2IZ4A

Solution structure of porcine beta-microseminoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
b'QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
molecule tags Inhibitor
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz4A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz4A02
2RKYA 3L89M 3OEDC 1H04P 1TPMA 1E5GA 4MUCA 2W81A 3INBC 4C16A 1GKGA 5FO8C 1FBRA 3EJHA 2JGXA 1SS2A 2XWJI 5HYPA 5HZPB 1U5MA 1VVDA 4CSYA 4ZH1D 3KXVA 1TPGA 2JRAA 2A55A 3NFPI 1GPZA 2RLQA 1PPQA 4AYMA 4AYEA 3GXEA 2XRDA 1G4GA 3IU3I 3IX0A 1MD8A 1VVCA 3O8EB 2WIIC 2ERJA 3SW0X 2QY0A 4K12A 1QO6A 3R62A 1UOTP 2UWNA 5I0QB 3CALA 2IZ3A 5HYTB 2RLPA 1MD7A 2XWBF 2CG7A 1GHQB 1OJVA 1ELVA 4LOTA 1TPNA 2EHFA 4DJZA 3ERBA 1G4FA 4B2RA 2LOJA 4AYIA 1H2PP 2RL0A 2XRBA 3GOVA 1E8BA 2XQWC 3TVJA 4A5WB 1GKNA 2MCYA 2RKZA 4IGDA 5JPMG 2CG6A 1C1ZA 4F4OC 5HYUB 4ONTD 3OP8A 2YRAA 2G7IA 3MQLA 2O39C 3T5OA 2IZ4A 2V8EA 1Q3XA 1CKLA 1H03P 4YNXA 1ZJKA 1QGBA 2BZMA 1HFHA 4PZ5A 4B2SA 2YBYA 4AYDA 1OK3A 1SRZA 3ZD2A 2W80A 4WJG2 2CKUA 1H2QP 1O9AA 2KRIA 1NWVA 2MCZA 1QUBA 3KZJA 2B5ID 4LOSA 1Z92B 3M7PA 4KKDA 1HFIA 1OJYA 4FXGG 3RJ3D 1OK2A 3ZRZA 1OK9A 1OK1A 3OXUD 2EC3A 1OJWA 1LY2A 3ZD1A 1E88A 2JGWA 4JHSA 2KMSA 4J38B 1HCCA
chains in the Genus database with same CATH superfamily
1K9M2 1VQK1 1TPMA 3CPWY 1VQN1 5FO8C 2V8JA 2WB1A 2E7ZA 3K7AI 1ZB8A 5CM2M 3CCL1 3VMHA 2BJOA 3HOYI 3IFUA 2JIMA 3NH5A 1Q861 3I561 1RO2A 3CME1 2QR1B 1VQ7Z 1GPZA 3MZKB 3CCEZ 3S1NI 2W04A 1TWAI 3HOWI 3H0GI 2R7ZI 5A2Qf 3NJAA 2WIIC 3M3YI 1Y1WI 1KQSZ 2DE7A 4K12A 1QO6A 1KD11 1Q811 1WIIA 1X3WA 3I4NI 3GTKI 5I0QB 4E2XA 1QVGZ 3CALA 5DN4A 1JJ2Z 2RLPA 3FGRA 2NVQI 4A3JI 1ELVA 2V3VA 1TWCI 2R6MA 1TPNA 2JR6A 1QYPA 2Q51A 2X2ZA 4HGZA 3HKZA 2RL0A 4A5WB 2OTJ1 2RKZA 5D1OA 2K3RA 1S72Z 2RT9A 1VQL1 2VUMI 2YRAA 1VQ61 4NBBA 1RO4A 3WSYA 3CD6Z 2IV2X 2V8EA 1VQM1 3CCQ1 3OW2Z 1Q3XA 1YJW1 2JA6I 2I2LA 2RHBA 4BY7I 5FLXf 2JA8I 3S14I 3VMGA 1Q821 4PZ5A 1HFHA 2YBYA 3HOVI 3G6E1 1TWHI 2CKUA 1H2QP 2AYDA 3CPWZ 2V8IA 2EGTA 4BY1I 3J80b 3GCFA 1K732 2B5ID 1M1K2 3S1QI 1Z92B 2ZYCA 1OJYA 4CL1A 3J80f 1YIJZ 2E2II 1OK9A 1FDIA 5T6BA 3GKQA 1VQKZ 4MD7A 1OJWA 3CCR1 4A3DI 1SIWA 1LY2A 3ZD1A 1VQNZ 4NBCA 1K83I 2KMSA 2V8KA 2H85A 3IF8A 2OTL1 3S17I 2QRCB 3CCJ1 3FQQA 3CC41 1M902 2ZAEB 3S1RI 2VUGA 4MUCA 3CCLZ 2NVXI 1VQ41 2LIYA 4E32A 3I56Z 1QVFZ 3CMEZ 4A3GI 2NVTI 2JGXA 1Y1VI 1S7MA 2E9HA 5HYPA 1I50I 1Y1VS 4S1TA 2KPIA 2E2HI 3QWUA 2V45A 3S16I 4X6AI 3CCV1 3NFPI 5C3EI 3T4NB 1PPQA 4AYMA 4MRIA 3GTOI 4NH1C 3H3VJ 4AYEA 4E2YA 3CC2Z 1VQP1 1NJI2 1TWFI 3O8EB 4A3MI 3NDIA 2ERJA 3GTQI 3LUSA 1KD12 2NAPA 1Q812 3I07A 2QEXZ 3R62A 3CCMZ 3NDJA 1W2BY 4RVDA 3GTMI 2OZKA 2XWBF 2M6NA 3F3FC 3GTMS 2CG7A 4A3LI 4A3BI 1K8A1 1X0TA 5A2Qb 2M48A 2VPYA 4B2RA 1VQLZ 1WJ2A 3CCS1 1H2PP 2PK7A 3VB9A 3ZLEA 3TE5B 