The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
98
|
sequence length |
412
|
structure length |
388
|
Chain Sequence |
SGNPFQANVEMKTFMERFNLTHHHQSGIYVDLGQDKEVDGTLYREPAGLCPIWGKHIELQQPDRPPYRNNFLEDVPTEKEYKQSGNPLPGGFNLNFVTPSGQRISPFPMELLEKNSNIKASTDLGRCAEFAFKTVAMDKNNKATKYRYPFVYDSKKRLCHILYVSMQLMEGKKYCSVKGEPPDLTWYCFKPRKSVTENHHLIYGSAYVGENPDAFISKCPNQALRGYRFGVWKKGRCLDYTELTDTVIERVESKAQCWVKTFENDGVASDQPDQPHSGGVGRNYGFYYVDTTGEGKCALSDQVPDCLVSDSAAVSYTAAGSLSEETPNFIIPSNPPTPETALQCTADKFPDSFGACDVQACKRQKTSCVGGQIQSTSVDCTADEQNEC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Membrane protein
|
| source organism |
Toxoplasma gondii
|
| publication title |
Host Cell Invasion by Apicomplexan Parasites: Insights from the Co-Structure of Ama1 with a Ron2 Peptide
pubmed doi rcsb |
| molecule keywords |
APICAL MEMBRANE ANTIGEN, PUTATIVE
|
| total genus |
98
|
| structure length |
388
|
| sequence length |
412
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2011-02-10 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02430 | AMA-1 | Apical membrane antigen 1 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Complement Module; domain 1 | Complement Module; domain 1 |
#chains in the Genus database with same CATH superfamily 2Y8T A; 3ZLD A; 3ZLE A; 2X2Z A; 2Y8R A; 4YIZ A; 4APL A; 2Y8S A; #chains in the Genus database with same CATH topology 5JPM G; 1HFI A; 1OJV A; 3GXE A; 3IU3 I; 1VVD A; 3CAL A; 1NWV A; 1CKL A; 3ERB A; 3K3T A; 1G4F A; 3INB C; 1RLH A; 3CI0 J; 3EJH A; 1Z92 B; 4PZ5 A; 3KZJ A; 1TPG A; 2Y8R A; 4J38 B; 5DN5 A; 4N7E A; 4PO7 A; 1LY2 A; 1GKN A; 2O39 C; 1OK3 A; 2YBY A; 2MCY A; 4K12 A; 3IX0 A; 1QO6 A; 4FXG G; 3KXV A; 4A5W B; 3FGR A; 1VVC A; 1OJW A; 3ZD2 A; 3ZD1 A; 2RL0 A; 4B2R A; 4KKD A; 1E5G A; 4IGD A; 2Y8S A; 1UOT P; 3ZLE A; 4CSY A; 2XRB A; 4F4O C; 4AYI A; 4AYM A; 2I2L A; 5FO8 C; 4MUC A; 4LOS A; 1GKG A; 3ZRZ A; 3FGT A; 1U5M A; 2ERJ A; 2XWJ I; 5HYU B; 2QY0 A; 1GHQ B; 1QGB A; 1HFH A; 3F6K A; 2B5I D; 4B2S A; 1ELV A; 1ZJK A; 2X2Z A; 2UWN A; 1H2P P; 3MQL A; 2XWB F; 2V8E A; 1Q3X A; 2YRA A; 4APL A; 2ZYC A; 1H04 P; 1OJY A; 2KMS A; 2G7I A; 4LOT A; 2CKU A; 4BWC A; 2CG7 A; 5HYP A; 4C16 A; 1MD7 A; 3WSY A; 2RLQ A; 1QUB A; 2RKZ A; 3L89 M; 3OXU D; 1OK2 A; 2MCZ A; 3SW0 X; 2WII C; 5I0Q B; 2XRD A; 4WJG 2; 1H03 P; 4ZH1 D; 3GOV A; 1TPN A; 3OED C; 2RKY A; 1E8B A; 2W80 A; 1E88 A; 1SRZ A; 4AYE A; 4DJZ A; 3ZLD A; 2LOJ A; 3OP8 A; 2RLP A; 2A55 A; 1OK9 A; 2CG6 A; 1C1Z A; 3M7P A; 1GPZ A; 3VWO A; 2W81 A; 1HCC A; 2EC3 A; 2JRA A; 3R62 A; 3NFP I; 2Y8T A; 3T5O A; 1FBR A; 1MD8 A; 4ONT D; 3O8E B; 4JHS A; 1SS2 A; 2IZ3 A; 4MSL A; 3TVJ A; 2EHF A; 5DN4 A; 2KRI A; 2IZ4 A; 3WSX A; 5HYT B; 2JGW A; 4AYD A; 1G4G A; 1TPM A; 1H2Q P; 1OK1 A; 2BZM A; 2XQW C; 3RJ3 D; 4YNX A; 1PPQ A; 3NJA A; 5HZP B; 4YIZ A; 2JGX A; 1O9A A; #chains in the Genus database with same CATH homology 2Y8T A; 3ZLE A; 3WSY A; 2I2L A; 3FGT A; 4MSL A; 2Y8R A; 4PO7 A; 4N7E A; 3F6K A; 3WSX A; 2X2Z A; 3ZLD A; 4APL A; 3FGR A; 3NJA A; 4BWC A; 4YIZ A; 2Y8S A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
