2IZ4A

Solution structure of porcine beta-microseminoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
molecule tags Inhibitor
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz4A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz4A02
2JRAA 1HFIA 4K12A 1TPGA 2RKYA 3M7PA 3KXVA 3O8EB 2XRBA 1HCCA 1FBRA 4YNXA 4AYEA 4F4OC 3ERBA 1H03P 2IZ4A 2G7IA 2UWNA 4AYMA 1GKNA 3CALA 2V8EA 1H2PP 5HYPA 1C1ZA 2WIIC 1H2QP 2XWJI 5I0QB 2B5ID 2CKUA 4PZ5A 2BZMA 2EC3A 2XQWC 4ZH1D 1SRZA 1ELVA 4FXGG 1GPZA 5FO8C 1GHQB 1OK9A 4DJZA 5HYTB 3IX0A 3MQLA 3GXEA 2CG7A 4CSYA 3EJHA 2W80A 2MCYA 1OK3A 4B2SA 1G4GA 1PPQA 4B2RA 1E5GA 1HFHA 1SS2A 2O39C 3T5OA 3NFPI 1OK1A 1E88A 1OJWA 3OXUD 1CKLA 2YRAA 1VVDA 1G4FA 1Q3XA 1H04P 3TVJA 2RLPA 5JPMG 5HYUB 1U5MA 1OK2A 2JGXA 1QO6A 1TPNA 1VVCA 3OP8A 2JGWA 5HZPB 4ONTD 3ZD1A 3ZRZA 4AYIA 2MCZA 2W81A 4J38B 1QGBA 1UOTP 2XRDA 3GOVA 3OEDC 1GKGA 4LOTA 1MD7A 1QUBA 3RJ3D 1Z92B 1O9AA 2KRIA 3L89M 2CG6A 4IGDA 2RKZA 2QY0A 1OJVA 2EHFA 1NWVA 2KMSA 2LOJA 2XWBF 2A55A 3SW0X 4LOSA 3R62A 2IZ3A 1TPMA 1OJYA 2ERJA 3IU3I 4KKDA 4A5WB 4JHSA 4MUCA 4C16A 4AYDA 1LY2A 1E8BA 3INBC 3KZJA 2RL0A 3ZD2A 2RLQA 2YBYA 1MD8A 1ZJKA 4WJG2
chains in the Genus database with same CATH superfamily
2JRAA 4K12A 2OTL1 1Y8CA 3PO3I 2QEX1 2W04A 5CM2M 3BG0B 4RV9A 1W2BY 3O8EB 1VQ41 3CCEZ 3K7AI 1FBRA 4AYEA 4MD9A 1VQ7Z 3BG1B 4F4OC 3G6E1 1PFTA 2G7IA 1GKNA 4NH1C 3T4NB 1C1ZA 2KPIA 3D6WA 3CCM1 1JJ2Z 2XWJI 2B5ID 4PZ5A 1K9M2 4NBFA 1KQSY 2NVQI 3CCVZ 3HOZI 4BY7I 2ZAEB 1TWHI 2E2JI 2VPYA 3IFUA 3CCE1 1VQ71 5FO8C 2M48A 1GHQB 3OW2Z 2RBLA 4MH4A 3GXEA 1M902 2JA8I 1NP6A 4NB8A 2MCYA 3CCV1 4B2RA 2P3YA 1JWHC 1SS2A 1ZB8A 3T5OA 1E88A 2I3CA 2Y8SA 4BXXI 2YRAA 1VVDA 3CCLZ 1VQPZ 5AN9F 4E2WA 2IV2X 1W2BZ 4RVDA 5HYUB 2EGTA 2JS4A 1QVFY 1OK2A 1RO2A 1TWFI 1YUAA 5T64A 3EEDA 1QO6A 1Q811 4A3CI 4A3JI 2JGWA 5HZPB 4NBBA 1Q7Y2 1KC81 3ZD1A 1QXFA 3VB9A 1LQLA 2QRCB 1ML8A 5T67A 3OEDC 4LOTA 3CCL1 3M3YI 1VQP1 2QA4Z 2KRIA 1Z01A 2RKZA 4A3MI 2QY0A 5T6BA 1TWAI 3HOWI 5LL6f 2IZ3A 1TPMA 1VQLZ 2DE5A 1NJI2 5DN5A 4BWCA 3F3PC 1VQKZ 2VPXA 4XX2A 3VMGA 2H85A 4A3II 1LY2A 4NOZA 4MD7A 1VQMZ 1QYPA 2QA41 2AKLA 1Q862 2RLQA 3CMAZ 2VPZA 1YIJZ 4A3DI 2YBYA 2P28A 1ZJKA 1WIIA 4MONA 1HFIA 1X0TA 1I50I 1QVFZ 1VQL1 1TPGA 1WW9A 1QF8A 2HF1A 3KXVA 3EERA 3NFZA 2WAQA 4YNXA 3OW2Y 1VQK1 5C4JI 3NDJA 3NH4A 1VQM1 2UWNA 2V8EA 4QTTA 2OOYB 1H2PP 2Y0SA 4NBGA 3CMA1 4MRIA 1YIJ1 3U50C 2NVTI 1H2QP 3I55Z 1VQNZ 4Y52I 2BZMA 2XQWC 3CC4Z 2R92I 2QKDA 4E2ZA 1N8R1 3D9XA 3M4OI 3FGTA 3GTGI 2OOXB 3S2DI 3CCJZ 2RT9A 3GKQA 2JUBA 3I4MI 2JIRA 1VLAA 3CC2Z 1K732 3I551 1VQN1 5D1OB 1PPQA 3CC41 1S7MA 1HFHA 2O39C 3NFPI 1OK1A 3Q87A 4BBRI 2ZYCA 1G4FA 2GTIA 3S15I 4E2YA 1S72Z 1U5MA 1KD12 4APLA 3MZKB 3IF8A 4DGLA 3CCJ1 3PO2I 3S14I 3CC21 1Q16A 3J7A4 1TWCI 3GTKI 4MXUA 3HOYI 