2IZ4A

Solution structure of porcine beta-microseminoprotein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
91
structure length
91
Chain Sequence
QCYFIPNQSLKPNECQDLKGVSHPLNSVWKTKDCEECTCGQDAISCCNTAAIPTGYDTNKCQKILNKKTCTYTVVEKKDPGKTCDVTGWVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords BETA-MICROSEMINOPROTEIN
publication title Solution Structure of Human and Porcine Beta-Microseminoprotein
pubmed doi rcsb
source organism Sus scrofa
total genus 9
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05825 PSP94 Beta-microseminoprotein (PSP-94)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2iz4A01
2.20.25.590 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 2iz4A02
5JPMG 2XQWC 4C16A 3INBC 3L89M 3ZD1A 1E8BA 4K12A 1U5MA 1TPGA 3TVJA 1SRZA 2CG7A 5HYTB 3GXEA 4AYEA 2KMSA 1PPQA 3EJHA 2UWNA 2XWJI 1ELVA 2RKZA 3MQLA 3ZD2A 4YNXA 4AYMA 4CSYA 3R62A 1E5GA 1TPMA 2A55A 1H2PP 4PZ5A 5HYUB 4FXGG 1HCCA 2RKYA 1MD7A 4AYIA 1OK2A 5HYPA 1GPZA 4F4OC 5FO8C 2JRAA 5I0QB 3ERBA 4B2RA 2QY0A 4AYDA 2WIIC 1GHQB 3OXUD 1OK1A 1Z92B 2RLPA 1NWVA 2EHFA 2YBYA 3OP8A 2CG6A 2G7IA 2IZ4A 2XRDA 1GKGA 1HFIA 1O9AA 4LOSA 5HZPB 1ZJKA 3OEDC 1TPNA 1GKNA 4LOTA 4A5WB 2W81A 1H03P 1QO6A 3GOVA 3IU3I 4ZH1D 3CALA 1E88A 2RLQA 2XWBF 2IZ3A 1OJVA 1HFHA 4MUCA 1SS2A 4ONTD 2RL0A 4DJZA 2EC3A 2MCZA 3T5OA 3M7PA 3IX0A 1OK9A 2MCYA 2JGXA 1VVCA 4KKDA 1VVDA 1G4FA 3O8EB 4WJG2 3NFPI 1OK3A 2ERJA 4JHSA 3SW0X 2YRAA 1CKLA 4IGDA 2XRBA 2O39C 2V8EA 2W80A 4B2SA 1C1ZA 2KRIA 3RJ3D 3ZRZA 1G4GA 1QUBA 1UOTP 1OJYA 1FBRA 4J38B 1LY2A 1Q3XA 2CKUA 1MD8A 2BZMA 1H2QP 2JGWA 3KXVA 2B5ID 1H04P 1QGBA 1OJWA 2LOJA 3KZJA
chains in the Genus database with same CATH superfamily
1ZH1A 4DGLA 3CCUZ 1VQ71 1E8BA 1I6HI 4K12A 1U5MA 2JA6I 5A2Qb 1YHQZ 1SRZA 2Y0SA 1JJ2Z 3GTPI 3G4S1 2F4MA 4RVFA 2NVXI 1JWHC 2WAQA 1Z01A 4CL1A 1PPQA 1VQK1 1M901 2LEXA 3U50C 1VQPZ 3S16I 1TPMA 2GU2A 5AN9F 2ZYCA 4FXGG 1YIJZ 1TWGI 2EGTA 2M6NA 1HCCA 3D9XA 2VPYA 4EWCA 3HOZI 3K3TA 4BBSI 4NOZA 1Q812 1VLAA 3CMA1 1LQLA 1S7MA 3CCE1 4NBBA 3CCR1 2I2LA 2M48A 2YBYA 2P28A 4MD7A 2GTIA 2IZ4A 5IP9I 4TNUA 3PO3I 3CC21 1VQ81 1S721 1ZJKA 4A3CI 2QLVB 3I551 4LOTA 2JIMA 1YJWZ 1L1OC 5FLMI 1QO6A 3FKII 3GOVA 3G711 2GTHA 4A3II 2JA8I 4N7EA 2AYDA 3RZDI 3CCV1 1USPB 1K9M2 1HFHA 1KC81 3J81f 2RL0A 2EC3A 4MRIA 3H3VJ 2ZAEB 5DN4A 1VVDA 1KQSY 1QVFY 3PO3S 1TWHI 1QXFA 4A3LI 3VWOA 3CMEZ 2RPRA 3GTGI 1CKLA 1M1K2 3KIHA 3CC7Z 3ZLEA 4IGDA 2OOYB 3IFUA 2R7ZI 3OW2Z 1TWCI 3HKZA 3I07A 2OTL1 2E2II 2LIYA 3HOYI 1USPA 1I50I 1K8A2 3S17I 2K3RA 1VQNZ 2W04A 3GTKI 1FBRA 3Q87A 5IT9b 1K731 1Q862 1WJ2A 4RVDA 4BWCA 1K83I 1QGBA 3VTNA 1N8R2 1NJI2 1ELVA 1YIT1 3NDIA 1RO4A 4MH4A 4HH4A 4C16A 4A3DI 3NDJA 3L89M 3CI0J 1VQOZ 5HYTB 1VQL1 4E2YA 3FQQA 1ZB9A 5FLXf 3FGRA 3CCJZ 2JIQA 1DL6A 4QTUA 3S2DI 3MQLA 3CCL1 1E5GA 2QKDA 4PZ5A 1NP6A 3MONA 3G6E1 