4MQ9A

Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with ge23077
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 49
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4mq9A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4mq9A01
3GTKK 4BY1K 1R9TC 1HQMA 1TWGC 5FLMK 5IP7K 4JK1A 4AYBD 4XLNA 4A3LK 4X6AC 3HOYK 2R93K 1SMYA 5IYCC 5M5XK 3GTGK 3HOUK 5C3EC 3S1RC 1TWCC 2WAQD 5IP9C 2JA8C 3K7AK 4A3BC 2A68A 4G7ZA 3GTQC 1I3QC 3GTJK 4Y52K 3GTMC 4MEXA 1WCMK 3CQZC 4A3IK 3M4OC 4A3JK 2NVQC 4ZH4A 1XPPA 4LJZA 5FJ8K 5C44K 4QJVA 2E2IC 4QJVB 1BDFA 3PO3C 2R92K 4YFXA 4KMUA 2NVXK 4OIQA 4BBSC 2PA8D 4KN7A 3I4MK 4C3HC 1SFOC 4X6AK 1K83K 1TWCK 5IP9K 5FLMC 1Y1VC 3S15K 2R7ZC 3S2DC 3HOYC 3GTOC 3M3YK 1I6VA 4G7OA 4G7HA 4A3FC 4OINA 4Y7NC 2YU9C 2B63K 3S1MK 4A3DK 3H0GK 2R7ZK 4QIWL 3S15C 2E2JK 1YNJA 5TMFA 4MEYA 2O5IA 2VUMC 2NVYK 3S17C 4OIPA 1TWHC 4Q5SA 4AYBL 3FKIK 4A93K 4QIWD 5TMCA 4BBSK 5IYBC 4BY7C 5C4XC 3HOVK 4LLGA 4BBRC 3H3VD 1TWAK 4XSXA 1TWHK 4C3HK 1SFOK 3S17K 2WB1D 2NVYC 3FKIC 4A93C 4BXXK 2JA5K 3I4NC 3DXJA 3HOXC 3RZDC 2E2HK 2E2IK 2WB1L 4C3JK 4A3KK 4Q4ZA 5M3MK 2A69A 3EQLA 5M5WK 1I6HC 3PO2K 3K7AC 3S1RK 2JA8K 3GTGC 3GTQK 3HKZD 2B63C 4A3DC 3S1QK 3GTLC 2Y0SL 1K83C 4C3IC 1IW7A 1TWGK 4A3GK 1YNNA 1R9TK 1Y1VK 3HKZL 5D4DA 3HOZK 1I6HK 2PMZD 2R93C 3S2HC 2BE5A 3RZOK 5IP7C 2A6EA 3S1QC 4BY1C 5C44C 2E2HC 3HOXK 4C2MC 3RZDK 2WAQL 3I4NK 1TWFC 5C4JC 3S14K 3GTMK 4C3JC 4Y52C 3GTJC 4A3KC 1I3QK 2PA8L 4BXXC 5M3FK 4A3JC 3M4OK 4A3BK 3CQZK 2PPBA 4A3CK 4LK1A 4NOIA 4C2MK 5C4XK 4BY7K 5IYDK 2Y0SD 4A3GC 4C3IK 1Y1WC 2JA7C 4A3LC 4OIRA 4KN4A 3HOZC 2VUMK 3GTLK 4XLPA 3HOUC 2PMZL 5IYCK 1I50C 3H0GC 1ZYRA 2A6HA 4A3MK 3S1MC 4Y7NK 3S16C 2YU9K 4LK0A 2NVTK 2JA6K 2E2JC 4A3EK 3GTKC 3HOWK 3PO2C 3RZOC 3S2DK 4YFNA 4A3CC 1I50K 3GTPK 4A3FK 3S1NC 2O5JA 3M3YC 3H3VL 3GTOK 4A3MC 2JA5C 4OIOA 4GZYA 1TWAC 4BBRK 4MQ9A 2NVXC 3I4MC 5M5YK 4XSZA 1Y1WK 2JA7K 5IYDC 2CW0A 3HOVC 5IYBK 2NVQK 3S14C 5C4JK 1TWFK 1WCMC 4A3IC 2R92C 3PO3K 3HOWC 4YFKA 3WODA 4A3EC 2JA6C 3S1NK 4YG2A 2NVTC 3S16K 3S2HK 3GTPC 5C3EK