5C4XI 2KI7B 4N7EA 1KC82 4Y7NI 3NDIA 3CD6Z 2XRDA 3D2LA 1MD7A 1Z03A 2B63I 3RJ3D 3L89M 1S721 4E33A 1USPA 1RLYA 2JIQA 2CG6A 2EHFA 2LOJA 1NWVA 3SW0X 2PK7A 2XWBF 1YHQZ 1I6HI 4DK1A 3H0GI 4HH4A 1WJ2A 1VQ61 2HU9A 4PO7A 2BJOA 4NBHA 5IP7I 3IU3I 1FDIA 2JA6I 3CQZI 3CD61 2NVXI 2OTJZ 3TDHB 3INBC 3KZJA 3S1MI 2RL0A 3VTNA 4A3FI 1YHQ1 1Q822 1RNIA 3QWUA 5FLXb 4DQYB 4WJG2 2DE6A 4RVHA 3CPWY 1USPB 1K8A2 1WZNA 3CCSZ 4NB9A 2Y8TA 3S1NI 2XRBA 1KRLA 5FLXf 1M901 4RVFA 4RS4A 2E2II 3CCQZ 5FLMI 2OTJ1 3VMHA 4AYMA 2VF1A 3FGRA 4MD8A 3TE5B 2F4MA 3GTMS 4MSLA 1SFOI 2E2HI 2JNYA 5I0QB 2F4OA 2CKUA 1M1K2 2EC3A 1YJ9Z 1YJNZ 3ZLDA 2PMZA 3FKII 4S1TA 4ZH1D 2R6MA 1VQ8Z 1SRZA 4AYBA 1ZB9A 3CCS1 2JMOA 4FXGG 1GPZA 1K83I 1Z02A 4NBCA 4NFRA 2E9HA 3IX0A 3P5JB 3CCQ1 1Q7Y1 2YU9I 2CG7A 4NBAA 2V8JA 2JIPA 3EJHA 2W80A 1TWGI 2W03A 4YIZA 2LFUA 3GTOI 3G71Z 1OK3A 4NBEA 1G4GA 1YUKA 5IT9b 2V3VA 1YJ91 1YJN1 3LUSA 1VQ81 2LIYA 1VQ5Z 1FDOA 3J81b 1VQOZ 3CPWZ 4A3KI 3G4SZ 3ZLEA 2RPRA 3TVJA 2RLPA 5IT9f 1NJI1 2Q4ZA 2YADA 4E32A 2QLVB 2JGXA 4E2XA 2JA7I 1VVCA 3G711 1VQ9Z 2E7ZA 4ONTD 2K5RA 1Y1VS 3GTJI 2NVYI 1YI2Z 2W81A 4HGYA 1Q861 4J38B 2V8KA 1VQ51 1VQO1 2QR1B 2Y8RA 3KIFA 1GKGA 1QUBA 3G4S1 1O9AA 5D1PA 2J6AA 2M6NA 1P9NA 2V45A 1OJVA 2KMSA 2A55A 3I07A 2X2ZA 3K3TA 3R62A 1RLHA 1QVGY 2LEXA 1VQ91 2ERJA 2GTHA 5IP9I 1YI21 3RZDI 1VQ6Z 1N2FA 4TNUA 1Q812 4C16A 3CXCY 4AYDA 2DE7A 2NAPA 3GTMI 1E8BA 1L1OC 2AYDA 3I56Z 1WCMI 3IR7A 1MD8A 1SIWA 3GCFA 5A2Qb 2RKYA 4A3BI 3M7PA 3KIHA 1HCCA 4QTUA 1X3WA 3NH8A 1K731 5A2Qf 3ERBA 3MZLB 1H03P 3JAMb 4E31A 2IZ4A 4A3EI 3WSYA 2RHBA 3CALA 3S1QI 2GU2A 3I561 2VUGA 5HYPA 3HOXI 4CL1A 2QREB 3F6KA 1K9M1 2WIIC 2WB1A 3GTPI 1ZH1A 3JAMf 3FQMA 3HKZA 3I4NI 3GTQI 2O53A 1KD11 2O4HA 1RQFA 1YITZ 2VUMI 3VMIA 3PO3S 4NBDA 3S17I 1ELVA 1QVGZ 2RIQA 1DL6A 1OK9A 4DJZA 5HYTB 3VWOA 3MQLA 2QRDB 2JIOA 3CMEZ 3S1RI 3HOUI 4CSYA 3CXCZ 3NJAA 1Y1VI 4HGZA 3RZOI 3S16I 5C44I 4B2SA 3WSXA 5C3EI 1KQSZ 4A3GI 1E5GA 4EWCA 3CC7Z 2JA5I 1YIT1 1OJWA 3OXUD 1I3QI 1CKLA 1X3ZA 4A3LI 3MONA 1Q3XA 1H04P 1TFIA 3S2HI 2JR6A 5JPMG 3CI0J 2JIMA 4X6AI 3CME1 1R9TI 1N8R2 3J80b 1RO0A 1TPNA 3OP8A 3F3FC 3ZRZA 4AYIA 2MCZA 3GTLI 3HOVI 3CC71 1YJWZ 1QGBA 2Q51A 3J80f 1UOTP 3ESWA 3GOVA 3CCRZ 3H3VJ 4A93I 1Q821 1Z92B 1K8A1 1JJ2Y 1NUIA 4RVGA 4IGDA 2K3RA 2OZKA 2VPWA 2V8IA 3CCUZ 1RO4A 2OTLZ 4LOSA 2PM9A 2R93I 3J81f 3NH5A 2QEXZ 4BY1I 1OJYA 4KKDA 2R7ZI 2I2LA 1VQ4Z 1YJW1 4A5WB 4JHSA 4MUCA 3CCR1 5D1OA 1AA6A 2G2KA 3G6EZ 4BBSI 5DN4A 1M1K1 1Y1WI 3ZD2A 4E30A 3CCMZ 3FQQA 3CCU1
chains in the Genus database with same CATH topology