1E8BA 3TVJA 4MH4A 1VQMZ 4IGDA 2YADA 3CCQZ 1YJWZ 2K5RA 2QA41 3VMIA 5C4JI 3MQLA 1N8R1 4NB9A 1AA6A 1VQ81 1CKLA 2KI7B 5C44I 3G6EZ 1H03P 3EERA 2B63I 3GTGI 1YJ91 5C4XI 2BZMA 2GTHA 2PM9A 4NBEA 3NH4A 1SRZA 4A3CI 3J81f 4WJG2 4APLA 1NWVA 2MCZA 2JIOA 1QUBA 3KZJA 1USPA 1YJN1 3CXCY 2GTIA 4KKDA 1QXFA 1HFIA 4NBAA 3ESWA 1QF8A 3NH8A 5FLXb 1YIT1 2OTLZ 1TFIA 3CCJZ 1YHQZ 4HH4A 4BWCA 2AKLA 4E2WA 2EC3A 2LEXA 3S15I 3PO3I 1E88A 3PO3S 4J38B 3WSXA 3D2LA 2RKYA 3TDHB 3L89M 3RZDI 3OEDC 1H04P 1E5GA 1KC82 1RQFA 1P9NA 4PO7A 1FBRA 3JAMf 3CCVZ 1N2FA 1VVDA 4MD9A 3KXVA 4E33A 1W2BZ 1VQPZ 1TPGA 2A55A 2JIRA 1Z02A 2RLQA 4A3KI 3F3PC 1VQO1 2RPRA 2VPXA 3GXEA 3K3TA 3ZLDA 1PFTA 2XRDA 4QTUA 1VQ91 1G4GA 3IU3I 2Y8SA 1ML8A 1LQLA 1YUKA 2Y0SA 3MONA 4MONA 1VVCA 2NVYI 3G4S1 2G2KA 1L1OC 2HF1A 3SW0X 3FGTA 3CMA1 4A3EI 2OOXB 2WAQA 1QVGY 1JJ2Y 4AYBA 1Q862 2UWNA 2Y8RA 1I6HI 1S721 3D9XA 1MD7A 1RLYA 2QLVB 5LL6f 5DN5A 5T64A 3GTPI 1GHQB 3HOZI 1OJVA 4NB8A 3CCSZ 3IR7A 4LOTA 2JMOA 5T67A 1KRLA 2EHFA 4DJZA 4Y7NI 1G4FA 4BBRI 2LOJA 4AYIA 1RLHA 3GTJI 3S2HI 2HU9A 5D1PA 2XRBA 3GOVA 1Z01A 1VQ8Z 5JPMG 3VTNA 1K731 1NUIA 3I551 4ONTD 1N8R2 1YJ9Z 4E31A 1M1K1 4BBSI 2G7IA 3OW2Y 3GTLI 2RBLA 3T5OA 1Q7Y1 2IZ4A 3CI0J 3P5JB 2F4OA 5D1OB 1WCMI 3CCU1 4BXXI 2JUBA 1ZJKA 3J7A4 3VWOA 2P3YA 2VF1A 2OTJZ 1VQ51 3F6KA 4AYDA 1YJNZ 3PO2I 5FLMI 4NOZA 3S2DI 1M901 2W03A 2QRDB 4EWCA 1VQ6Z 2KRIA 1I3QI 1YITZ 4MXUA 5IT9b 2O53A 4RVGA 5IT9f 1RO0A 4FXGG 3RJ3D 1OK2A 3ZRZA 1OK1A 1YI21 4NBGA 3FKII 4E30A 1JWHC 4DGLA 3OXUD 3S1MI 4Y52I 2JIQA 1Q822 2JS4A 2DE6A 2JGWA 4RV9A 3J81b 3G711 3CC71 2J6AA 3KIFA 1K9M1 1NJI1 1WW9A 4N7EA 2W81A 3INBC 4C16A 1QVFY 1GKGA 2JA7I 1Y8CA 3I4MI 3CC21 3EJHA 1ZH1A 2DE5A 3CQZI 4MD8A 1TWGI 4YIZA 3CCRZ 1SS2A 2XWJI 5HZPB 1U5MA 1VQOZ 2JIPA 4CSYA 4ZH1D 4DQYB 1VQ9Z 2YU9I 1YUAA 1WZNA 2JRAA 2QEX1 2I3CA 3CC4Z 3CCM1 3G4SZ 1VQ4Z 2RIQA 3BG1B 3CMAZ 2F4MA 2VPZA 1VQ71 3IX0A 3JAMb 2Y8TA 1MD8A 2JNYA 1RNIA 1SFOI 2PMZA 3CCE1 3Q87A 4A3FI 2QY0A 4RVFA 1NP6A 4RS4A 2QKDA 4XX2A 2GU2A 4RVHA 1ZB9A 5IP7I 4NBFA 1UOTP 4HGYA 2IZ3A 5HYTB 3D6WA 4A3II 1Z03A 4NBHA 1R9TI 2O4HA 4QTTA 3RZOI 2Q4ZA 3ERBA 2OOYB 3I55Z 4E2ZA 3M4OI 2XQWC 1GKNA 2MCYA 1KQSY 2P28A 2CG6A 1C1ZA 4F4OC 5HYUB 3CCUZ 3OP8A 3MZLB 4NBDA 1Q7Y2 2O39C 1VQ5Z 2VPWA 3FQMA 2R93I 4YNXA 1K8A2 1X3ZA 1QGBA 2JA5I 4B2SA 3CD61 1FDOA 1YHQ1 1DL6A 1OK3A 3BG0B 4DK1A 5IP9I 3ZD2A 2W80A 3KIHA 4TNUA 2QA4Z 1KC81 1O9AA 3EEDA 1VLAA 1YI2Z 3U50C 4A93I 3NFZA 4LOSA 2R92I 1Q16A 3M7PA 2QREB 3CXCZ 3HOXI 5AN9F 2LFUA 3G71Z 3CC7Z 2E2JI 1USPB 4NFRA 4MSLA 4JHSA 3HOUI 1HCCA 1YIJ1
chains in the Genus database with same CATH topology