chains in the Genus database with same CATH superfamily
1HQMA 1TWGC 5FLMK 4XLNA 4A3LK 4X6AC 5IYCC 5M5XK 3HOUK 2JA8C 2WAQD 3NUHA 4A3BC 4GTFA 1I3QC 4MEXA 2E2HA 1WCMK 3OPFA 2NVQC 4LR2A 2NVXK 2PA8D 4KN7A 4PAAA 4C3HC 1WIHA 4X6AK 1GE9A 1TWCK 5IP9K 5FLMC 1I50A 2R7ZC 3HOYC 1I6VA 4A3DK 4G7HA 4A3FC 5CHPA 2W7VA 5IOTA 1EH1A 3SZZA 1YNJA 5TMFA 1EI6A 2NVYK 4GTLA 4WCES 4BBSK 4RMFA 1O24A 1TWAK 4XSXA 3AH5A 5DM6S 4BXXK 1ISEA 3HOXC 3RZDC 4GTAA 2E2HK 4C3JK 3RZOK 1I6HC 1JOEA 3K7AC 3GTGC 3GTQK 3HKZD 3S1QK 5HQHA 1YNNA 1R9TK 1Y1VK 4KMAA 4WILA 2R93C 3S2HC 4KB2A 3S1QC 4BY1C 3I4NK 1BS2A 1TWFC 4C3JC 4Y52C 3GTJC 1JQWA 1V5VA 4BXXC 5M3FK 2ZJRS 3M4OK 2NVYA 5JFEA 4A3CK 4LK1A 1WCMA 2GAHC 5C4XK 2KPUA 2Y0SD 1INNA 4IOCS 4C3IK 1Y1WC 1XZQB 1F7UA 3BUEA 2PMZL 2NVXA 4A3MK 2YU9K 3PO2C 3S2DK 1I50K 3T02A 4A3FK 1IS1A 2JA5C 4MQ9A 3I4MC 4WJ3M 5IYDC 3HOVC 5IYBK 3WODA 1DCHA 1O2AA 2P5MA 1ZBSA 1I3QA 4KDDA 3T00A 1O26A 1SMYA 4P5BA 3FOFA 3DLLS 3GTJK 4Y52K 3M4OC 1F7VA 4ZH4A 1XPPA 4G0UA 2E2IC 1WSRA 5JVHS 4YFXA 3TTGA 4KMUA 4P5AA 1XXBA 3I4MK 4AH6A 3L4JA 1SFOC 2ZJQS 3CQZA 1Y1VC 4GTEA 1WQHA 1XXAA 3S2DC 3GTOC 3M3YK 1YCLA 1EQRA 2YU9C 2KQ1A 4QIWL 3S15C 5EGEA 1XZPA 2O5IA 2CFAA 4Q5SA 1DCPA 1USOA 5TMCA 5C4XC 2V6TA 2GSNA 1USMA 4BBRC 2KWAA 3GTOA 4ILDA 3ERED 2NVYC 5HL8A 2YU9A 3I4NC 2WB1L 4A3KK 5M3MK 2RGRA 2A69A 4KMDA 1F9NA 1G51A 1VRQC 3S1RK 4A3DC 1WSVA 3Q3QA 2FQOA 4A3GK 1WORA 3OEPA 1O28A 1I6HK 2PMZD 1J6VA 5IP7C 4DDQA 2A6EA 4KM9A 2E2HC 3HOXK 4C2MC 3RZDK 1ZQ1C 1EK8A 3AQOA 3S14K 4GTCA 1I3QK 4KMHA 4A3BK 2PPBA 4C2MK 2JA7C 4A3LC 4OIRA 4KN4A 3GTLK 4G0WA 3HOUC 5IYCK 2R7ZA 4U67S 2A6HA 1XXCA 3GTJA 1XZQA 3S16C 1JVIA 3HOWK 2FQTA 4A3CC 4GFQA 3S1NC 5JVOA 2R92A 2O5JA 1TWHA 3H3VL 1BJTA 4OIOA 2ZJPS 4GZYA 1BGWA 2JH3A 1PJ5A 2NVXC 1O27A 4XSZA 2JA7K 2XCQA 1IL2A 2NVQK 3G4AA 3S14C 1WCMC 3PO3K 3GEEA 4YFKA 4A3EC 3IPJA 2JA6C 2Y3PA 2NVTC 4FZBA 3G4CA 3LAJA 4FM9A 2GSUA 5HL7S 2ZUFA 5IP7K 3PIOS 2XCRB 4AYBD 3TFIA 3FHZA 1PJ7A 3S1RC 2L5NA 