2JRAA 4K12A 2OTL1 3PO3I 2QEX1 2W04A 5CM2M 3BG0B 4RV9A 1W2BY 3O8EB 1VQ41 3CCEZ 3K7AI 1FBRA 4AYEA 4MD9A 1VQ7Z 3BG1B 4F4OC 3G6E1 1PFTA 2G7IA 1GKNA 4NH1C 3T4NB 1C1ZA 2KPIA 3D6WA 3CCM1 1JJ2Z 2XWJI 2B5ID 4PZ5A 1K9M2 4NBFA 1KQSY 2NVQI 3CCVZ 3HOZI 4BY7I 2ZAEB 1TWHI 2E2JI 3IFUA 3CCE1 1VQ71 5FO8C 2M48A 1GHQB 3OW2Z 2RBLA 4MH4A 3GXEA 1M902 2JA8I 1NP6A 4NB8A 2MCYA 3CCV1 4B2RA 2P3YA 1JWHC 1SS2A 1ZB8A 3T5OA 1E88A 2I3CA 4BXXI 2YRAA 1VVDA 3CCLZ 1VQPZ 5AN9F 4E2WA 1W2BZ 4RVDA 5HYUB 2EGTA 2JS4A 1QVFY 1OK2A 1RO2A 1TWFI 1YUAA 5T64A 3EEDA 1QO6A 1Q811 4A3CI 4A3JI 2JGWA 5HZPB 4NBBA 1Q7Y2 1KC81 3ZD1A 3VB9A 1LQLA 2QRCB 1ML8A 5T67A 3OEDC 4LOTA 3CCL1 3M3YI 1VQP1 2QA4Z 2KRIA 1Z01A 2RKZA 4A3MI 2QY0A 5T6BA 1TWAI 3HOWI 5LL6f 2IZ3A 1TPMA 1VQLZ 2DE5A 1NJI2 3F3PC 1VQKZ 4XX2A 3VMGA 2H85A 4A3II 1LY2A 4NOZA 4MD7A 1VQMZ 1QYPA 2QA41 2AKLA 1Q862 2RLQA 3CMAZ 1YIJZ 4A3DI 2YBYA 2P28A 1ZJKA 1WIIA 4MONA 1HFIA 1X0TA 1I50I 1QVFZ 1VQL1 1TPGA 1WW9A 1QF8A 2HF1A 3KXVA 3EERA 3NFZA 2WAQA 4YNXA 3OW2Y 1VQK1 5C4JI 3NDJA 3NH4A 1VQM1 2UWNA 2V8EA 4QTTA 2OOYB 1H2PP 2Y0SA 4NBGA 3CMA1 4MRIA 1YIJ1 3U50C 2NVTI 1H2QP 3I55Z 1VQNZ 4Y52I 2BZMA 2XQWC 3CC4Z 2R92I 2QKDA 4E2ZA 1N8R1 3D9XA 3M4OI 3GTGI 2OOXB 3S2DI 3CCJZ 2RT9A 3GKQA 2JUBA 3I4MI 1VLAA 3CC2Z 1K732 3I551 1VQN1 5D1OB 1PPQA 3CC41 1S7MA 1HFHA 2O39C 3NFPI 1OK1A 3Q87A 4BBRI 1G4FA 2GTIA 3S15I 4E2YA 1S72Z 1U5MA 1KD12 3MZKB 3IF8A 4DGLA 3CCJ1 3PO2I 3S14I 3CC21 3J7A4 1TWCI 3GTKI 4MXUA 3HOYI 5C4XI 2KI7B 1KC82 4Y7NI 3NDIA 3CD6Z 2XRDA 1MD7A 1Z03A 2B63I 3RJ3D 3L89M 1S721 4E33A 1USPA 1RLYA 2CG6A 2EHFA 2LOJA 1NWVA 3SW0X 2PK7A 2XWBF 1YHQZ 1I6HI 4DK1A 3H0GI 4HH4A 1VQ61 2HU9A 2BJOA 4NBHA 5IP7I 3IU3I 2JA6I 3CQZI 3CD61 2NVXI 2OTJZ 3TDHB 3INBC 3KZJA 3S1MI 2RL0A 3VTNA 4A3FI 1YHQ1 1Q822 1RNIA 3QWUA 5FLXb 4DQYB 4WJG2 2DE6A 4RVHA 3CPWY 1USPB 1K8A2 3CCSZ 4NB9A 3S1NI 2XRBA 1KRLA 5FLXf 1M901 4RVFA 4RS4A 2E2II 3CCQZ 5FLMI 2OTJ1 3VMHA 4AYMA 2VF1A 4MD8A 3TE5B 2F4MA 3GTMS 1SFOI 2E2HI 2JNYA 5I0QB 2F4OA 2CKUA 1M1K2 2EC3A 1YJ9Z 1YJNZ 2PMZA 3FKII 4S1TA 4ZH1D 2R6MA 1VQ8Z 1SRZA 4AYBA 1ZB9A 3CCS1 2JMOA 4FXGG 1GPZA 1K83I 1Z02A 4NBCA 4NFRA 2E9HA 3IX0A 3P5JB 3CCQ1 1Q7Y1 2YU9I 2CG7A 4NBAA 2V8JA 3EJHA 2W80A 1TWGI 2W03A 2LFUA 3GTOI 3G71Z 1OK3A 4NBEA 1G4GA 1YUKA 5IT9b 1YJ91 1YJN1 3LUSA 1VQ81 2LIYA 1VQ5Z 3J81b 1VQOZ 3CPWZ 4A3KI 3G4SZ 2RPRA 3TVJA 2RLPA 5IT9f 1NJI1 2Q4ZA 2YADA 4E32A 2QLVB 2JGXA 4E2XA 2JA7I 1VVCA 3G711 1VQ9Z 4ONTD 2K5RA 1Y1VS 3GTJI 2NVYI 1YI2Z 2W81A 4HGYA 1Q861 4J38B 2V8KA 1VQ51 1VQO1 2QR1B 3KIFA 1GKGA 1QUBA 3G4S1 1O9AA 5D1PA 2J6AA 2M6NA 1P9NA 1OJVA 2KMSA 2A55A 3I07A 3R62A 1QVGY 1VQ91 2ERJA 2GTHA 5IP9I 1YI21 3RZDI 1VQ6Z 1N2FA 4TNUA 1Q812 4C16A 3CXCY 4AYDA 2DE7A 3GTMI 1E8BA 1L1OC 3I56Z 1WCMI 1MD8A 3GCFA 5A2Qb 2RKYA 4A3BI 3M7PA 3KIHA 1HCCA 4QTUA 1X3WA 3NH8A 1K731 5A2Qf 3ERBA 3MZLB 1H03P 3JAMb 4E31A 2IZ4A 4A3EI 2RHBA 3CALA 3S1QI 2GU2A 3I561 2VUGA 5HYPA 3HOXI 4CL1A 2QREB 1K9M1 2WIIC 2WB1A 3GTPI 1ZH1A 3JAMf 3FQMA 3HKZA 3I4NI 3GTQI 2O53A 1KD11 2O4HA 1RQFA 1YITZ 2VUMI 