2JIOA 2PMZA 3GTLI 2QEXZ 3OW2Y 3D6WA 1YJNZ 1OK2A 4NB9A 1GPZA 3WSYA 4MXUA 2JRAA 5I0QB 3ESWA 3ERBA 4B2RA 2QY0A 4AYDA 2JA5I 3CCS1 1Z92B 5C4JI 1VQ7Z 2RLPA 3J80b 2NVQI 3P5JB 2R92I 2PK7A 1M902 4QTTA 2CG6A 5IP7I 2V45A 3IF8A 5T64A 1O9AA 3G4SZ 3NH4A 1YJ91 3OEDC 1X3WA 1VQ9Z 3JAMf 1GKNA 1WIIA 1KQSZ 2JIPA 1QVFZ 4E33A 1Y1VI 2QR1B 3IU3I 3CCM1 4NBEA 4ZH1D 4BBRI 1I3QI 2Y8SA 3CALA 3VMHA 2RLQA 2XWBF 4X6AI 4PO7A 1Q16A 1QF8A 4MUCA 1SS2A 4ONTD 3S14I 2MCZA 3T5OA 1RO2A 3CMAZ 2VPZA 4KKDA 3CD61 3FGTA 3CCEZ 3NFPI 2ERJA 3SW0X 4XX2A 2YRAA 2JUBA 1VQ51 2PM9A 3FQMA 1TWFI 2OZKA 2XRBA 1YI2Z 2O39C 4BXXI 2W80A 1Y1VS 1C1ZA 3J7A4 2V8JA 1G4GA 1VQ8Z 1S72Z 2DE7A 2K5RA 1YJW1 1UOTP 3I55Z 4A3MI 3VMIA 2CKUA 1VQMZ 2OTJZ 2BZMA 1H2QP 1WCMI 1KC82 3MZLB 1H04P 3I561 5D1PA 2R6MA 5T67A 1OJWA 2LOJA 3KZJA 3GTMS 3CXCZ 2XQWC 3CCVZ 2JNYA 2Q4ZA 4NFRA 1W2BY 2YU9I 4E2WA 1RLYA 2JA7I 4NB8A 2BJOA 3TVJA 4S1TA 3F6KA 3KIFA 1QVGY 4DQYB 3EEDA 2V8IA 1K9M1 2V3VA 1Y8CA 3CCQ1 3NJAA 3CC71 2XWJI 1K732 4Y7NI 3ZD2A 4YNXA 4CSYA 3S2HI 1VQ61 3J81b 3BG1B 1Q821 1Q7Y1 2A55A 1H2PP 2OOXB 4RV9A 3T4NB 1R9TI 4E31A 2P3YA 4A3EI 2JIRA 2X2ZA 2JMOA 4MONA 1P9NA 2QA41 2QREB 3HOXI 5HYPA 1ML8A 1K8A1 5FO8C 3CC41 1YITZ 3WSXA 2H85A 3MZKB 1GHQB 4A3FI 3OXUD 3F3FC 4NH1C 1TWAI 3EERA 4BY7I 3IR7A 5C4XI 1KD12 1AA6A 4Y52I 4A3KI 2XRDA 1GKGA 3CXCY 4LOSA 3S1RI 2QRCB 1VQ41 5HZPB 1KRLA 4NBGA 2JS4A 4E30A 1VQLZ 2KI7B 4RVHA 3D2LA 4MSLA 2O4HA 2AKLA 2RIQA 5A2Qf 2W81A 1NUIA 1Z02A 2J6AA 1SFOI 3CCLZ 1N2FA 3M3YI 4A93I 3NFZA 3G6EZ 4NBFA 2E9HA 5FLXb 1RLHA 1RQFA 3CCU1 2IV2X 3S1QI 3HOVI 4NBDA 4DJZA 1YHQ1 3M7PA 2VF1A 1OK9A 2MCYA 2JGXA 4A3BI 1RNIA 3VB9A 3CCSZ 1G4FA 3S1NI 4WJG2 4RVGA 1Y1WI 3M4OI 2RHBA 1VQKZ 1QYPA 4YIZA 1W2BZ 2F4OA 1VQP1 1ZB8A 3RJ3D 5C3EI 3ZRZA 2HF1A 4BY1I 3CPWZ 5T6BA 1VQ91 1YIJ1 5D1OA 1QUBA 1YJ9Z 2O53A 3F3PC 1QVGZ 1OJYA 4J38B 1LY2A 1Q3XA 4E2XA 1MD8A 3S15I 3CCMZ 1X3ZA 3GTMI 3HOWI 3LUSA 2G2KA 4JHSA 5JPMG 2NVTI 3PO2I 3ZLDA 3INBC 2LFUA 3NH8A 2NVYI 3NH5A 3CCRZ 3ZD1A 1PFTA 3TE5B 3JAMb 4NBHA 2B63I 1TPGA 1Q811 2CG7A 3GXEA 3VMGA 3CC2Z 4AYEA 3CD6Z 2KMSA 2RBLA 3GTQI 3EJHA 2UWNA 4E32A 1YUKA 5DN5A 1VQ5Z 2RKZA 1YI21 2Q51A 4AYMA 3R62A 1TFIA 3G71Z 3CQZI 4NBCA 5HYUB 3GTOI 2RKYA 4NBAA 4RS4A 1VQM1 1JJ2Y 2OTJ1 3S1MI 1MD7A 4AYIA 2E7ZA 2VUGA 2VPXA 3HOUI 3K7AI 3I56Z 3CPWY 4F4OC 2KPIA 2VUMI 2Y8RA 3H0GI 3TDHB 2WIIC 5CM2M 1OK1A 5IT9f 2E2JI 3CME1 1NWVA 2EHFA 2I3CA 3OP8A 2YADA 2G7IA 2V8KA 4HGYA 1HFIA 4A3GI 1Q822 1Q7Y2 4AYBA 2OTLZ 3CCQZ 1TPNA 1VQN1 5C44I 1M1K1 4A5WB 2QRDB 1H03P 1RO0A 3GTJI 1VQ6Z 1E88A 2VPWA 3QWUA 2IZ3A 1WW9A 2DE6A 3GCFA 1Q861 3RZOI 1WZNA 1OJVA 3GKQA 2R93I 2QA4Z 1N8R1 1NJI1 1VQO1 4A3JI 3IX0A 1VVCA 3I4MI 4MD9A 4E2ZA 2E2HI 4APLA 2HU9A 3CC4Z 2NAPA 2W03A 1FDIA 3O8EB 1Z03A 2RT9A 3CCJ1 1OK3A 2DE5A 4MD8A 2WB1A 4DK1A 3I4NI 2Y8TA 2V8EA 4B2SA 2KRIA 1YUAA 3BG0B 1VQ4Z 1X0TA 1SIWA 1KD11 3J80f 2QEX1 4HGZA 1FDOA 5LL6f 2JR6A 5D1OB 2JGWA 3KXVA 1YJN1 2B5ID