1K9M2 1VQK1 1TPMA 3CPWY 1VQN1 5FO8C 2V8JA 2WB1A 3K7AI 1ZB8A 5CM2M 3CCL1 3VMHA 2BJOA 3HOYI 3IFUA 3NH5A 1Q861 3I561 1RO2A 3CME1 2QR1B 1VQ7Z 1GPZA 3MZKB 3CCEZ 3S1NI 2W04A 1TWAI 3HOWI 3H0GI 2R7ZI 5A2Qf 2WIIC 3M3YI 1Y1WI 1KQSZ 2DE7A 4K12A 1QO6A 1KD11 1Q811 1WIIA 1X3WA 3I4NI 3GTKI 5I0QB 4E2XA 1QVGZ 3CALA 1JJ2Z 2RLPA 2NVQI 4A3JI 1ELVA 1TWCI 2R6MA 1TPNA 2JR6A 1QYPA 2Q51A 4HGZA 3HKZA 2RL0A 4A5WB 2OTJ1 2RKZA 5D1OA 2K3RA 1S72Z 2RT9A 1VQL1 2VUMI 2YRAA 1VQ61 4NBBA 1RO4A 3CD6Z 2V8EA 1VQM1 3CCQ1 3OW2Z 1Q3XA 1YJW1 2JA6I 2RHBA 4BY7I 5FLXf 2JA8I 3S14I 3VMGA 1Q821 4PZ5A 1HFHA 2YBYA 3HOVI 3G6E1 1TWHI 2CKUA 1H2QP 3CPWZ 2V8IA 2EGTA 4BY1I 3J80b 3GCFA 1K732 2B5ID 1M1K2 3S1QI 1Z92B 1OJYA 4CL1A 3J80f 1YIJZ 2E2II 1OK9A 5T6BA 3GKQA 1VQKZ 4MD7A 1OJWA 3CCR1 4A3DI 1VQNZ 1LY2A 3ZD1A 4NBCA 1K83I 2KMSA 2V8KA 3IF8A 2H85A 2OTL1 3S17I 2QRCB 3CCJ1 3FQQA 3CC41 1M902 2ZAEB 3S1RI 2VUGA 4MUCA 3CCLZ 2NVXI 1VQ41 2LIYA 4E32A 3I56Z 1QVFZ 3CMEZ 4A3GI 2NVTI 2JGXA 1Y1VI 1S7MA 2E9HA 5HYPA 1I50I 1Y1VS 4S1TA 2KPIA 2E2HI 3QWUA 3S16I 4X6AI 3CCV1 3NFPI 5C3EI 3T4NB 1PPQA 4AYMA 4MRIA 3GTOI 4NH1C 3H3VJ 4AYEA 4E2YA 3CC2Z 1VQP1 1NJI2 1TWFI 3O8EB 4A3MI 3NDIA 2ERJA 3GTQI 3LUSA 1KD12 1Q812 3I07A 2QEXZ 3R62A 3CCMZ 3NDJA 1W2BY 4RVDA 3GTMI 2OZKA 2XWBF 2M6NA 3F3FC 3GTMS 2CG7A 4A3LI 4A3BI 1K8A1 1X0TA 5A2Qb 2M48A 4B2RA 1VQLZ 3CCS1 1H2PP 2PK7A 3VB9A 3TE5B 1E8BA 3TVJA 4MH4A 1VQMZ 4IGDA 2YADA 3CCQZ 1YJWZ 2K5RA 2QA41 3VMIA 5C4JI 3MQLA 1N8R1 4NB9A 1VQ81 1CKLA 2KI7B 5C44I 3G6EZ 1H03P 3EERA 2B63I 3GTGI 1YJ91 5C4XI 2BZMA 2GTHA 2PM9A 4NBEA 3NH4A 1SRZA 4A3CI 3J81f 4WJG2 1NWVA 2MCZA 1QUBA 3KZJA 1USPA 1YJN1 3CXCY 2GTIA 4KKDA 1HFIA 4NBAA 3ESWA 1QF8A 3NH8A 5FLXb 1YIT1 2OTLZ 1TFIA 3CCJZ 1YHQZ 4HH4A 4E2WA 2AKLA 2EC3A 3S15I 3PO3I 1E88A 3PO3S 4J38B 2RKYA 3TDHB 3L89M 3RZDI 3OEDC 1H04P 1E5GA 1KC82 1RQFA 1P9NA 1FBRA 3JAMf 3CCVZ 1N2FA 1VVDA 4MD9A 3KXVA 4E33A 1W2BZ 1VQPZ 1TPGA 2A55A 1Z02A 2RLQA 4A3KI 3F3PC 1VQO1 2RPRA 3GXEA 1PFTA 2XRDA 4QTUA 1VQ91 1G4GA 3IU3I 1ML8A 1LQLA 1YUKA 2Y0SA 3MONA 4MONA 1VVCA 2NVYI 3G4S1 2G2KA 1L1OC 2HF1A 3SW0X 3CMA1 4A3EI 2OOXB 2WAQA 1QVGY 1JJ2Y 4AYBA 1Q862 2UWNA 1I6HI 1S721 3D9XA 1MD7A 1RLYA 2QLVB 5LL6f 5T64A 3HOZI 3GTPI 1GHQB 1OJVA 4NB8A 3CCSZ 4LOTA 2JMOA 5T67A 1KRLA 2EHFA 4DJZA 4Y7NI 1G4FA 4BBRI 2LOJA 4AYIA 3GTJI 3S2HI 2HU9A 5D1PA 2XRBA 3GOVA 1Z01A 1VQ8Z 5JPMG 3VTNA 1K731 1NUIA 3I551 4ONTD 1N8R2 1YJ9Z 4E31A 1M1K1 4BBSI 2G7IA 3OW2Y 3GTLI 2RBLA 3T5OA 1Q7Y1 2IZ4A 3P5JB 2F4OA 5D1OB 1WCMI 3CCU1 4BXXI 2JUBA 1ZJKA 3J7A4 2P3YA 2VF1A 2OTJZ 1VQ51 4AYDA 1YJNZ 3PO2I 5FLMI 4NOZA 3S2DI 1M901 2W03A 2QRDB 4EWCA 1VQ6Z 2KRIA 1I3QI 1YITZ 4MXUA 5IT9b 2O53A 4RVGA 5IT9f 1RO0A 4FXGG 3RJ3D 1OK2A 3ZRZA 1OK1A 1YI21 4NBGA 3FKII 4E30A 1JWHC 4DGLA 3OXUD 3S1MI 4Y52I 1Q822 2JS4A 2DE6A 2JGWA 4RV9A 3J81b 3G711 3CC71 2J6AA 3KIFA 1K9M1 1NJI1 1WW9A 2W81A 3INBC 4C16A 1QVFY 1GKGA 2JA7I 3I4MI 3CC21 3EJHA 1ZH1A 2DE5A 3CQZI 4MD8A 1TWGI 3CCRZ 1SS2A 2XWJI 5HZPB 1U5MA 1VQOZ 4CSYA 4ZH1D 