2VUMA 1PJ6A 4G7ZA 2JA5A 3GTMC 1AB4A 3CQZC 2ZFZA 4GT9A 5FJ8K 4LJZA 1IBAA 4QJVB 1BDFA 2R92K 4M1XA 3VA7A 5JVGS 2XCOA 3N3YA 3A8JA 3GTPA 3S15K 4G7OA 1VJEA 2B63K 4Y7NC 2D6FC 3S1MK 3H0GK 2E2JK 4MEYA 3V4GA 3S17C 4OIPA 1TWHC 4QIWD 5IYBC 4BY7C 1WOSA 3HOVK 4LLGA 3GTLA 1SFOK 1IE0A 4WFNS 3FKIC 4A93C 4IOAS 2JA5K 5IOSA 3DXJA 2E2IK 2JA7A 2RH6A 4Q4ZA 3OREA 3EQLA 1RU0A 3PO2K 3GTLC 2Y0SL 1K83C 4KC6A 1IW7A 1EFWA 3HKZL 5D4DA 3GEIA 3ADAC 4IO9S 5C44C 2B63A 5L46A 1HI9A 1K83A 3GTKA 4A3JC 4PABA 4NOIA 1DCOA 1YX2A 5IYDK 4A3GC 2CFAB 2KXYA 1ZXOA 3S0XA 1XZPB 1WOPA 2VUMK 4XLPA 1I50C 4LK0A 3A8IA 3HXAA 1O29A 2E2JC 3GTKC 3BP8C 3FOEA 3RZOC 3GTPK 3GEHA 3BP3A 5EGHA 4A3MC 4WFBS 4BLBA 1X31C 4BBRK 1VH2A 3H0GA 5M5YK 3JSTA 4LQYA 3N0BA 1Y1WK 4C45A 1TWFK 4A3IC 2R92C 1DD5A 3GIRA 1WOOA 4KASA 3S2HK 3GTPC 1IQ0A 5C3EK 3GTKK 4BY1K 1R9TC 4KARA 2E2IA 4JK1A 2R93K 3HOYK 3AD9C 1VGXA 4WF9S 3GTGK 5C3EC 3K7AK 1TWCC 5IP9C 3GSIA 3CF5S 1KQ4A 5IORA 1SFOA 2A68A 3GTQC 4A3IK 4A3JK 2GAGC 5C44K 4QJVA 1O2BA 3PO3C 3PIPS 3LAPA 4OIQA 4BBSC 1VLOA 1UV7A 2JA6A 1K83K 1O25A 4KM8A 1L0WA 2V6UA 3L4KA 1J6WA 4OINA 3A8KA 2ZUEA 4O2DA 5IOQA 4WFAS 2R7ZK 2PHCB 2VUMC 3AQPA 4AYBL 3FKIK 4A93K 1ZVUA 4BKWA 3H3VD 5E68A 2EBBA 1B4BA 4KATA 1TWHK 4C3HK 3S17K 2WB1D 4KAWX 4J3NA 2GSOA 1Y1WA 1B4AA 4G0VA 5M5WK 2JA8K 1TWFA 2B63C 4C3IC 1TWGK 3TFJA 4GTDA 3HOZK 1TWCA 2BE5A 1FEUA 2WAQL 3GTGA 5C4JC 3AD7C 3GTMK 4A3KC 2PA8L 3LYWA 3AD8C 3CQZK 3QX3A 4BY7K 3SZYA 2R93A 3FKIA 1J6XA 2V6SA 1C0AA 1TWAA 3HOZC 4KB4A 3MMLB 1F93A 3H0GC 1ZYRA 1WQGA 3S1MC 4GTBA 4Y7NK 2NVTK 2P8TA 4BLAA 2JA6K 4A3EK 4YFNA 3LPXA 1J98A 3M3YC 3GTOK 3GTQA 3N0CA 1O2FB 1TWAC 2L3UA 3TFHA 5DM7S 1TWGA 5TJ3A 4XCHA 1R9TA 3CAGA 2CW0A 1WQFA 4LOWA 5CJ9A 5C4JK 3HOWC 4P9SA 3GDZA 3S1NK 4YG2A 3S16K 3GTMA 1Y1VA 4WJ4A 3T01A
chains in the Genus database with same CATH topology