chains in the Genus database with same CATH topology
1ZH1A 4DGLA 3CCUZ 1VQ71 1E8BA 1I6HI 4K12A 1U5MA 2JA6I 5A2Qb 1YHQZ 1SRZA 2Y0SA 1JJ2Z 3GTPI 3G4S1 2F4MA 4RVFA 2NVXI 1JWHC 2WAQA 1Z01A 4CL1A 1PPQA 1VQK1 1M901 3U50C 1VQPZ 3S16I 1TPMA 2GU2A 5AN9F 4FXGG 1YIJZ 1TWGI 2EGTA 2M6NA 1HCCA 3D9XA 4EWCA 3HOZI 4BBSI 4NOZA 1Q812 1VLAA 3CMA1 1LQLA 1S7MA 3CCE1 4NBBA 3CCR1 2M48A 2YBYA 2P28A 4MD7A 2GTIA 2IZ4A 5IP9I 4TNUA 3PO3I 3CC21 1VQ81 1S721 1ZJKA 4A3CI 2QLVB 3I551 4LOTA 1YJWZ 1L1OC 5FLMI 1QO6A 3FKII 3GOVA 3G711 2GTHA 4A3II 2JA8I 3RZDI 3CCV1 1USPB 1K9M2 1HFHA 1KC81 3J81f 2RL0A 2EC3A 4MRIA 3H3VJ 2ZAEB 1VVDA 1KQSY 1QVFY 3PO3S 1TWHI 4A3LI 3CMEZ 2RPRA 3GTGI 1CKLA 1M1K2 3KIHA 3CC7Z 4IGDA 2OOYB 3IFUA 2R7ZI 3OW2Z 1TWCI 3HKZA 3I07A 2OTL1 2E2II 2LIYA 3HOYI 1USPA 1I50I 1K8A2 3S17I 2K3RA 1VQNZ 2W04A 3GTKI 1FBRA 3Q87A 5IT9b 1K731 1Q862 4RVDA 1K83I 1QGBA 3VTNA 1N8R2 1NJI2 1ELVA 1YIT1 3NDIA 1RO4A 4MH4A 4HH4A 4C16A 4A3DI 3NDJA 3L89M 1VQOZ 5HYTB 1VQL1 4E2YA 3FQQA 1ZB9A 5FLXf 3CCJZ 1DL6A 4QTUA 3S2DI 3MQLA 3CCL1 1E5GA 2QKDA 4PZ5A 1NP6A 3MONA 3G6E1 2PMZA 3GTLI 2QEXZ 3OW2Y 3D6WA 1YJNZ 1OK2A 4NB9A 1GPZA 4MXUA 2JRAA 5I0QB 3ESWA 3ERBA 4B2RA 2QY0A 4AYDA 2JA5I 3CCS1 1Z92B 5C4JI 1VQ7Z 2RLPA 3J80b 2NVQI 3P5JB 2R92I 2PK7A 1M902 4QTTA 2CG6A 5IP7I 3IF8A 5T64A 1O9AA 3G4SZ 3NH4A 1YJ91 3OEDC 1X3WA 1VQ9Z 3JAMf 1GKNA 1WIIA 1KQSZ 1QVFZ 4E33A 1Y1VI 2QR1B 3IU3I 3CCM1 4NBEA 4ZH1D 4BBRI 1I3QI 3CALA 3VMHA 2RLQA 2XWBF 4X6AI 1QF8A 4MUCA 1SS2A 4ONTD 3S14I 2MCZA 3T5OA 1RO2A 3CMAZ 4KKDA 3CD61 3CCEZ 3NFPI 2ERJA 3SW0X 4XX2A 2YRAA 2JUBA 1VQ51 2PM9A 3FQMA 1TWFI 2OZKA 2XRBA 1YI2Z 2O39C 4BXXI 2W80A 1Y1VS 1C1ZA 3J7A4 2V8JA 1G4GA 1VQ8Z 1S72Z 2DE7A 2K5RA 1YJW1 1UOTP 3I55Z 4A3MI 3VMIA 2CKUA 1VQMZ 2OTJZ 2BZMA 1H2QP 1WCMI 1KC82 3MZLB 1H04P 3I561 5D1PA 2R6MA 5T67A 1OJWA 2LOJA 3KZJA 3GTMS 3CXCZ 2XQWC 3CCVZ 2JNYA 2Q4ZA 4NFRA 1W2BY 2YU9I 4E2WA 1RLYA 2JA7I 4NB8A 2BJOA 3TVJA 4S1TA 3KIFA 1QVGY 4DQYB 3EEDA 2V8IA 1K9M1 3CCQ1 3CC71 2XWJI 1K732 4Y7NI 3ZD2A 4YNXA 4CSYA 3S2HI 1VQ61 3J81b 3BG1B 1Q821 1Q7Y1 2A55A 1H2PP 2OOXB 4RV9A 3T4NB 1R9TI 4E31A 2P3YA 4A3EI 2JMOA 4MONA 1P9NA 2QA41 2QREB 3HOXI 5HYPA 1ML8A 1K8A1 5FO8C 3CC41 1YITZ 2H85A 3MZKB 1GHQB 4A3FI 3OXUD 3F3FC 4NH1C 1TWAI 3EERA 4BY7I 5C4XI 4Y52I 1KD12 4A3KI 2XRDA 1GKGA 3CXCY 4LOSA 3S1RI 2QRCB 1VQ41 5HZPB 1KRLA 4NBGA 2JS4A 4E30A 1VQLZ 2KI7B 4RVHA 2O4HA 2AKLA 2RIQA 5A2Qf 2W81A 1NUIA 1Z02A 2J6AA 1SFOI 3CCLZ 1N2FA 3M3YI 4A93I 3NFZA 3G6EZ 4NBFA 2E9HA 5FLXb 1RQFA 3CCU1 3S1QI 3HOVI 4NBDA 4DJZA 1YHQ1 3M7PA 2VF1A 1OK9A 2MCYA 2JGXA 4A3BI 1RNIA 3VB9A 3CCSZ 1G4FA 3S1NI 4WJG2 4RVGA 1Y1WI 3M4OI 2RHBA 1VQKZ 1QYPA 1W2BZ 2F4OA 1VQP1 1ZB8A 3RJ3D 5C3EI 3ZRZA 2HF1A 4BY1I 3CPWZ 5T6BA 1VQ91 1YIJ1 5D1OA 1QUBA 1YJ9Z 2O53A 3F3PC 1QVGZ 1OJYA 4J38B 