4DQYB 1VQ9Z 2YU9I 1YUAA 2JRAA 2QEX1 2I3CA 3CC4Z 3CCM1 3G4SZ 1VQ4Z 2RIQA 3BG1B 3CMAZ 2F4MA 1VQ71 3IX0A 3JAMb 1MD8A 2JNYA 1RNIA 1SFOI 2PMZA 3CCE1 3Q87A 4A3FI 2QY0A 4RVFA 1NP6A 4RS4A 2QKDA 4XX2A 2GU2A 4RVHA 1ZB9A 5IP7I 4NBFA 1UOTP 4HGYA 2IZ3A 5HYTB 3D6WA 4A3II 1Z03A 4NBHA 1R9TI 2O4HA 4QTTA 3RZOI 2Q4ZA 3ERBA 2OOYB 3I55Z 4E2ZA 3M4OI 2XQWC 1GKNA 2MCYA 1KQSY 2P28A 2CG6A 1C1ZA 4F4OC 5HYUB 3CCUZ 3OP8A 3MZLB 4NBDA 1Q7Y2 2O39C 1VQ5Z 3FQMA 2R93I 4YNXA 1K8A2 1X3ZA 1QGBA 2JA5I 4B2SA 3CD61 1YHQ1 1DL6A 1OK3A 3BG0B 4DK1A 5IP9I 3ZD2A 2W80A 3KIHA 4TNUA 2QA4Z 1KC81 1O9AA 3EEDA 1VLAA 1YI2Z 3U50C 4A93I 3NFZA 4LOSA 2R92I 3M7PA 2QREB 3CXCZ 3HOXI 5AN9F 2LFUA 3G71Z 3CC7Z 2E2JI 1USPB 4NFRA 4JHSA 3HOUI 1HCCA 1YIJ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKY A;  3L89 M;  3OED C;  1H04 P;  1TPM A;  1E5G A;  4MUC A;  2W81 A;  3INB C;  4C16 A;  1GKG A;  5FO8 C;  1FBR A;  3EJH A;  2JGX A;  1SS2 A;  2XWJ I;  5HYP A;  5HZP B;  1U5M A;  1VVD A;  4CSY A;  4ZH1 D;  3KXV A;  1TPG A;  2JRA A;  2A55 A;  3NFP I;  1GPZ A;  2RLQ A;  1PPQ A;  4AYM A;  4AYE A;  3GXE A;  2XRD A;  1G4G A;  3IU3 I;  3IX0 A;  1MD8 A;  1VVC A;  3O8E B;  2WII C;  2ERJ A;  3SW0 X;  2QY0 A;  4K12 A;  1QO6 A;  3R62 A;  1UOT P;  2UWN A;  5I0Q B;  3CAL A;  2IZ3 A;  5HYT B;  2RLP A;  1MD7 A;  2XWB F;  2CG7 A;  1GHQ B;  1OJV A;  1ELV A;  4LOT A;  1TPN A;  2EHF A;  4DJZ A;  3ERB A;  1G4F A;  4B2R A;  2LOJ A;  4AYI A;  1H2P P;  2RL0 A;  2XRB A;  3GOV A;  1E8B A;  2XQW C;  3TVJ A;  4A5W B;  1GKN A;  2MCY A;  2RKZ A;  4IGD A;  5JPM G;  2CG6 A;  1C1Z A;  4F4O C;  5HYU B;  4ONT D;  3OP8 A;  2YRA A;  2G7I A;  3MQL A;  2O39 C;  3T5O A;  2IZ4 A;  2V8E A;  1Q3X A;  1CKL A;  1H03 P;  4YNX A;  1ZJK A;  1QGB A;  2BZM A;  1HFH A;  4PZ5 A;  4B2S A;  2YBY A;  4AYD A;  1OK3 A;  1SRZ A;  3ZD2 A;  2W80 A;  4WJG 2;  2CKU A;  1H2Q P;  1O9A A;  2KRI A;  1NWV A;  2MCZ A;  1QUB A;  3KZJ A;  2B5I D;  4LOS A;  1Z92 B;  3M7P A;  4KKD A;  1HFI A;  1OJY A;  4FXG G;  3RJ3 D;  1OK2 A;  3ZRZ A;  1OK9 A;  1OK1 A;  3OXU D;  2EC3 A;  1OJW A;  1LY2 A;  3ZD1 A;  1E88 A;  2JGW A;  4JHS A;  2KMS A;  4J38 B;  1HCC A; 
#chains in the Genus database with same CATH topology
 1K9M 2;  1VQK 1;  1TPM A;  3CPW Y;  1VQN 1;  5FO8 C;  2V8J A;  2WB1 A;  2E7Z A;  3K7A I;  1ZB8 A;  5CM2 M;  3CCL 1;  3VMH A;  2BJO A;  3HOY I;  3IFU A;  2JIM A;  3NH5 A;  1Q86 1;  3I56 1;  1RO2 A;  3CME 1;  2QR1 B;  1VQ7 Z;  1GPZ A;  3MZK B;  3CCE Z;  3S1N I;  2W04 A;  1TWA I;  3HOW I;  3H0G I;  2R7Z I;  5A2Q f;  3NJA A;  2WII C;  3M3Y I;  1Y1W I;  1KQS Z;  2DE7 A;  4K12 A;  1QO6 A;  1KD1 1;  1Q81 1;  1WII A;  1X3W A;  3I4N I;  3GTK I;  5I0Q B;  4E2X A;  1QVG Z;  3CAL A;  5DN4 A;  1JJ2 Z;  2RLP A;  3FGR A;  2NVQ I;  4A3J I;  1ELV A;  2V3V A;  