EJH A;  1W2B Y;  1E88 A;  3CCJ Z;  3EER A;  3S1M I;  3CC2 1;  3HOW I;  1K8A 2;  5HYP A;  1O9A A;  3NFZ A;  4J38 B;  2XQW C;  2E9H A;  2K3R A;  2QY0 A;  2V8K A;  4NOZ A;  3S15 I;  3GTL I;  3M7P A;  3T4N B;  3S2D I;  2BZM A;  2YAD A;  3I56 1;  3CMA Z;  3SW0 X;  4B2S A;  3GTK I;  5IP9 I;  2MCZ A;  3HOU I;  3NH5 A;  1HFH A;  1VQP Z;  2J6A A;  1VQM 1;  1ML8 A;  2F4M A;  1N2F A;  3CCJ 1;  1M1K 2;  4A3G I;  4ONT D;  1VQ7 Z;  3CCQ 1;  3CCS 1;  2PMZ A;  5FLM I;  2R92 I;  2MCY A;  1E8B A;  1YHQ 1;  5T67 A;  1YHQ Z;  5HYU B;  1X3W A;  4LOS A;  1QO6 A;  3G6E 1;  2GTH A;  3KIH A;  1YJ9 1;  1I3Q I;  3GKQ A;  1YJN Z;  1NJI 2;  2E2H I;  3CCE Z;  4K12 A;  3P5J B;  3CC7 1;  5D1P A;  3CC7 Z;  1VQK 1;  1M90 2;  4RVF A;  2NVQ I;  1TPM A;  1S72 1;  3GTM S;  2IZ4 A;  4AYE A;  2RKZ A;  5AN9 F;  2VUG A;  1U5M A;  3GCF A;  4A3E I;  3OW2 Y;  2OTL Z;  3VMG A;  1GPZ A;  1WII A;  4NFR A;  1Y1V I;  2O4H A;  1R9T I;  2HF1 A;  5IT9 b;  1MD7 A;  3M4O I;  1X3Z A;  1K9M 2;  3VMI A;  1LY2 A;  2JS4 A;  2Q4Z A;  2VUM I;  4A3K I;  3S1N I;  3J81 f;  1M1K 1;  4NBG A;  4NBC A;  1Q81 2;  2DE6 A;  3I4N I;  4BXX I;  3NFP I;  1NP6 A;  1K73 1;  3HOY I;  3G71 1;  2LOJ A;  3CCM 1;  1X0T A;  2KI7 B;  1RNI A;  2W81 A;  2QLV B;  1NJI 1;  1OK3 A;  1VQ5 Z;  4C16 A;  2Q51 A;  3I56 Z;  1YUK A;  3BG0 B;  4LOT A;  3LUS A;  2G2K A;  1RQF A;  4A3D I;  1RLY A;  3ESW A;  2YRA A;  2NVY I;  3CCL 1;  2CG6 A;  3CD6 Z;  3BG1 B;  1YIT Z;  1Q82 1;  3CC2 Z;  4HGZ A;  3EED A;  2R6M A;  1NWV A;  2VF1 A;  3CXC Z;  3G71 Z;  3D9X A;  3HOX I;  3J7A 4;  1VQ8 Z;  3J81 b;  2CG7 A;  1QVG Z;  1S72 Z;  1VQ6 Z;  3Q87 A;  1VQK Z;  2YU9 I;  2WB1 A;  1VQO 1;  1Z02 A;  2H85 A;  2ZAE B;  3MZL B;  2W80 A;  1YJ9 Z;  1VQO Z;  5D1O B;  1TWG I;  3GXE A;  4MD8 A;  4AYB A;  2V8I A;  3OED C;  2DE5 A;  1SRZ A;  3GTP I;  2W03 A;  1ELV A;  1VQ4 Z;  4RVH A;  2QRC B;  3G4S 1;  4A3L I;  1K9M 1;  1H2Q P;  1USP B;  1VVC A;  3CCV 1;  2V8J A;  3S14 I;  1RO4 A;  2K5R A;  1Y1W I;  3CC4 1;  2RHB A;  4B2R A;  5C4J I;  1UOT P;  1YIJ 1;  2V8E A;  4DK1 A;  1ZH1 A;  3NDI A;  2A55 A;  2XWJ I;  1VQL 1;  3T5O A;  3GTJ I;  2JA8 I;  1OK9 A;  4AYD A;  3NDJ A;  4E2W A;  1HCC A;  3ZRZ A;  3CCR Z;  1VQ9 1;  3ZD1 A;  2RPR A;  1GHQ B;  3ZD2 A;  2JGX A;  4MD7 A;  5T6B A;  4NBH A;  2RLQ A;  2QR1 B;  1ZB9 A;  1KD1 1;  3FQM A;  1ZJK A;  3S1R I;  3CCL Z;  1YUA A;  1TPG A;  3RZD I;  2RIQ A;  4AYI A;  3S1Q I;  3J80 f;  1VQL Z;  2DE7 A;  2O39 C;  1VVD A;  3CPW Z;  3IF8 A;  1YIJ Z;  3NH4 A;  2JA7 I;  4TNU A;  5HYT B;  4A5W B;  4X6A I;  4RVG A;  4YNX A;  4DQY B;  1N8R 2;  3GTG I;  2I3C A;  1TPN A;  3TDH B;  5C4X I;  4NBE A;  3CPW Y;  2QEX 1;  3PO3 S;  3KIF A;  1YJW 1;  3H3V J;  4A93 I;  2M48 A;  2RBL A;  2EHF A;  1G4G A;  1H04 P;  4Y7N I;  3HKZ A;  2B63 I;  1H03 P;  3F3P C;  4CSY A;  4DGL A;  4E33 A;  3INB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...