3GTKK 4BY1K 1R9TC 1HQMA 1TWGC 5FLMK 5IP7K 4JK1A 4AYBD 4XLNA 4A3LK 4X6AC 3HOYK 2R93K 1SMYA 5IYCC 5M5XK 3GTGK 3HOUK 5C3EC 3S1RC 1TWCC 2WAQD 5IP9C 2JA8C 3K7AK 4A3BC 2A68A 4G7ZA 3GTQC 1I3QC 3GTJK 4Y52K 3GTMC 4MEXA 1WCMK 3CQZC 4A3IK 3M4OC 4A3JK 2NVQC 4ZH4A 1XPPA 4LJZA 5FJ8K 5C44K 4QJVA 2E2IC 4QJVB 1BDFA 3PO3C 2R92K 4YFXA 4KMUA 2NVXK 4OIQA 4BBSC 2PA8D 4KN7A 3I4MK 4C3HC 1SFOC 4X6AK 1K83K 1TWCK 5IP9K 5FLMC 1Y1VC 3S15K 2R7ZC 3S2DC 3HOYC 3GTOC 3M3YK 1I6VA 4G7OA 4G7HA 4A3FC 4OINA 4Y7NC 2YU9C 2B63K 3S1MK 4A3DK 3H0GK 2R7ZK 4QIWL 3S15C 2E2JK 1YNJA 5TMFA 4MEYA 2O5IA 2VUMC 2NVYK 3S17C 4OIPA 1TWHC 4Q5SA 4AYBL 3FKIK 4A93K 4QIWD 5TMCA 4BBSK 5IYBC 4BY7C 5C4XC 3HOVK 4LLGA 4BBRC 3H3VD 1TWAK 4XSXA 1TWHK 4C3HK 1SFOK 3S17K 2WB1D 2NVYC 3FKIC 4A93C 4BXXK 2JA5K 3I4NC 3DXJA 3HOXC 3RZDC 2E2HK 2E2IK 2WB1L 4C3JK 4A3KK 4Q4ZA 5M3MK 2A69A 3EQLA 5M5WK 1I6HC 3PO2K 3K7AC 3S1RK 2JA8K 3GTGC 3GTQK 3HKZD 2B63C 4A3DC 3S1QK 3GTLC 2Y0SL 1K83C 4C3IC 1IW7A 1TWGK 4A3GK 1YNNA 1R9TK 1Y1VK 3HKZL 5D4DA 3HOZK 1I6HK 2PMZD 2R93C 3S2HC 2BE5A 3RZOK 5IP7C 2A6EA 3S1QC 4BY1C 5C44C 2E2HC 3HOXK 4C2MC 3RZDK 2WAQL 3I4NK 1TWFC 5C4JC 3S14K 3GTMK 4C3JC 4Y52C 3GTJC 4A3KC 1I3QK 2PA8L 4BXXC 5M3FK 4A3JC 3M4OK 4A3BK 3CQZK 2PPBA 4A3CK 4LK1A 4NOIA 4C2MK 5C4XK 4BY7K 5IYDK 2Y0SD 4A3GC 4C3IK 1Y1WC 2JA7C 4A3LC 4OIRA 4KN4A 3HOZC 2VUMK 3GTLK 4XLPA 3HOUC 2PMZL 5IYCK 1I50C 3H0GC 1ZYRA 2A6HA 4A3MK 3S1MC 4Y7NK 3S16C 2YU9K 4LK0A 2NVTK 2JA6K 2E2JC 4A3EK 3GTKC 3HOWK 3PO2C 3RZOC 3S2DK 4YFNA 4A3CC 1I50K 3GTPK 4A3FK 3S1NC 2O5JA 3M3YC 3H3VL 3GTOK 4A3MC 2JA5C 4OIOA 4GZYA 1TWAC 4BBRK 4MQ9A 2NVXC 3I4MC 5M5YK 4XSZA 1Y1WK 2JA7K 5IYDC 2CW0A 3HOVC 5IYBK 2NVQK 3S14C 5C4JK 1TWFK 1WCMC 4A3IC 2R92C 3PO3K 3HOWC 4YFKA 3WODA 4A3EC 2JA6C 3S1NK 4YG2A 2NVTC 3S16K 3S2HK 3GTPC 5C3EK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTK K;  4BY1 K;  1R9T C;  1HQM A;  1TWG C;  5FLM K;  5IP7 K;  4JK1 A;  4AYB D;  4XLN A;  4A3L K;  4X6A C;  3HOY K;  2R93 K;  1SMY A;  5IYC C;  5M5X K;  3GTG K;  3HOU K;  5C3E C;  3S1R C;  1TWC C;  2WAQ D;  5IP9 C;  2JA8 C;  3K7A K;  4A3B C;  2A68 A;  4G7Z A;  3GTQ C;  1I3Q C;  3GTJ K;  4Y52 K;  3GTM C;  4MEX A;  1WCM