1TWC I;  2R6M A;  1TPN A;  2JR6 A;  1QYP A;  2Q51 A;  2X2Z A;  4HGZ A;  3HKZ A;  2RL0 A;  4A5W B;  2OTJ 1;  2RKZ A;  5D1O A;  2K3R A;  1S72 Z;  2RT9 A;  1VQL 1;  2VUM I;  2YRA A;  1VQ6 1;  4NBB A;  1RO4 A;  3WSY A;  3CD6 Z;  2IV2 X;  2V8E A;  1VQM 1;  3CCQ 1;  3OW2 Z;  1Q3X A;  1YJW 1;  2JA6 I;  2I2L A;  2RHB A;  4BY7 I;  5FLX f;  2JA8 I;  3S14 I;  3VMG A;  1Q82 1;  4PZ5 A;  1HFH A;  2YBY A;  3HOV I;  3G6E 1;  1TWH I;  2CKU A;  1H2Q P;  2AYD A;  3CPW Z;  2V8I A;  2EGT A;  4BY1 I;  3J80 b;  3GCF A;  1K73 2;  2B5I D;  1M1K 2;  3S1Q I;  1Z92 B;  2ZYC A;  1OJY A;  4CL1 A;  3J80 f;  1YIJ Z;  2E2I I;  1OK9 A;  1FDI A;  5T6B A;  3GKQ A;  1VQK Z;  4MD7 A;  1OJW A;  3CCR 1;  4A3D I;  1SIW A;  1LY2 A;  3ZD1 A;  1VQN Z;  4NBC A;  1K83 I;  2KMS A;  2V8K A;  2H85 A;  3IF8 A;  2OTL 1;  3S17 I;  2QRC B;  3CCJ 1;  3FQQ A;  3CC4 1;  1M90 2;  2ZAE B;  3S1R I;  2VUG A;  4MUC A;  3CCL Z;  2NVX I;  1VQ4 1;  2LIY A;  4E32 A;  3I56 Z;  1QVF Z;  3CME Z;  4A3G I;  2NVT I;  2JGX A;  1Y1V I;  1S7M A;  2E9H A;  5HYP A;  1I50 I;  1Y1V S;  4S1T A;  2KPI A;  2E2H I;  3QWU A;  2V45 A;  3S16 I;  4X6A I;  3CCV 1;  3NFP I;  5C3E I;  3T4N B;  1PPQ A;  4AYM A;  4MRI A;  3GTO I;  4NH1 C;  3H3V J;  4AYE A;  4E2Y A;  3CC2 Z;  1VQP 1;  1NJI 2;  1TWF I;  3O8E B;  4A3M I;  3NDI A;  2ERJ A;  3GTQ I;  3LUS A;  1KD1 2;  2NAP A;  1Q81 2;  3I07 A;  2QEX Z;  3R62 A;  3CCM Z;  3NDJ A;  1W2B Y;  4RVD A;  3GTM I;  2OZK A;  2XWB F;  2M6N A;  3F3F C;  3GTM S;  2CG7 A;  4A3L I;  4A3B I;  1K8A 1;  1X0T A;  5A2Q b;  2M48 A;  2VPY A;  4B2R A;  1VQL Z;  1WJ2 A;  3CCS 1;  1H2P P;  2PK7 A;  3VB9 A;  3ZLE A;  3TE5 B;  1E8B A;  3TVJ A;  4MH4 A;  1VQM Z;  4IGD A;  2YAD A;  3CCQ Z;  1YJW Z;  2K5R A;  2QA4 1;  3VMI A;  5C4J I;  3MQL A;  1N8R 1;  4NB9 A;  1AA6 A;  1VQ8 1;  1CKL A;  2KI7 B;  5C44 I;  3G6E Z;  1H03 P;  3EER A;  2B63 I;  3GTG I;  1YJ9 1;  5C4X I;  2BZM A;  2GTH A;  2PM9 A;  4NBE A;  3NH4 A;  1SRZ A;  4A3C I;  3J81 f;  4WJG 2;  4APL A;  1NWV A;  2MCZ A;  2JIO A;  1QUB A;  3KZJ A;  1USP A;  1YJN 1;  3CXC Y;  2GTI A;  4KKD A;  1QXF A;  1HFI A;  4NBA A;  3ESW A;  1QF8 A;  3NH8 A;  5FLX b;  1YIT 1;  2OTL Z;  1TFI A;  3CCJ Z;  1YHQ Z;  4HH4 A;  4BWC A;  2AKL A;  4E2W A;  2EC3 A;  2LEX A;  3S15 I;  3PO3 I;  1E88 A;  3PO3 S;  4J38 B;  3WSX A;  3D2L A;  2RKY A;  3TDH B;  3L89 M;  3RZD I;  3OED C;  1H04 P;  1E5G A;  1KC8 2;  1RQF A;  1P9N A;  4PO7 A;  1FBR A;  3JAM f;  3CCV Z;  1N2F A;  1VVD A;  4MD9 A;  3KXV A;  4E33 A;  1W2B Z;  1VQP Z;  1TPG A;  2A55 A;  2JIR A;  1Z02 A;  2RLQ A;  4A3K I;  3F3P C;  1VQO 1;  2RPR A;  2VPX A;  3GXE A;  3K3T A;  3ZLD A;  1PFT A;  2XRD A;  4QTU A;  1VQ9 1;  1G4G A;  3IU3 I;  2Y8S A;  1ML8 A;  1LQL A;  1YUK A;  2Y0S A;  3MON A;  4MON A;  