3VMIA 3PO3S 4NBDA 3S17I 1ELVA 1QVGZ 2RIQA 1DL6A 1OK9A 4DJZA 5HYTB 3MQLA 2QRDB 3CMEZ 3S1RI 3HOUI 4CSYA 3CXCZ 4HGZA 1Y1VI 3RZOI 3S16I 5C44I 4B2SA 5C3EI 1KQSZ 4A3GI 1E5GA 4EWCA 3CC7Z 2JA5I 1YIT1 1OJWA 3OXUD 1I3QI 1CKLA 1X3ZA 4A3LI 3MONA 1Q3XA 1H04P 1TFIA 3S2HI 2JR6A 5JPMG 4X6AI 3CME1 1R9TI 1N8R2 3J80b 1RO0A 1TPNA 3OP8A 3F3FC 3ZRZA 4AYIA 2MCZA 3GTLI 3HOVI 3CC71 1YJWZ 1QGBA 2Q51A 3J80f 1UOTP 3ESWA 3GOVA 3CCRZ 3H3VJ 4A93I 1Q821 1Z92B 1K8A1 1JJ2Y 1NUIA 4RVGA 4IGDA 2K3RA 2OZKA 2V8IA 3CCUZ 1RO4A 2OTLZ 4LOSA 2PM9A 2R93I 3J81f 3NH5A 2QEXZ 4BY1I 1OJYA 4KKDA 2R7ZI 1VQ4Z 1YJW1 4A5WB 4JHSA 4MUCA 3CCR1 5D1OA 2G2KA 3G6EZ 4BBSI 1M1K1 1Y1WI 3ZD2A 4E30A 3CCMZ 3FQQA 3CCU1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRA A;  1HFI A;  4K12 A;  1TPG A;  2RKY A;  3M7P A;  3KXV A;  3O8E B;  2XRB A;  1HCC A;  1FBR A;  4YNX A;  4AYE A;  4F4O C;  3ERB A;  1H03 P;  2IZ4 A;  2G7I A;  2UWN A;  4AYM A;  1GKN A;  3CAL A;  2V8E A;  1H2P P;  5HYP A;  1C1Z A;  2WII C;  1H2Q P;  2XWJ I;  5I0Q B;  2B5I D;  2CKU A;  4PZ5 A;  2BZM A;  2EC3 A;  2XQW C;  4ZH1 D;  1SRZ A;  1ELV A;  4FXG G;  1GPZ A;  5FO8 C;  1GHQ B;  1OK9 A;  4DJZ A;  5HYT B;  3IX0 A;  3MQL A;  3GXE A;  2CG7 A;  4CSY A;  3EJH A;  2W80 A;  2MCY A;  1OK3 A;  4B2S A;  1G4G A;  1PPQ A;  4B2R A;  1E5G A;  1HFH A;  1SS2 A;  2O39 C;  3T5O A;  3NFP I;  1OK1 A;  1E88 A;  1OJW A;  3OXU D;  1CKL A;  2YRA A;  1VVD A;  1G4F A;  1Q3X A;  1H04 P;  3TVJ A;  2RLP A;  5JPM G;  5HYU B;  1U5M A;  1OK2 A;  2JGX A;  1QO6 A;  1TPN A;  1VVC A;  3OP8 A;  2JGW A;  5HZP B;  4ONT D;  3ZD1 A;  3ZRZ A;  4AYI A;  2MCZ A;  2W81 A;  4J38 B;  1QGB A;  1UOT P;  2XRD A;  3GOV A;  3OED C;  1GKG A;  4LOT A;  1MD7 A;  1QUB A;  3RJ3 D;  1Z92 B;  1O9A A;  2KRI A;  3L89 M;  2CG6 A;  4IGD A;  2RKZ A;  2QY0 A;  1OJV A;  2EHF A;  1NWV A;  2KMS A;  2LOJ A;  2XWB F;  2A55 A;  3SW0 X;  4LOS A;  3R62 A;  2IZ3 A;  1TPM A;  1OJY A;  2ERJ A;  3IU3 I;  4KKD A;  4A5W B;  4JHS A;  4MUC A;  4C16 A;  4AYD A;  1LY2 A;  1E8B A;  3INB C;  3KZJ A;  2RL0 A;  3ZD2 A;  2RLQ A;  2YBY A;  1MD8 A;  1ZJK A;  4WJG 2; 
#chains in the Genus database with same CATH topology
 2JRA A;  4K12 A;  2OTL 1;  1Y8C A;  3PO3 I;  2QEX 1;  2W04 A;  5CM2 M;  3BG0 B;  4RV9 A;  1W2B Y;  3O8E B;  1VQ4 1;  3CCE Z;  3K7A I;  1FBR A;  4AYE A;  4MD9 A;  1VQ7 Z;  3BG1 B;  4F4O C;  3G6E 1;  1PFT A;  2G7I A;  1GKN A;  4NH1 C;  3T4N B;  1C1Z A;  2KPI A;  3D6W A;  3CCM 1;  1JJ2 Z;  2XWJ I;  2B5I D;  4PZ5 A;  1K9M 2;  4NBF A;  1KQS Y;  2NVQ I;  3CCV Z;  3HOZ I;  4BY7 I;  2ZAE B;  1TWH I;  2E2J I;  2VPY A;  3IFU A;  3CCE 1;  1VQ7 1;  5FO8 C;  2M48 A;  1GHQ B;  3OW2 Z;  2RBL A;  4MH4 A;  3GXE A;  1M90 2;  2JA8 I;  1NP6 A;  4NB8 A;  2MCY A;  3CCV 1;  4B2R A;  2P3Y A;  1JWH