1LY2A 1Q3XA 4E2XA 1MD8A 3S15I 3CCMZ 1X3ZA 3GTMI 3HOWI 3LUSA 2G2KA 4JHSA 5JPMG 2NVTI 3PO2I 3INBC 2LFUA 3NH8A 2NVYI 3NH5A 3CCRZ 3ZD1A 1PFTA 3TE5B 3JAMb 4NBHA 2B63I 1TPGA 1Q811 2CG7A 3GXEA 3VMGA 3CC2Z 4AYEA 3CD6Z 2KMSA 2RBLA 3GTQI 3EJHA 2UWNA 4E32A 1YUKA 1VQ5Z 2RKZA 1YI21 2Q51A 4AYMA 3R62A 1TFIA 3G71Z 3CQZI 4NBCA 5HYUB 3GTOI 2RKYA 4NBAA 4RS4A 1VQM1 1JJ2Y 2OTJ1 3S1MI 1MD7A 4AYIA 2VUGA 3HOUI 3K7AI 3I56Z 3CPWY 4F4OC 2KPIA 2VUMI 3H0GI 3TDHB 2WIIC 5CM2M 1OK1A 5IT9f 2E2JI 3CME1 1NWVA 2EHFA 2I3CA 3OP8A 2YADA 2G7IA 2V8KA 4HGYA 1HFIA 4A3GI 1Q822 1Q7Y2 4AYBA 2OTLZ 3CCQZ 1TPNA 1VQN1 5C44I 1M1K1 4A5WB 2QRDB 1H03P 1RO0A 3GTJI 1VQ6Z 1E88A 3QWUA 2IZ3A 1WW9A 2DE6A 3GCFA 1Q861 3RZOI 1OJVA 3GKQA 2R93I 2QA4Z 1N8R1 1NJI1 1VQO1 4A3JI 3IX0A 1VVCA 3I4MI 4MD9A 4E2ZA 2E2HI 2HU9A 3CC4Z 2W03A 3O8EB 1Z03A 2RT9A 3CCJ1 1OK3A 2DE5A 4MD8A 2WB1A 4DK1A 3I4NI 2V8EA 4B2SA 2KRIA 1YUAA 3BG0B 1VQ4Z 1X0TA 1KD11 3J80f 2QEX1 4HGZA 5LL6f 2JR6A 5D1OB 2JGWA 3KXVA 1YJN1 2B5ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPM G;  2XQW C;  4C16 A;  3INB C;  3L89 M;  3ZD1 A;  1E8B A;  4K12 A;  1U5M A;  1TPG A;  3TVJ A;  1SRZ A;  2CG7 A;  5HYT B;  3GXE A;  4AYE A;  2KMS A;  1PPQ A;  3EJH A;  2UWN A;  2XWJ I;  1ELV A;  2RKZ A;  3MQL A;  3ZD2 A;  4YNX A;  4AYM A;  4CSY A;  3R62 A;  1E5G A;  1TPM A;  2A55 A;  1H2P P;  4PZ5 A;  5HYU B;  4FXG G;  1HCC A;  2RKY A;  1MD7 A;  4AYI A;  1OK2 A;  5HYP A;  1GPZ A;  4F4O C;  5FO8 C;  2JRA A;  5I0Q B;  3ERB A;  4B2R A;  2QY0 A;  4AYD A;  2WII C;  1GHQ B;  3OXU D;  1OK1 A;  1Z92 B;  2RLP A;  1NWV A;  2EHF A;  2YBY A;  3OP8 A;  2CG6 A;  2G7I A;  2IZ4 A;  2XRD A;  1GKG A;  1HFI A;  1O9A A;  4LOS A;  5HZP B;  1ZJK A;  3OED C;  1TPN A;  1GKN A;  4LOT A;  4A5W B;  2W81 A;  1H03 P;  1QO6 A;  3GOV A;  3IU3 I;  4ZH1 D;  3CAL A;  1E88 A;  2RLQ A;  2XWB F;  2IZ3 A;  1OJV A;  1HFH A;  4MUC A;  1SS2 A;  4ONT D;  2RL0 A;  4DJZ A;  2EC3 A;  2MCZ A;  3T5O A;  3M7P A;  3IX0 A;  1OK9 A;  2MCY A;  2JGX A;  1VVC A;  4KKD A;  1VVD A;  1G4F A;  3O8E B;  4WJG 2;  3NFP I;  1OK3 A;  2ERJ A;  4JHS A;  3SW0 X;  2YRA A;  1CKL A;  4IGD A;  2XRB A;  2O39 C;  2V8E A;  2W80 A;  4B2S A;  1C1Z A;  2KRI A;  3RJ3 D;  3ZRZ A;  1G4G A;  1QUB A;  1UOT P;  1OJY A;  1FBR A;  4J38 B;  1LY2 A;  1Q3X A;  2CKU A;  1MD8 A;  2BZM A;  1H2Q P;  2JGW A;  3KXV A;  2B5I D;  1H04 P;  1QGB A;  1OJW A;  2LOJ A;  3KZJ A; 
#chains in the Genus database with same CATH topology