1VVC A;  2NVY I;  3G4S 1;  2G2K A;  1L1O C;  2HF1 A;  3SW0 X;  3FGT A;  3CMA 1;  4A3E I;  2OOX B;  2WAQ A;  1QVG Y;  1JJ2 Y;  4AYB A;  1Q86 2;  2UWN A;  2Y8R A;  1I6H I;  1S72 1;  3D9X A;  1MD7 A;  1RLY A;  2QLV B;  5LL6 f;  5DN5 A;  5T64 A;  3GTP I;  1GHQ B;  3HOZ I;  1OJV A;  4NB8 A;  3CCS Z;  3IR7 A;  4LOT A;  2JMO A;  5T67 A;  1KRL A;  2EHF A;  4DJZ A;  4Y7N I;  1G4F A;  4BBR I;  2LOJ A;  4AYI A;  1RLH A;  3GTJ I;  3S2H I;  2HU9 A;  5D1P A;  2XRB A;  3GOV A;  1Z01 A;  1VQ8 Z;  5JPM G;  3VTN A;  1K73 1;  1NUI A;  3I55 1;  4ONT D;  1N8R 2;  1YJ9 Z;  4E31 A;  1M1K 1;  4BBS I;  2G7I A;  3OW2 Y;  3GTL I;  2RBL A;  3T5O A;  1Q7Y 1;  2IZ4 A;  3CI0 J;  3P5J B;  2F4O A;  5D1O B;  1WCM I;  3CCU 1;  4BXX I;  2JUB A;  1ZJK A;  3J7A 4;  3VWO A;  2P3Y A;  2VF1 A;  2OTJ Z;  1VQ5 1;  3F6K A;  4AYD A;  1YJN Z;  3PO2 I;  5FLM I;  4NOZ A;  3S2D I;  1M90 1;  2W03 A;  2QRD B;  4EWC A;  1VQ6 Z;  2KRI A;  1I3Q I;  1YIT Z;  4MXU A;  5IT9 b;  2O53 A;  4RVG A;  5IT9 f;  1RO0 A;  4FXG G;  3RJ3 D;  1OK2 A;  3ZRZ A;  1OK1 A;  1YI2 1;  4NBG A;  3FKI I;  4E30 A;  1JWH C;  4DGL A;  3OXU D;  3S1M I;  4Y52 I;  2JIQ A;  1Q82 2;  2JS4 A;  2DE6 A;  2JGW A;  4RV9 A;  3J81 b;  3G71 1;  3CC7 1;  2J6A A;  3KIF A;  1K9M 1;  1NJI 1;  1WW9 A;  4N7E A;  2W81 A;  3INB C;  4C16 A;  1QVF Y;  1GKG A;  2JA7 I;  1Y8C A;  3I4M I;  3CC2 1;  3EJH A;  1ZH1 A;  2DE5 A;  3CQZ I;  4MD8 A;  1TWG I;  4YIZ A;  3CCR Z;  1SS2 A;  2XWJ I;  5HZP B;  1U5M A;  1VQO Z;  2JIP A;  4CSY A;  4ZH1 D;  4DQY B;  1VQ9 Z;  2YU9 I;  1YUA A;  1WZN A;  2JRA A;  2QEX 1;  2I3C A;  3CC4 Z;  3CCM 1;  3G4S Z;  1VQ4 Z;  2RIQ A;  3BG1 B;  3CMA Z;  2F4M A;  2VPZ A;  1VQ7 1;  3IX0 A;  3JAM b;  2Y8T A;  1MD8 A;  2JNY A;  1RNI A;  1SFO I;  2PMZ A;  3CCE 1;  3Q87 A;  4A3F I;  2QY0 A;  4RVF A;  1NP6 A;  4RS4 A;  2QKD A;  4XX2 A;  2GU2 A;  4RVH A;  1ZB9 A;  5IP7 I;  4NBF A;  1UOT P;  4HGY A;  2IZ3 A;  5HYT B;  3D6W A;  4A3I I;  1Z03 A;  4NBH A;  1R9T I;  2O4H A;  4QTT A;  3RZO I;  2Q4Z A;  3ERB A;  2OOY B;  3I55 Z;  4E2Z A;  3M4O I;  2XQW C;  1GKN A;  2MCY A;  1KQS Y;  2P28 A;  2CG6 A;  1C1Z A;  4F4O C;  5HYU B;  3CCU Z;  3OP8 A;  3MZL B;  4NBD A;  1Q7Y 2;  2O39 C;  1VQ5 Z;  2VPW A;  3FQM A;  2R93 I;  4YNX A;  1K8A 2;  1X3Z A;  1QGB A;  2JA5 I;  4B2S A;  3CD6 1;  1FDO A;  1YHQ 1;  1DL6 A;  1OK3 A;  3BG0 B;  4DK1 A;  5IP9 I;  3ZD2 A;  2W80 A;  3KIH A;  4TNU A;  2QA4 Z;  1KC8 1;  1O9A A;  3EED A;  1VLA A;  1YI2 Z;  3U50 C;  4A93 I;  3NFZ A;  4LOS A;  2R92 I;  1Q16 A;  3M7P A;  2QRE B;  3CXC Z;  3HOX I;  5AN9 F;  2LFU A;  3G71 Z;  3CC7 Z;  2E2J I;  1USP B;  4NFR A;  4MSL A;  4JHS A;  3HOU I;  1HCC A;  1YIJ 1; 
#chains in the Genus database with same CATH homology