C;  1SS2 A;  1ZB8 A;  3T5O A;  1E88 A;  2I3C A;  2Y8S A;  4BXX I;  2YRA A;  1VVD A;  3CCL Z;  1VQP Z;  5AN9 F;  4E2W A;  2IV2 X;  1W2B Z;  4RVD A;  5HYU B;  2EGT A;  2JS4 A;  1QVF Y;  1OK2 A;  1RO2 A;  1TWF I;  1YUA A;  5T64 A;  3EED A;  1QO6 A;  1Q81 1;  4A3C I;  4A3J I;  2JGW A;  5HZP B;  4NBB A;  1Q7Y 2;  1KC8 1;  3ZD1 A;  1QXF A;  3VB9 A;  1LQL A;  2QRC B;  1ML8 A;  5T67 A;  3OED C;  4LOT A;  3CCL 1;  3M3Y I;  1VQP 1;  2QA4 Z;  2KRI A;  1Z01 A;  2RKZ A;  4A3M I;  2QY0 A;  5T6B A;  1TWA I;  3HOW I;  5LL6 f;  2IZ3 A;  1TPM A;  1VQL Z;  2DE5 A;  1NJI 2;  5DN5 A;  4BWC A;  3F3P C;  1VQK Z;  2VPX A;  4XX2 A;  3VMG A;  2H85 A;  4A3I I;  1LY2 A;  4NOZ A;  4MD7 A;  1VQM Z;  1QYP A;  2QA4 1;  2AKL A;  1Q86 2;  2RLQ A;  3CMA Z;  2VPZ A;  1YIJ Z;  4A3D I;  2YBY A;  2P28 A;  1ZJK A;  1WII A;  4MON A;  1HFI A;  1X0T A;  1I50 I;  1QVF Z;  1VQL 1;  1TPG A;  1WW9 A;  1QF8 A;  2HF1 A;  3KXV A;  3EER A;  3NFZ A;  2WAQ A;  4YNX A;  3OW2 Y;  1VQK 1;  5C4J I;  3NDJ A;  3NH4 A;  1VQM 1;  2UWN A;  2V8E A;  4QTT A;  2OOY B;  1H2P P;  2Y0S A;  4NBG A;  3CMA 1;  4MRI A;  1YIJ 1;  3U50 C;  2NVT I;  1H2Q P;  3I55 Z;  1VQN Z;  4Y52 I;  2BZM A;  2XQW C;  3CC4 Z;  2R92 I;  2QKD A;  4E2Z A;  1N8R 1;  3D9X A;  3M4O I;  3FGT A;  3GTG I;  2OOX B;  3S2D I;  3CCJ Z;  2RT9 A;  3GKQ A;  2JUB A;  3I4M I;  2JIR A;  1VLA A;  3CC2 Z;  1K73 2;  3I55 1;  1VQN 1;  5D1O B;  1PPQ A;  3CC4 1;  1S7M A;  1HFH A;  2O39 C;  3NFP I;  1OK1 A;  3Q87 A;  4BBR I;  2ZYC A;  1G4F A;  2GTI A;  3S15 I;  4E2Y A;  1S72 Z;  1U5M A;  1KD1 2;  4APL A;  3MZK B;  3IF8 A;  4DGL A;  3CCJ 1;  3PO2 I;  3S14 I;  3CC2 1;  1Q16 A;  3J7A 4;  1TWC I;  3GTK I;  4MXU A;  3HOY I;  5C4X I;  2KI7 B;  4N7E A;  1KC8 2;  4Y7N I;  3NDI A;  3CD6 Z;  2XRD A;  3D2L A;  1MD7 A;  1Z03 A;  2B63 I;  3RJ3 D;  3L89 M;  1S72 1;  4E33 A;  1USP A;  1RLY A;  2JIQ A;  2CG6 A;  2EHF A;  2LOJ A;  1NWV A;  3SW0 X;  2PK7 A;  2XWB F;  1YHQ Z;  1I6H I;  4DK1 A;  3H0G I;  4HH4 A;  1WJ2 A;  1VQ6 1;  2HU9 A;  4PO7 A;  2BJO A;  4NBH A;  5IP7 I;  3IU3 I;  1FDI A;  2JA6 I;  3CQZ I;  3CD6 1;  2NVX I;  2OTJ Z;  3TDH B;  3INB C;  3KZJ A;  3S1M I;  2RL0 A;  3VTN A;  4A3F I;  1YHQ 1;  1Q82 2;  1RNI A;  3QWU A;  5FLX b;  4DQY B;  4WJG 2;  2DE6 A;  4RVH A;  3CPW Y;  1USP B;  1K8A 2;  1WZN A;  3CCS Z;  4NB9 A;  2Y8T A;  3S1N I;  2XRB A;  1KRL A;  5FLX f;  1M90 1;  4RVF A;  4RS4 A;  2E2I I;  3CCQ Z;  5FLM I;  2OTJ 1;  3VMH A;  4AYM A;  2VF1 A;  3FGR A;  4MD8 A;  3TE5 B;  2F4M A;  3GTM S;  4MSL A;  1SFO I;  2E2H I;  2JNY A;  5I0Q B;  2F4O A;  2CKU A;  1M1K 2;  2EC3 A;  1YJ9 Z;  1YJN Z;  3ZLD A;  2PMZ A;  3FKI I;  4S1T A;  4ZH1 D;  2R6M A;  1VQ8 Z;  1SRZ A;  4AYB A;  1ZB9 A;  3CCS 1;  2JMO A;  4FXG G;  1GPZ A;  1K83 