 1ZH1 A;  4DGL A;  3CCU Z;  1VQ7 1;  1E8B A;  1I6H I;  4K12 A;  1U5M A;  2JA6 I;  5A2Q b;  1YHQ Z;  1SRZ A;  2Y0S A;  1JJ2 Z;  3GTP I;  3G4S 1;  2F4M A;  4RVF A;  2NVX I;  1JWH C;  2WAQ A;  1Z01 A;  4CL1 A;  1PPQ A;  1VQK 1;  1M90 1;  2LEX A;  3U50 C;  1VQP Z;  3S16 I;  1TPM A;  2GU2 A;  5AN9 F;  2ZYC A;  4FXG G;  1YIJ Z;  1TWG I;  2EGT A;  2M6N A;  1HCC A;  3D9X A;  2VPY A;  4EWC A;  3HOZ I;  3K3T A;  4BBS I;  4NOZ A;  1Q81 2;  1VLA A;  3CMA 1;  1LQL A;  1S7M A;  3CCE 1;  4NBB A;  3CCR 1;  2I2L A;  2M48 A;  2YBY A;  2P28 A;  4MD7 A;  2GTI A;  2IZ4 A;  5IP9 I;  4TNU A;  3PO3 I;  3CC2 1;  1VQ8 1;  1S72 1;  1ZJK A;  4A3C I;  2QLV B;  3I55 1;  4LOT A;  2JIM A;  1YJW Z;  1L1O C;  5FLM I;  1QO6 A;  3FKI I;  3GOV A;  3G71 1;  2GTH A;  4A3I I;  2JA8 I;  4N7E A;  2AYD A;  3RZD I;  3CCV 1;  1USP B;  1K9M 2;  1HFH A;  1KC8 1;  3J81 f;  2RL0 A;  2EC3 A;  4MRI A;  3H3V J;  2ZAE B;  5DN4 A;  1VVD A;  1KQS Y;  1QVF Y;  3PO3 S;  1TWH I;  1QXF A;  4A3L I;  3VWO A;  3CME Z;  2RPR A;  3GTG I;  1CKL A;  1M1K 2;  3KIH A;  3CC7 Z;  3ZLE A;  4IGD A;  2OOY B;  3IFU A;  2R7Z I;  3OW2 Z;  1TWC I;  3HKZ A;  3I07 A;  2OTL 1;  2E2I I;  2LIY A;  3HOY I;  1USP A;  1I50 I;  1K8A 2;  3S17 I;  2K3R A;  1VQN Z;  2W04 A;  3GTK I;  1FBR A;  3Q87 A;  5IT9 b;  1K73 1;  1Q86 2;  1WJ2 A;  4RVD A;  4BWC A;  1K83 I;  1QGB A;  3VTN A;  1N8R 2;  1NJI 2;  1ELV A;  1YIT 1;  3NDI A;  1RO4 A;  4MH4 A;  4HH4 A;  4C16 A;  4A3D I;  3NDJ A;  3L89 M;  3CI0 J;  1VQO Z;  5HYT B;  1VQL 1;  4E2Y A;  3FQQ A;  1ZB9 A;  5FLX f;  3FGR A;  3CCJ Z;  2JIQ A;  1DL6 A;  4QTU A;  3S2D I;  3MQL A;  3CCL 1;  1E5G A;  2QKD A;  4PZ5 A;  1NP6 A;  3MON A;  3G6E 1;  2JIO A;  2PMZ A;  3GTL I;  2QEX Z;  3OW2 Y;  3D6W A;  1YJN Z;  1OK2 A;  4NB9 A;  1GPZ A;  3WSY A;  4MXU A;  2JRA A;  5I0Q B;  3ESW A;  3ERB A;  4B2R A;  2QY0 A;  4AYD A;  2JA5 I;  3CCS 1;  1Z92 B;  5C4J I;  1VQ7 Z;  2RLP A;  3J80 b;  2NVQ I;  3P5J B;  2R92 I;  2PK7 A;  1M90 2;  4QTT A;  2CG6 A;  5IP7 I;  2V45 A;  3IF8 A;  5T64 A;  1O9A A;  3G4S Z;  3NH4 A;  1YJ9 1;  3OED C;  1X3W A;  1VQ9 Z;  3JAM f;  1GKN A;  1WII A;  1KQS Z;  2JIP A;  1QVF Z;  4E33 A;  1Y1V I;  2QR1 B;  3IU3 I;  3CCM 1;  4NBE A;  4ZH1 D;  4BBR I;  1I3Q I;  2Y8S A;  3CAL A;  3VMH A;  2RLQ A;  2XWB F;  4X6A I;  4PO7 A;  1Q16 A;  1QF8 A;  4MUC A;  1SS2 A;  4ONT D;  3S14 I;  2MCZ A;  3T5O A;  1RO2 A;  3CMA Z;  2VPZ A;  4KKD A;  3CD6 1;  3FGT A;  3CCE Z;  3NFP I;  2ERJ A;  3SW0 X;  4XX2 A;  2YRA A;  2JUB A;  1VQ5 1;  2PM9 A;  3FQM A;  1TWF I;  2OZK A;  2XRB A;  1YI2 Z;  2O39 C;  4BXX I;  2W80 A;  1Y1V S;  1C1Z A;  3J7A 4;  2V8J A;  1G4G A;  1VQ8 Z;  1S72 Z;  2DE7 A;  2K5R A;  1YJW 1;  1UOT P;  3I55 Z;  4A3M I;  3VMI A;  2CKU A;  1VQM Z;  2OTJ Z;  2BZM A;  1H2Q P;  1WCM I;  1KC8 2;  3MZL B;  1H04 P;  3I56 1;  5D1P A;  2R6M A;  5T67 A;  1OJW A;  2LOJ A;  3KZJ A;  3GTM S;  3CXC Z;  2XQW C;  3CCV Z;  2JNY A;  2Q4Z A;  4NFR A;  1W2B Y;  2YU9 I;  4E2W A;  1RLY A;  2JA7 I;  4NB8 A;  2BJO A;  3TVJ A;  4S1T A;  3F6K A;  3KIF A;  1QVG Y;  4DQY B;  3EED A;  2V8I A;  1K9M 1;  2V3V A;  1Y8C A;  3CCQ 1;  3NJA A;  3CC7 1;  2XWJ I;  1K73 2;  4Y7N I;  3ZD2 A;  4YNX A;  