The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
100
|
structure length |
100
|
Chain Sequence |
KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQPSTVKVNLKVTQKLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Structural genomics, unknown function
|
source organism |
Streptococcus thermophilus
|
publication title |
Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C
rcsb |
molecule keywords |
Uncharacterized protein
|
total genus |
10
|
structure length |
100
|
sequence length |
100
|
ec nomenclature | |
pdb deposition date | 2010-05-13 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07949 | YbbR | YbbR-like protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | RNA Polymerase Alpha Subunit; Chain A, domain 2 | RNA Polymerase Alpha Subunit; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2KXY A; #chains in the Genus database with same CATH topology 3DXJ A; 5HQH A; 4QIW D; 2KQ1 A; 2L5N A; 3GTK C; 4OIQ A; 4A3K C; 3M4O C; 3FKI C; 3GTQ C; 1YNJ A; 1I6H C; 4A3L C; 2NVQ C; 2A68 A; 4KN7 A; 3GTJ C; 4WFN S; 4YFN A; 1TWA C; 2JA6 C; 3EQL A; 2KPU A; 5IP9 C; 3PO2 C; 4KMU A; 2PA8 D; 5DM6 S; 3K7A C; 2CW0 A; 5C3E C; 2VUM C; 4BBS C; 4OIO A; 2NVX C; 2O5J A; 4OIN A; 2JA8 C; 2L3U A; 4NOI A; 4A3C C; 2E2I C; 1I6V A; 1K83 C; 4XLP A; 2YU9 C; 4MQ9 A; 1R9T C; 3S2D C; 2R92 C; 1I50 C; 1TWG C; 3I4M C; 3PIO S; 4LLG A; 3GTP C; 5IYC C; 1SFO C; 4OIP A; 3HOU C; 4WFA S; 3HOZ C; 2A69 A; 1SMY A; 3LYW A; 4MEY A; 5JVG S; 4IO9 S; 4XSZ A; 3S1N C; 2JA5 C; 4G7H A; 4Q4Z A; 1YNN A; 5C4X C; 2JA7 C; 2KXY A; 4WF9 S; 4QJV A; 2PPB A; 4MEX A; 3GTM C; 2E2J C; 3CQZ C; 4WFB S; 4ZH4 A; 1ZYR A; 3I4N C; 2A6E A; 3S16 C; 4A3M C; 1FEU A; 1HQM A; 2A6H A; 2NVY C; 3HOY C; 5TMF A; 3HKZ D; 5C44 C; 3S2H C; 4XLN A; 4X6A C; 5FLM C; 4JK1 A; 2PMZ D; 4BBR C; 4C2M C; 4A3I C; 3M3Y C; 4Q5S A; 5TMC A; 2B63 C; 4BXX C; 4BY7 C; 1Y1W C; 3H0G C; 3S1M C; 3S1R C; 4A3E C; 4G7O A; 5HL7 S; 4C3I C; 1WCM C; 4A3F C; 4YFX A; 3H3V D; 5C4J C; 3HOW C; 4LK0 A; 1TWH C; 3S17 C; 2BE5 A; 2ZJQ S; 3HOX C; 4U67 S; 3PIP S; 4LJZ A; 2R93 C; 4IOA S; 4BY1 C; 3S15 C; 1IW7 A; 1I3Q C; 5D4D A; 4Y52 C; 4YG2 A; 4C3J C; 2R7Z C; 2WAQ D; 1Y1V C; 4A93 C; 3PO3 C; 1TWF C; 3RZO C; 4G7Z A; 1TWC C; 4Y7N C; 3S14 C; 2ZJP S; 3DLL S; 4XSX A; 4OIR A; 3GTG C; 3HOV C; 4WCE S; 2O5I A; 2ZJR S; 4GZY A; 3CF5 S; 4IOC S; 5IYB C; 3WOD A; 5JVH S; 4KN4 A; 5IP7 C; 4A3G C; 4A3D C; 3RZD C; 4C3H C; 4A3J C; 5DM7 S; 2Y0S D; 3S1Q C; 2WB1 D; 4AYB D; 1BDF A; 3GTO C; 4YFK A; 4A3B C; 5IYD C; 2E2H C; 3GTL C; 4LK1 A; 2NVT C; #chains in the Genus database with same CATH homology 2KXY A; 2KPU A; 3LYW A; 2L3U A; 5HQH A; 2KQ1 A; 2L5N A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...