I;  1Z02 A;  4NBC A;  4NFR A;  2E9H A;  3IX0 A;  3P5J B;  3CCQ 1;  1Q7Y 1;  2YU9 I;  2CG7 A;  4NBA A;  2V8J A;  2JIP A;  3EJH A;  2W80 A;  1TWG I;  2W03 A;  4YIZ A;  2LFU A;  3GTO I;  3G71 Z;  1OK3 A;  4NBE A;  1G4G A;  1YUK A;  5IT9 b;  2V3V A;  1YJ9 1;  1YJN 1;  3LUS A;  1VQ8 1;  2LIY A;  1VQ5 Z;  1FDO A;  3J81 b;  1VQO Z;  3CPW Z;  4A3K I;  3G4S Z;  3ZLE A;  2RPR A;  3TVJ A;  2RLP A;  5IT9 f;  1NJI 1;  2Q4Z A;  2YAD A;  4E32 A;  2QLV B;  2JGX A;  4E2X A;  2JA7 I;  1VVC A;  3G71 1;  1VQ9 Z;  2E7Z A;  4ONT D;  2K5R A;  1Y1V S;  3GTJ I;  2NVY I;  1YI2 Z;  2W81 A;  4HGY A;  1Q86 1;  4J38 B;  2V8K A;  1VQ5 1;  1VQO 1;  2QR1 B;  2Y8R A;  3KIF A;  1GKG A;  1QUB A;  3G4S 1;  1O9A A;  5D1P A;  2J6A A;  2M6N A;  1P9N A;  2V45 A;  1OJV A;  2KMS A;  2A55 A;  3I07 A;  2X2Z A;  3K3T A;  3R62 A;  1RLH A;  1QVG Y;  2LEX A;  1VQ9 1;  2ERJ A;  2GTH A;  5IP9 I;  1YI2 1;  3RZD I;  1VQ6 Z;  1N2F A;  4TNU A;  1Q81 2;  4C16 A;  3CXC Y;  4AYD A;  2DE7 A;  2NAP A;  3GTM I;  1E8B A;  1L1O C;  2AYD A;  3I56 Z;  1WCM I;  3IR7 A;  1MD8 A;  1SIW A;  3GCF A;  5A2Q b;  2RKY A;  4A3B I;  3M7P A;  3KIH A;  1HCC A;  4QTU A;  1X3W A;  3NH8 A;  1K73 1;  5A2Q f;  3ERB A;  3MZL B;  1H03 P;  3JAM b;  4E31 A;  2IZ4 A;  4A3E I;  3WSY A;  2RHB A;  3CAL A;  3S1Q I;  2GU2 A;  3I56 1;  2VUG A;  5HYP A;  3HOX I;  4CL1 A;  2QRE B;  3F6K A;  1K9M 1;  2WII C;  2WB1 A;  3GTP I;  1ZH1 A;  3JAM f;  3FQM A;  3HKZ A;  3I4N I;  3GTQ I;  2O53 A;  1KD1 1;  2O4H A;  1RQF A;  1YIT Z;  2VUM I;  3VMI A;  3PO3 S;  4NBD A;  3S17 I;  1ELV A;  1QVG Z;  2RIQ A;  1DL6 A;  1OK9 A;  4DJZ A;  5HYT B;  3VWO A;  3MQL A;  2QRD B;  2JIO A;  3CME Z;  3S1R I;  3HOU I;  4CSY A;  3CXC Z;  3NJA A;  1Y1V I;  4HGZ A;  3RZO I;  3S16 I;  5C44 I;  4B2S A;  3WSX A;  5C3E I;  1KQS Z;  4A3G I;  1E5G A;  4EWC A;  3CC7 Z;  2JA5 I;  1YIT 1;  1OJW A;  3OXU D;  1I3Q I;  1CKL A;  1X3Z A;  4A3L I;  3MON A;  1Q3X A;  1H04 P;  1TFI A;  3S2H I;  2JR6 A;  5JPM G;  3CI0 J;  2JIM A;  4X6A I;  3CME 1;  1R9T I;  1N8R 2;  3J80 b;  1RO0 A;  1TPN A;  3OP8 A;  3F3F C;  3ZRZ A;  4AYI A;  2MCZ A;  3GTL I;  3HOV I;  3CC7 1;  1YJW Z;  1QGB A;  2Q51 A;  3J80 f;  1UOT P;  3ESW A;  3GOV A;  3CCR Z;  3H3V J;  4A93 I;  1Q82 1;  1Z92 B;  1K8A 1;  1JJ2 Y;  1NUI A;  4RVG A;  4IGD A;  2K3R A;  2OZK A;  2VPW A;  2V8I A;  3CCU Z;  1RO4 A;  2OTL Z;  4LOS A;  2PM9 A;  2R93 I;  3J81 f;  3NH5 A;  2QEX Z;  4BY1 I;  1OJY A;  4KKD A;  2R7Z I;  2I2L A;  1VQ4 Z;  1YJW 1;  4A5W B;  4JHS A;  4MUC A;  3CCR 1;  5D1O A;  1AA6 A;  2G2K A;  3G6E Z;  4BBS I;  5DN4 A;  1M1K 1;  1Y1W I;  3ZD2 A;  4E30 A;  3CCM Z;  3FQQ A;  3CCU 1; 
#chains in the Genus database with same CATH homology