4CSY A;  3S2H I;  1VQ6 1;  3J81 b;  3BG1 B;  1Q82 1;  1Q7Y 1;  2A55 A;  1H2P P;  2OOX B;  4RV9 A;  3T4N B;  1R9T I;  4E31 A;  2P3Y A;  4A3E I;  2JIR A;  2X2Z A;  2JMO A;  4MON A;  1P9N A;  2QA4 1;  2QRE B;  3HOX I;  5HYP A;  1ML8 A;  1K8A 1;  5FO8 C;  3CC4 1;  1YIT Z;  3WSX A;  2H85 A;  3MZK B;  1GHQ B;  4A3F I;  3OXU D;  3F3F C;  4NH1 C;  1TWA I;  3EER A;  4BY7 I;  3IR7 A;  5C4X I;  1KD1 2;  1AA6 A;  4Y52 I;  4A3K I;  2XRD A;  1GKG A;  3CXC Y;  4LOS A;  3S1R I;  2QRC B;  1VQ4 1;  5HZP B;  1KRL A;  4NBG A;  2JS4 A;  4E30 A;  1VQL Z;  2KI7 B;  4RVH A;  3D2L A;  4MSL A;  2O4H A;  2AKL A;  2RIQ A;  5A2Q f;  2W81 A;  1NUI A;  1Z02 A;  2J6A A;  1SFO I;  3CCL Z;  1N2F A;  3M3Y I;  4A93 I;  3NFZ A;  3G6E Z;  4NBF A;  2E9H A;  5FLX b;  1RLH A;  1RQF A;  3CCU 1;  2IV2 X;  3S1Q I;  3HOV I;  4NBD A;  4DJZ A;  1YHQ 1;  3M7P A;  2VF1 A;  1OK9 A;  2MCY A;  2JGX A;  4A3B I;  1RNI A;  3VB9 A;  3CCS Z;  1G4F A;  3S1N I;  4WJG 2;  4RVG A;  1Y1W I;  3M4O I;  2RHB A;  1VQK Z;  1QYP A;  4YIZ A;  1W2B Z;  2F4O A;  1VQP 1;  1ZB8 A;  3RJ3 D;  5C3E I;  3ZRZ A;  2HF1 A;  4BY1 I;  3CPW Z;  5T6B A;  1VQ9 1;  1YIJ 1;  5D1O A;  1QUB A;  1YJ9 Z;  2O53 A;  3F3P C;  1QVG Z;  1OJY A;  4J38 B;  1LY2 A;  1Q3X A;  4E2X A;  1MD8 A;  3S15 I;  3CCM Z;  1X3Z A;  3GTM I;  3HOW I;  3LUS A;  2G2K A;  4JHS A;  5JPM G;  2NVT I;  3PO2 I;  3ZLD A;  3INB C;  2LFU A;  3NH8 A;  2NVY I;  3NH5 A;  3CCR Z;  3ZD1 A;  1PFT A;  3TE5 B;  3JAM b;  4NBH A;  2B63 I;  1TPG A;  1Q81 1;  2CG7 A;  3GXE A;  3VMG A;  3CC2 Z;  4AYE A;  3CD6 Z;  2KMS A;  2RBL A;  3GTQ I;  3EJH A;  2UWN A;  4E32 A;  1YUK A;  5DN5 A;  1VQ5 Z;  2RKZ A;  1YI2 1;  2Q51 A;  4AYM A;  3R62 A;  1TFI A;  3G71 Z;  3CQZ I;  4NBC A;  5HYU B;  3GTO I;  2RKY A;  4NBA A;  4RS4 A;  1VQM 1;  1JJ2 Y;  2OTJ 1;  3S1M I;  1MD7 A;  4AYI A;  2E7Z A;  2VUG A;  2VPX A;  3HOU I;  3K7A I;  3I56 Z;  3CPW Y;  4F4O C;  2KPI A;  2VUM I;  2Y8R A;  3H0G I;  3TDH B;  2WII C;  5CM2 M;  1OK1 A;  5IT9 f;  2E2J I;  3CME 1;  1NWV A;  2EHF A;  2I3C A;  3OP8 A;  2YAD A;  2G7I A;  2V8K A;  4HGY A;  1HFI A;  4A3G I;  1Q82 2;  1Q7Y 2;  4AYB A;  2OTL Z;  3CCQ Z;  1TPN A;  1VQN 1;  5C44 I;  1M1K 1;  4A5W B;  2QRD B;  1H03 P;  1RO0 A;  3GTJ I;  1VQ6 Z;  1E88 A;  2VPW A;  3QWU A;  2IZ3 A;  1WW9 A;  2DE6 A;  3GCF A;  1Q86 1;  3RZO I;  1WZN A;  1OJV A;  3GKQ A;  2R93 I;  2QA4 Z;  1N8R 1;  1NJI 1;  1VQO 1;  4A3J I;  3IX0 A;  1VVC A;  3I4M I;  4MD9 A;  4E2Z A;  2E2H I;  4APL A;  2HU9 A;  3CC4 Z;  2NAP A;  2W03 A;  1FDI A;  3O8E B;  1Z03 A;  2RT9 A;  3CCJ 1;  1OK3 A;  2DE5 A;  4MD8 A;  2WB1 A;  4DK1 A;  3I4N I;  2Y8T A;  2V8E A;  4B2S A;  2KRI A;  1YUA A;  3BG0 B;  1VQ4 Z;  1X0T A;  1SIW A;  1KD1 1;  3J80 f;  2QEX 1;  4HGZ A;  1FDO A;  5LL6 f;  2JR6 A;  5D1O B;  2JGW A;  3KXV A;  1YJN 1;  2B5I D; 