 1K9M 2;  1VQK 1;  1TPM A;  3CPW Y;  1VQN 1;  5FO8 C;  2V8J A;  2WB1 A;  3K7A I;  1ZB8 A;  5CM2 M;  3CCL 1;  3VMH A;  2BJO A;  3HOY I;  3IFU A;  3NH5 A;  1Q86 1;  3I56 1;  1RO2 A;  3CME 1;  2QR1 B;  1VQ7 Z;  1GPZ A;  3MZK B;  3CCE Z;  3S1N I;  2W04 A;  1TWA I;  3HOW I;  3H0G I;  2R7Z I;  5A2Q f;  2WII C;  3M3Y I;  1Y1W I;  1KQS Z;  2DE7 A;  4K12 A;  1QO6 A;  1KD1 1;  1Q81 1;  1WII A;  1X3W A;  3I4N I;  3GTK I;  5I0Q B;  4E2X A;  1QVG Z;  3CAL A;  1JJ2 Z;  2RLP A;  2NVQ I;  4A3J I;  1ELV A;  1TWC I;  2R6M A;  1TPN A;  2JR6 A;  1QYP A;  2Q51 A;  4HGZ A;  3HKZ A;  2RL0 A;  4A5W B;  2OTJ 1;  2RKZ A;  5D1O A;  2K3R A;  1S72 Z;  2RT9 A;  1VQL 1;  2VUM I;  2YRA A;  1VQ6 1;  4NBB A;  1RO4 A;  3CD6 Z;  2V8E A;  1VQM 1;  3CCQ 1;  3OW2 Z;  1Q3X A;  1YJW 1;  2JA6 I;  2RHB A;  4BY7 I;  5FLX f;  2JA8 I;  3S14 I;  3VMG A;  1Q82 1;  4PZ5 A;  1HFH A;  2YBY A;  3HOV I;  3G6E 1;  1TWH I;  2CKU A;  1H2Q P;  3CPW Z;  2V8I A;  2EGT A;  4BY1 I;  3J80 b;  3GCF A;  1K73 2;  2B5I D;  1M1K 2;  3S1Q I;  1Z92 B;  1OJY A;  4CL1 A;  3J80 f;  1YIJ Z;  2E2I I;  1OK9 A;  5T6B A;  3GKQ A;  1VQK Z;  4MD7 A;  1OJW A;  3CCR 1;  4A3D I;  1VQN Z;  1LY2 A;  3ZD1 A;  4NBC A;  1K83 I;  2KMS A;  2V8K A;  3IF8 A;  2H85 A;  2OTL 1;  3S17 I;  2QRC B;  3CCJ 1;  3FQQ A;  3CC4 1;  1M90 2;  2ZAE B;  3S1R I;  2VUG A;  4MUC A;  3CCL Z;  2NVX I;  1VQ4 1;  2LIY A;  4E32 A;  3I56 Z;  1QVF Z;  3CME Z;  4A3G I;  2NVT I;  2JGX A;  1Y1V I;  1S7M A;  2E9H A;  5HYP A;  1I50 I;  1Y1V S;  4S1T A;  2KPI A;  2E2H I;  3QWU A;  3S16 I;  4X6A I;  3CCV 1;  3NFP I;  5C3E I;  3T4N B;  1PPQ A;  4AYM A;  4MRI A;  3GTO I;  4NH1 C;  3H3V J;  4AYE A;  4E2Y A;  3CC2 Z;  1VQP 1;  1NJI 2;  1TWF I;  3O8E B;  4A3M I;  3NDI A;  2ERJ A;  3GTQ I;  3LUS A;  1KD1 2;  1Q81 2;  3I07 A;  2QEX Z;  3R62 A;  3CCM Z;  3NDJ A;  1W2B Y;  4RVD A;  3GTM I;  2OZK A;  2XWB F;  2M6N A;  3F3F C;  3GTM S;  2CG7 A;  4A3L I;  4A3B I;  1K8A 1;  1X0T A;  5A2Q b;  2M48 A;  4B2R A;  1VQL Z;  3CCS 1;  1H2P P;  2PK7 A;  3VB9 A;  3TE5 B;  1E8B A;  3TVJ A;  4MH4 A;  1VQM Z;  4IGD A;  2YAD A;  3CCQ Z;  1YJW Z;  2K5R A;  2QA4 1;  3VMI A;  5C4J I;  3MQL A;  1N8R 1;  4NB9 A;  1VQ8 1;  1CKL A;  2KI7 B;  5C44 I;  3G6E Z;  1H03 P;  3EER A;  2B63 I;  3GTG I;  1YJ9 1;  5C4X I;  2BZM A;  2GTH A;  2PM9 A;  4NBE A;  3NH4 A;  1SRZ A;  4A3C I;  3J81 f;  4WJG 2;  1NWV A;  2MCZ A;  1QUB A;  3KZJ A;  1USP A;  1YJN 1;  3CXC Y;  2GTI A;  4KKD A;  1HFI A;  4NBA A;  3ESW A;  1QF8 A;  3NH8 A;  5FLX b;  1YIT 1;  2OTL Z;  1TFI A;  3CCJ Z;  1YHQ Z;  4HH4 A;  4E2W A;  2AKL A;  2EC3 A;  3S15 I;  3PO3 I;  1E88 A;  3PO3 S;  4J38 B;  2RKY A;  3TDH B;  3L89 M;  3RZD I;  3OED C;  1H04 P;  1E5G A;  1KC8 2;  1RQF A;  1P9N A;  1FBR A;  3JAM f;  3CCV Z;  1N2F A;  1VVD A;  4MD9 A;  3KXV