 2JRA A;  4K12 A;  2OTL 1;  3PO3 I;  2QEX 1;  2W04 A;  5CM2 M;  3BG0 B;  4RV9 A;  1W2B Y;  3O8E B;  1VQ4 1;  3CCE Z;  3K7A I;  1FBR A;  4AYE A;  4MD9 A;  1VQ7 Z;  3BG1 B;  4F4O C;  3G6E 1;  1PFT A;  2G7I A;  1GKN A;  4NH1 C;  3T4N B;  1C1Z A;  2KPI A;  3D6W A;  3CCM 1;  1JJ2 Z;  2XWJ I;  2B5I D;  4PZ5 A;  1K9M 2;  4NBF A;  1KQS Y;  2NVQ I;  3CCV Z;  3HOZ I;  4BY7 I;  2ZAE B;  1TWH I;  2E2J I;  3IFU A;  3CCE 1;  1VQ7 1;  5FO8 C;  2M48 A;  1GHQ B;  3OW2 Z;  2RBL A;  4MH4 A;  3GXE A;  1M90 2;  2JA8 I;  1NP6 A;  4NB8 A;  2MCY A;  3CCV 1;  4B2R A;  2P3Y A;  1JWH C;  1SS2 A;  1ZB8 A;  3T5O A;  1E88 A;  2I3C A;  4BXX I;  2YRA A;  1VVD A;  3CCL Z;  1VQP Z;  5AN9 F;  4E2W A;  1W2B Z;  4RVD A;  5HYU B;  2EGT A;  2JS4 A;  1QVF Y;  1OK2 A;  1RO2 A;  1TWF I;  1YUA A;  5T64 A;  3EED A;  1QO6 A;  1Q81 1;  4A3C I;  4A3J I;  2JGW A;  5HZP B;  4NBB A;  1Q7Y 2;  1KC8 1;  3ZD1 A;  3VB9 A;  1LQL A;  2QRC B;  1ML8 A;  5T67 A;  3OED C;  4LOT A;  3CCL 1;  3M3Y I;  1VQP 1;  2QA4 Z;  2KRI A;  1Z01 A;  2RKZ A;  4A3M I;  2QY0 A;  5T6B A;  1TWA I;  3HOW I;  5LL6 f;  2IZ3 A;  1TPM A;  1VQL Z;  2DE5 A;  1NJI 2;  3F3P C;  1VQK Z;  4XX2 A;  3VMG A;  2H85 A;  4A3I I;  1LY2 A;  4NOZ A;  4MD7 A;  1VQM Z;  1QYP A;  2QA4 1;  2AKL A;  1Q86 2;  2RLQ A;  3CMA Z;  1YIJ Z;  4A3D I;  2YBY A;  2P28 A;  1ZJK A;  1WII A;  4MON A;  1HFI A;  1X0T A;  1I50 I;  1QVF Z;  1VQL 1;  1TPG A;  1WW9 A;  1QF8 A;  2HF1 A;  3KXV A;  3EER A;  3NFZ A;  2WAQ A;  4YNX A;  3OW2 Y;  1VQK 1;  5C4J I;  3NDJ A;  3NH4 A;  1VQM 1;  2UWN A;  2V8E A;  4QTT A;  2OOY B;  1H2P P;  2Y0S A;  4NBG A;  3CMA 1;  4MRI A;  1YIJ 1;  3U50 C;  2NVT I;  1H2Q P;  3I55 Z;  1VQN Z;  4Y52 I;  2BZM A;  2XQW C;  3CC4 Z;  2R92 I;  2QKD A;  4E2Z A;  1N8R 1;  3D9X A;  3M4O I;  3GTG I;  2OOX B;  3S2D I;  3CCJ Z;  2RT9 A;  3GKQ A;  2JUB A;  3I4M I;  1VLA A;  3CC2 Z;  1K73 2;  3I55 1;  1VQN 1;  5D1O B;  1PPQ A;  3CC4 1;  1S7M A;  1HFH A;  2O39 C;  3NFP I;  1OK1 A;  3Q87 A;  4BBR I;  1G4F A;  2GTI A;  3S15 I;  4E2Y A;  1S72 Z;  1U5M A;  1KD1 2;  3MZK B;  3IF8 A;  4DGL A;  3CCJ 1;  3PO2 I;  3S14 I;  3CC2 1;  3J7A 4;  1TWC I;  3GTK I;  4MXU A;  3HOY I;  5C4X I;  2KI7 B;  1KC8 2;  4Y7N I;  3NDI A;  3CD6 Z;  2XRD A;  1MD7 A;  1Z03 A;  2B63 I;  3RJ3 D;  3L89 M;  1S72 1;  4E33 A;  1USP A;  1RLY A;  2CG6 A;  2EHF A;  2LOJ A;  1NWV A;  3SW0 X;  2PK7 A;  2XWB F;  1YHQ Z;  1I6H I;  4DK1 A;  3H0G I;  4HH4 A;  1VQ6 1;  2HU9 A;  2BJO A;  4NBH A;  5IP7 I;  3IU3 I;  2JA6 I;  3CQZ I;  3CD6 1;  2NVX I;  2OTJ Z;  3TDH B;  3INB C;  3KZJ A;  3S1M I;  2RL0 A;  3VTN A;  4A3F I;  1YHQ 1;  1Q82 2;  1RNI A;  3QWU A;  5FLX b;  4DQY B;  4WJG 2;  2DE6 A;  4RVH A;  3CPW Y;  1USP B;  1K8A 2;  3CCS Z;  4NB9 A;  3S1N I;  2XRB A;  1KRL A;  5FLX f;  1M90 1;  4RVF A;  4RS4 A;  2E2I