#chains in the Genus database with same CATH homology
 1ZH1 A;  4DGL A;  3CCU Z;  1VQ7 1;  1E8B A;  1I6H I;  4K12 A;  1U5M A;  2JA6 I;  5A2Q b;  1YHQ Z;  1SRZ A;  2Y0S A;  1JJ2 Z;  3GTP I;  3G4S 1;  2F4M A;  4RVF A;  2NVX I;  1JWH C;  2WAQ A;  1Z01 A;  4CL1 A;  1PPQ A;  1VQK 1;  1M90 1;  3U50 C;  1VQP Z;  3S16 I;  1TPM A;  2GU2 A;  5AN9 F;  4FXG G;  1YIJ Z;  1TWG I;  2EGT A;  2M6N A;  1HCC A;  3D9X A;  4EWC A;  3HOZ I;  4BBS I;  4NOZ A;  1Q81 2;  1VLA A;  3CMA 1;  1LQL A;  1S7M A;  3CCE 1;  4NBB A;  3CCR 1;  2M48 A;  2YBY A;  2P28 A;  4MD7 A;  2GTI A;  2IZ4 A;  5IP9 I;  4TNU A;  3PO3 I;  3CC2 1;  1VQ8 1;  1S72 1;  1ZJK A;  4A3C I;  2QLV B;  3I55 1;  4LOT A;  1YJW Z;  1L1O C;  5FLM I;  1QO6 A;  3FKI I;  3GOV A;  3G71 1;  2GTH A;  4A3I I;  2JA8 I;  3RZD I;  3CCV 1;  1USP B;  1K9M 2;  1HFH A;  1KC8 1;  3J81 f;  2RL0 A;  2EC3 A;  4MRI A;  3H3V J;  2ZAE B;  1VVD A;  1KQS Y;  1QVF Y;  3PO3 S;  1TWH I;  4A3L I;  3CME Z;  2RPR A;  3GTG I;  1CKL A;  1M1K 2;  3KIH A;  3CC7 Z;  4IGD A;  2OOY B;  3IFU A;  2R7Z I;  3OW2 Z;  1TWC I;  3HKZ A;  3I07 A;  2OTL 1;  2E2I I;  2LIY A;  3HOY I;  1USP A;  1I50 I;  1K8A 2;  3S17 I;  2K3R A;  1VQN Z;  2W04 A;  3GTK I;  1FBR A;  3Q87 A;  5IT9 b;  1K73 1;  1Q86 2;  4RVD A;  1K83 I;  1QGB A;  3VTN A;  1N8R 2;  1NJI 2;  1ELV A;  1YIT 1;  3NDI A;  1RO4 A;  4MH4 A;  4HH4 A;  4C16 A;  4A3D I;  3NDJ A;  3L89 M;  1VQO Z;  5HYT B;  1VQL 1;  4E2Y A;  3FQQ A;  1ZB9 A;  5FLX f;  3CCJ Z;  1DL6 A;  4QTU A;  3S2D I;  3MQL A;  3CCL 1;  1E5G A;  2QKD A;  4PZ5 A;  1NP6 A;  3MON A;  3G6E 1;  2PMZ A;  3GTL I;  2QEX Z;  3OW2 Y;  3D6W A;  1YJN Z;  1OK2 A;  4NB9 A;  1GPZ A;  4MXU A;  2JRA A;  5I0Q B;  3ESW A;  3ERB A;  4B2R A;  2QY0 A;  4AYD A;  2JA5 I;  3CCS 1;  1Z92 B;  5C4J I;  1VQ7 Z;  2RLP A;  3J80 b;  2NVQ I;  3P5J B;  2R92 I;  2PK7 A;  1M90 2;  4QTT A;  2CG6 A;  5IP7 I;  3IF8 A;  5T64 A;  1O9A A;  3G4S Z;  3NH4 A;  1YJ9 1;  3OED C;  1X3W A;  1VQ9 Z;  3JAM f;  1GKN A;  1WII A;  1KQS Z;  1QVF Z;  4E33 A;  1Y1V I;  2QR1 B;  3IU3 I;  3CCM 1;  4NBE A;  4ZH1 D;  4BBR I;  1I3Q I;  3CAL A;  3VMH A;  2RLQ A;  2XWB F;  4X6A I;  1QF8 A;  4MUC A;  1SS2 A;  4ONT D;  3S14 I;  2MCZ A;  3T5O A;  1RO2 A;  3CMA Z;  4KKD A;  3CD6 1;  3CCE Z;  3NFP I;  2ERJ A;  3SW0 X;  4XX2 A;  2YRA A;  2JUB A;  1VQ5 1;  2PM9 A;  3FQM A;  1TWF I;  2OZK A;  2XRB A;  1YI2 Z;  2O39 C;  4BXX I;  2W80 A;  1Y1V S;  1C1Z A;  3J7A 4;  2V8J A;  1G4G A;  1VQ8 Z;  1S72 Z;  2DE7 A;  2K5R A;  1YJW 1;  1UOT P;  3I55 Z;  4A3M I;  3VMI A;  2CKU A;  1VQM Z;  2OTJ Z;  2BZM A;  1H2Q P;  1WCM I;  1KC8 2;  3MZL B;  1H04 P;  3I56 1;  5D1P A;  2R6M A;  5T67 A;  1OJW A;  2LOJ A;  3KZJ A;  3GTM S;  3CXC Z;  2XQW C;  3CCV Z;  2JNY A;  2Q4Z A;  4NFR A;  1W2B Y;  2YU9 I;  4E2W A;  1RLY A;  2JA7 I;  4NB8 