A;  4E33 A;  1W2B Z;  1VQP Z;  1TPG A;  2A55 A;  1Z02 A;  2RLQ A;  4A3K I;  3F3P C;  1VQO 1;  2RPR A;  3GXE A;  1PFT A;  2XRD A;  4QTU A;  1VQ9 1;  1G4G A;  3IU3 I;  1ML8 A;  1LQL A;  1YUK A;  2Y0S A;  3MON A;  4MON A;  1VVC A;  2NVY I;  3G4S 1;  2G2K A;  1L1O C;  2HF1 A;  3SW0 X;  3CMA 1;  4A3E I;  2OOX B;  2WAQ A;  1QVG Y;  1JJ2 Y;  4AYB A;  1Q86 2;  2UWN A;  1I6H I;  1S72 1;  3D9X A;  1MD7 A;  1RLY A;  2QLV B;  5LL6 f;  5T64 A;  3HOZ I;  3GTP I;  1GHQ B;  1OJV A;  4NB8 A;  3CCS Z;  4LOT A;  2JMO A;  5T67 A;  1KRL A;  2EHF A;  4DJZ A;  4Y7N I;  1G4F A;  4BBR I;  2LOJ A;  4AYI A;  3GTJ I;  3S2H I;  2HU9 A;  5D1P A;  2XRB A;  3GOV A;  1Z01 A;  1VQ8 Z;  5JPM G;  3VTN A;  1K73 1;  1NUI A;  3I55 1;  4ONT D;  1N8R 2;  1YJ9 Z;  4E31 A;  1M1K 1;  4BBS I;  2G7I A;  3OW2 Y;  3GTL I;  2RBL A;  3T5O A;  1Q7Y 1;  2IZ4 A;  3P5J B;  2F4O A;  5D1O B;  1WCM I;  3CCU 1;  4BXX I;  2JUB A;  1ZJK A;  3J7A 4;  2P3Y A;  2VF1 A;  2OTJ Z;  1VQ5 1;  4AYD A;  1YJN Z;  3PO2 I;  5FLM I;  4NOZ A;  3S2D I;  1M90 1;  2W03 A;  2QRD B;  4EWC A;  1VQ6 Z;  2KRI A;  1I3Q I;  1YIT Z;  4MXU A;  5IT9 b;  2O53 A;  4RVG A;  5IT9 f;  1RO0 A;  4FXG G;  3RJ3 D;  1OK2 A;  3ZRZ A;  1OK1 A;  1YI2 1;  4NBG A;  3FKI I;  4E30 A;  1JWH C;  4DGL A;  3OXU D;  3S1M I;  4Y52 I;  1Q82 2;  2JS4 A;  2DE6 A;  2JGW A;  4RV9 A;  3J81 b;  3G71 1;  3CC7 1;  2J6A A;  3KIF A;  1K9M 1;  1NJI 1;  1WW9 A;  2W81 A;  3INB C;  4C16 A;  1QVF Y;  1GKG A;  2JA7 I;  3I4M I;  3CC2 1;  3EJH A;  1ZH1 A;  2DE5 A;  3CQZ I;  4MD8 A;  1TWG I;  3CCR Z;  1SS2 A;  2XWJ I;  5HZP B;  1U5M A;  1VQO Z;  4CSY A;  4ZH1 D;  4DQY B;  1VQ9 Z;  2YU9 I;  1YUA A;  2JRA A;  2QEX 1;  2I3C A;  3CC4 Z;  3CCM 1;  3G4S Z;  1VQ4 Z;  2RIQ A;  3BG1 B;  3CMA Z;  2F4M A;  1VQ7 1;  3IX0 A;  3JAM b;  1MD8 A;  2JNY A;  1RNI A;  1SFO I;  2PMZ A;  3CCE 1;  3Q87 A;  4A3F I;  2QY0 A;  4RVF A;  1NP6 A;  4RS4 A;  2QKD A;  4XX2 A;  2GU2 A;  4RVH A;  1ZB9 A;  5IP7 I;  4NBF A;  1UOT P;  4HGY A;  2IZ3 A;  5HYT B;  3D6W A;  4A3I I;  1Z03 A;  4NBH A;  1R9T I;  2O4H A;  4QTT A;  3RZO I;  2Q4Z A;  3ERB A;  2OOY B;  3I55 Z;  4E2Z A;  3M4O I;  2XQW C;  1GKN A;  2MCY A;  1KQS Y;  2P28 A;  2CG6 A;  1C1Z A;  4F4O C;  5HYU B;  3CCU Z;  3OP8 A;  3MZL B;  4NBD A;  1Q7Y 2;  2O39 C;  1VQ5 Z;  3FQM A;  2R93 I;  4YNX A;  1K8A 2;  1X3Z A;  1QGB A;  2JA5 I;  4B2S A;  3CD6 1;  1YHQ 1;  1DL6 A;  1OK3 A;  3BG0 B;  4DK1 A;  5IP9 I;  3ZD2 A;  2W80 A;  3KIH A;  4TNU A;  2QA4 Z;  1KC8 1;  1O9A A;  3EED A;  1VLA A;  1YI2 Z;  3U50 C;  4A93 I;  3NFZ A;  4LOS A;  2R92 I;  3M7P A;  2QRE B;  3CXC Z;  3HOX I;  5AN9 F;  2LFU A;  3G71 Z;  3CC7 Z;  2E2J I;  1USP B;  4NFR A;  4JHS A;  3HOU I;  1HCC A;  1YIJ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...