I;  3CCQ Z;  5FLM I;  2OTJ 1;  3VMH A;  4AYM A;  2VF1 A;  4MD8 A;  3TE5 B;  2F4M A;  3GTM S;  1SFO I;  2E2H I;  2JNY A;  5I0Q B;  2F4O A;  2CKU A;  1M1K 2;  2EC3 A;  1YJ9 Z;  1YJN Z;  2PMZ A;  3FKI I;  4S1T A;  4ZH1 D;  2R6M A;  1VQ8 Z;  1SRZ A;  4AYB A;  1ZB9 A;  3CCS 1;  2JMO A;  4FXG G;  1GPZ A;  1K83 I;  1Z02 A;  4NBC A;  4NFR A;  2E9H A;  3IX0 A;  3P5J B;  3CCQ 1;  1Q7Y 1;  2YU9 I;  2CG7 A;  4NBA A;  2V8J A;  3EJH A;  2W80 A;  1TWG I;  2W03 A;  2LFU A;  3GTO I;  3G71 Z;  1OK3 A;  4NBE A;  1G4G A;  1YUK A;  5IT9 b;  1YJ9 1;  1YJN 1;  3LUS A;  1VQ8 1;  2LIY A;  1VQ5 Z;  3J81 b;  1VQO Z;  3CPW Z;  4A3K I;  3G4S Z;  2RPR A;  3TVJ A;  2RLP A;  5IT9 f;  1NJI 1;  2Q4Z A;  2YAD A;  4E32 A;  2QLV B;  2JGX A;  4E2X A;  2JA7 I;  1VVC A;  3G71 1;  1VQ9 Z;  4ONT D;  2K5R A;  1Y1V S;  3GTJ I;  2NVY I;  1YI2 Z;  2W81 A;  4HGY A;  1Q86 1;  4J38 B;  2V8K A;  1VQ5 1;  1VQO 1;  2QR1 B;  3KIF A;  1GKG A;  1QUB A;  3G4S 1;  1O9A A;  5D1P A;  2J6A A;  2M6N A;  1P9N A;  1OJV A;  2KMS A;  2A55 A;  3I07 A;  3R62 A;  1QVG Y;  1VQ9 1;  2ERJ A;  2GTH A;  5IP9 I;  1YI2 1;  3RZD I;  1VQ6 Z;  1N2F A;  4TNU A;  1Q81 2;  4C16 A;  3CXC Y;  4AYD A;  2DE7 A;  3GTM I;  1E8B A;  1L1O C;  3I56 Z;  1WCM I;  1MD8 A;  3GCF A;  5A2Q b;  2RKY A;  4A3B I;  3M7P A;  3KIH A;  1HCC A;  4QTU A;  1X3W A;  3NH8 A;  1K73 1;  5A2Q f;  3ERB A;  3MZL B;  1H03 P;  3JAM b;  4E31 A;  2IZ4 A;  4A3E I;  2RHB A;  3CAL A;  3S1Q I;  2GU2 A;  3I56 1;  2VUG A;  5HYP A;  3HOX I;  4CL1 A;  2QRE B;  1K9M 1;  2WII C;  2WB1 A;  3GTP I;  1ZH1 A;  3JAM f;  3FQM A;  3HKZ A;  3I4N I;  3GTQ I;  2O53 A;  1KD1 1;  2O4H A;  1RQF A;  1YIT Z;  2VUM I;  3VMI A;  3PO3 S;  4NBD A;  3S17 I;  1ELV A;  1QVG Z;  2RIQ A;  1DL6 A;  1OK9 A;  4DJZ A;  5HYT B;  3MQL A;  2QRD B;  3CME Z;  3S1R I;  3HOU I;  4CSY A;  3CXC Z;  4HGZ A;  1Y1V I;  3RZO I;  3S16 I;  5C44 I;  4B2S A;  5C3E I;  1KQS Z;  4A3G I;  1E5G A;  4EWC A;  3CC7 Z;  2JA5 I;  1YIT 1;  1OJW A;  3OXU D;  1I3Q I;  1CKL A;  1X3Z A;  4A3L I;  3MON A;  1Q3X A;  1H04 P;  1TFI A;  3S2H I;  2JR6 A;  5JPM G;  4X6A I;  3CME 1;  1R9T I;  1N8R 2;  3J80 b;  1RO0 A;  1TPN A;  3OP8 A;  3F3F C;  3ZRZ A;  4AYI A;  2MCZ A;  3GTL I;  3HOV I;  3CC7 1;  1YJW Z;  1QGB A;  2Q51 A;  3J80 f;  1UOT P;  3ESW A;  3GOV A;  3CCR Z;  3H3V J;  4A93 I;  1Q82 1;  1Z92 B;  1K8A 1;  1JJ2 Y;  1NUI A;  4RVG A;  4IGD A;  2K3R A;  2OZK A;  2V8I A;  3CCU Z;  1RO4 A;  2OTL Z;  4LOS A;  2PM9 A;  2R93 I;  3J81 f;  3NH5 A;  2QEX Z;  4BY1 I;  1OJY A;  4KKD A;  2R7Z I;  1VQ4 Z;  1YJW 1;  4A5W B;  4JHS A;  4MUC A;  3CCR 1;  5D1O A;  2G2K A;  3G6E Z;  4BBS I;  1M1K 1;  1Y1W I;  3ZD2 A;  4E30 A;  3CCM Z;  3FQQ A;  3CCU 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...