A;  2BJO A;  3TVJ A;  4S1T A;  3KIF A;  1QVG Y;  4DQY B;  3EED A;  2V8I A;  1K9M 1;  3CCQ 1;  3CC7 1;  2XWJ I;  1K73 2;  4Y7N I;  3ZD2 A;  4YNX A;  4CSY A;  3S2H I;  1VQ6 1;  3J81 b;  3BG1 B;  1Q82 1;  1Q7Y 1;  2A55 A;  1H2P P;  2OOX B;  4RV9 A;  3T4N B;  1R9T I;  4E31 A;  2P3Y A;  4A3E I;  2JMO A;  4MON A;  1P9N A;  2QA4 1;  2QRE B;  3HOX I;  5HYP A;  1ML8 A;  1K8A 1;  5FO8 C;  3CC4 1;  1YIT Z;  2H85 A;  3MZK B;  1GHQ B;  4A3F I;  3OXU D;  3F3F C;  4NH1 C;  1TWA I;  3EER A;  4BY7 I;  5C4X I;  4Y52 I;  1KD1 2;  4A3K I;  2XRD A;  1GKG A;  3CXC Y;  4LOS A;  3S1R I;  2QRC B;  1VQ4 1;  5HZP B;  1KRL A;  4NBG A;  2JS4 A;  4E30 A;  1VQL Z;  2KI7 B;  4RVH A;  2O4H A;  2AKL A;  2RIQ A;  5A2Q f;  2W81 A;  1NUI A;  1Z02 A;  2J6A A;  1SFO I;  3CCL Z;  1N2F A;  3M3Y I;  4A93 I;  3NFZ A;  3G6E Z;  4NBF A;  2E9H A;  5FLX b;  1RQF A;  3CCU 1;  3S1Q I;  3HOV I;  4NBD A;  4DJZ A;  1YHQ 1;  3M7P A;  2VF1 A;  1OK9 A;  2MCY A;  2JGX A;  4A3B I;  1RNI A;  3VB9 A;  3CCS Z;  1G4F A;  3S1N I;  4WJG 2;  4RVG A;  1Y1W I;  3M4O I;  2RHB A;  1VQK Z;  1QYP A;  1W2B Z;  2F4O A;  1VQP 1;  1ZB8 A;  3RJ3 D;  5C3E I;  3ZRZ A;  2HF1 A;  4BY1 I;  3CPW Z;  5T6B A;  1VQ9 1;  1YIJ 1;  5D1O A;  1QUB A;  1YJ9 Z;  2O53 A;  3F3P C;  1QVG Z;  1OJY A;  4J38 B;  1LY2 A;  1Q3X A;  4E2X A;  1MD8 A;  3S15 I;  3CCM Z;  1X3Z A;  3GTM I;  3HOW I;  3LUS A;  2G2K A;  4JHS A;  5JPM G;  2NVT I;  3PO2 I;  3INB C;  2LFU A;  3NH8 A;  2NVY I;  3NH5 A;  3CCR Z;  3ZD1 A;  1PFT A;  3TE5 B;  3JAM b;  4NBH A;  2B63 I;  1TPG A;  1Q81 1;  2CG7 A;  3GXE A;  3VMG A;  3CC2 Z;  4AYE A;  3CD6 Z;  2KMS A;  2RBL A;  3GTQ I;  3EJH A;  2UWN A;  4E32 A;  1YUK A;  1VQ5 Z;  2RKZ A;  1YI2 1;  2Q51 A;  4AYM A;  3R62 A;  1TFI A;  3G71 Z;  3CQZ I;  4NBC A;  5HYU B;  3GTO I;  2RKY A;  4NBA A;  4RS4 A;  1VQM 1;  1JJ2 Y;  2OTJ 1;  3S1M I;  1MD7 A;  4AYI A;  2VUG A;  3HOU I;  3K7A I;  3I56 Z;  3CPW Y;  4F4O C;  2KPI A;  2VUM I;  3H0G I;  3TDH B;  2WII C;  5CM2 M;  1OK1 A;  5IT9 f;  2E2J I;  3CME 1;  1NWV A;  2EHF A;  2I3C A;  3OP8 A;  2YAD A;  2G7I A;  2V8K A;  4HGY A;  1HFI A;  4A3G I;  1Q82 2;  1Q7Y 2;  4AYB A;  2OTL Z;  3CCQ Z;  1TPN A;  1VQN 1;  5C44 I;  1M1K 1;  4A5W B;  2QRD B;  1H03 P;  1RO0 A;  3GTJ I;  1VQ6 Z;  1E88 A;  3QWU A;  2IZ3 A;  1WW9 A;  2DE6 A;  3GCF A;  1Q86 1;  3RZO I;  1OJV A;  3GKQ A;  2R93 I;  2QA4 Z;  1N8R 1;  1NJI 1;  1VQO 1;  4A3J I;  3IX0 A;  1VVC A;  3I4M I;  4MD9 A;  4E2Z A;  2E2H I;  2HU9 A;  3CC4 Z;  2W03 A;  3O8E B;  1Z03 A;  2RT9 A;  3CCJ 1;  1OK3 A;  2DE5 A;  4MD8 A;  2WB1 A;  4DK1 A;  3I4N I;  2V8E A;  4B2S A;  2KRI A;  1YUA A;  3BG0 B;  1VQ4 Z;  1X0T A;  1KD1 1;  3J80 f;  2QEX 1;  4HGZ A;  5LL6 f;  2JR6 A;  5D1O B;  2JGW A;  3KXV A;  1YJN 1;  2B5I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...