K;  3CQZ C;  4A3I K;  3M4O C;  4A3J K;  2NVQ C;  4ZH4 A;  1XPP A;  4LJZ A;  5FJ8 K;  5C44 K;  4QJV A;  2E2I C;  4QJV B;  1BDF A;  3PO3 C;  2R92 K;  4YFX A;  4KMU A;  2NVX K;  4OIQ A;  4BBS C;  2PA8 D;  4KN7 A;  3I4M K;  4C3H C;  1SFO C;  4X6A K;  1K83 K;  1TWC K;  5IP9 K;  5FLM C;  1Y1V C;  3S15 K;  2R7Z C;  3S2D C;  3HOY C;  3GTO C;  3M3Y K;  1I6V A;  4G7O A;  4G7H A;  4A3F C;  4OIN A;  4Y7N C;  2YU9 C;  2B63 K;  3S1M K;  4A3D K;  3H0G K;  2R7Z K;  4QIW L;  3S15 C;  2E2J K;  1YNJ A;  5TMF A;  4MEY A;  2O5I A;  2VUM C;  2NVY K;  3S17 C;  4OIP A;  1TWH C;  4Q5S A;  4AYB L;  3FKI K;  4A93 K;  4QIW D;  5TMC A;  4BBS K;  5IYB C;  4BY7 C;  5C4X C;  3HOV K;  4LLG A;  4BBR C;  3H3V D;  1TWA K;  4XSX A;  1TWH K;  4C3H K;  1SFO K;  3S17 K;  2WB1 D;  2NVY C;  3FKI C;  4A93 C;  4BXX K;  2JA5 K;  3I4N C;  3DXJ A;  3HOX C;  3RZD C;  2E2H K;  2E2I K;  2WB1 L;  4C3J K;  4A3K K;  4Q4Z A;  5M3M K;  2A69 A;  3EQL A;  5M5W K;  1I6H C;  3PO2 K;  3K7A C;  3S1R K;  2JA8 K;  3GTG C;  3GTQ K;  3HKZ D;  2B63 C;  4A3D C;  3S1Q K;  3GTL C;  2Y0S L;  1K83 C;  4C3I C;  1IW7 A;  1TWG K;  4A3G K;  1YNN A;  1R9T K;  1Y1V K;  3HKZ L;  5D4D A;  3HOZ K;  1I6H K;  2PMZ D;  2R93 C;  3S2H C;  2BE5 A;  3RZO K;  5IP7 C;  2A6E A;  3S1Q C;  4BY1 C;  5C44 C;  2E2H C;  3HOX K;  4C2M C;  3RZD K;  2WAQ L;  3I4N K;  1TWF C;  5C4J C;  3S14 K;  3GTM K;  4C3J C;  4Y52 C;  3GTJ C;  4A3K C;  1I3Q K;  2PA8 L;  4BXX C;  5M3F K;  4A3J C;  3M4O K;  4A3B K;  3CQZ K;  2PPB A;  4A3C K;  4LK1 A;  4NOI A;  4C2M K;  5C4X K;  4BY7 K;  5IYD K;  2Y0S D;  4A3G C;  4C3I K;  1Y1W C;  2JA7 C;  4A3L C;  4OIR A;  4KN4 A;  3HOZ C;  2VUM K;  3GTL K;  4XLP A;  3HOU C;  2PMZ L;  5IYC K;  1I50 C;  3H0G C;  1ZYR A;  2A6H A;  4A3M K;  3S1M C;  4Y7N K;  3S16 C;  2YU9 K;  4LK0 A;  2NVT K;  2JA6 K;  2E2J C;  4A3E K;  3GTK C;  3HOW K;  3PO2 C;  3RZO C;  3S2D K;  4YFN A;  4A3C C;  1I50 K;  3GTP K;  4A3F K;  3S1N C;  2O5J A;  3M3Y C;  3H3V L;  3GTO K;  4A3M C;  2JA5 C;  4OIO A;  4GZY A;  1TWA C;  4BBR K;  4MQ9 A;  2NVX C;  3I4M C;  5M5Y K;  4XSZ A;  1Y1W K;  2JA7 K;  5IYD C;  2CW0 A;  3HOV C;  5IYB K;  2NVQ K;  3S14 C;  5C4J K;  1TWF K;  1WCM C;  4A3I C;  2R92 C;  3PO3 K;  3HOW C;  4YFK A;  3WOD A;  4A3E C;  2JA6 C;  3S1N K;  4YG2 A;  2NVT C;  3S16 K;  3S2H K;  3GTP C;  5C3E K; 
#chains in the Genus database with same CATH topology
 1HQM A;  1TWG C;  5FLM K;  4XLN A;  4A3L K;  4X6A C;  5IYC C;  5M5X K;  3HOU K;  2JA8 C;  2WAQ D;  3NUH A;  4A3B C;  4GTF A;  1I3Q C;  4MEX A;  2E2H A;  1WCM K;  3OPF A;  2NVQ C;  4LR2 A;  2NVX K;  2PA8 D;  4KN7 A;  4PAA A;  4C3H C;  1WIH A;  4X6A K;  1GE9 A;  1TWC K;  5IP9 K;  5FLM C;  1I50 A;  2R7Z C;  3HOY C;  1I6V A;  4A3D K;  4G7H A;  4A3F C;  5CHP A;  2W7V A;  5IOT A;  1EH1 A;  3SZZ A;  1YNJ A;  5TMF A;  1EI6 A;  2NVY K;  4GTL A;  4WCE S;  4BBS K;  4RMF A;  1O24 A;  1TWA K;  4XSX A;  3AH5 A;  5DM6 S;  4BXX K;  1ISE A;  3HOX C;  3RZD C;  4GTA A;  2E2H K;  4C3J K;  3RZO K;  1I6H C;  1JOE A;  3K7A C;  3GTG C;  3GTQ K;  3HKZ D;  3S1Q K;  5HQH A;  1YNN A;  1R9T K;  1Y1V K;  4KMA A;  4WIL A;  2R93 C;  3S2H C;  4KB2 A;  3S1Q C;  4BY1 C;  3I4N K;  1BS2 A;  1TWF C;  4C3J C;  4Y52 C;  3GTJ C;  1JQW A;  1V5V A;  4BXX C;  5M3F K;  2ZJR S;  3M4O K;  2NVY A;  5JFE A;  4A3C K;  4LK1 A;  1WCM A;  2GAH C;  5C4X K;  2KPU A;  2Y0S D;  1INN A;  4IOC S;  4C3I K;  1Y1W C;  1XZQ B;  1F7U A;  3BUE A;  2PMZ L;  2NVX A;  4A3M K;  2YU9 K;  3PO2 C;  3S2D K;  1I50 K;  3T02 A;  4A3F K;  1IS1 A;  2JA5 C;  4MQ9 A;  3I4M C;  4WJ3 M;  5IYD C;  3HOV C;  5IYB K;  3WOD A;  1DCH A;  1O2A A;  2P5M A;  1ZBS A;  1I3Q A;  4KDD A;  3T00 A;  1O26 A;  1SMY A;  4P5B A;  3FOF A;  3DLL S;  3GTJ K;  4Y52 K;  3M4O C;  1F7V A;  4ZH4 A;  1XPP A;  4G0U A;  2E2I C;  1WSR A;  5JVH S;  4YFX A;  3TTG A;  4KMU A;  4P5A A;  1XXB A;  3I4M K;  4AH6 A;  3L4J A;  1SFO C;  2ZJQ S;  3CQZ A;  1Y1V C;  4GTE A;  1WQH A;  1XXA A;  3S2D C;  3GTO C;  3M3Y K;  1YCL A;  1EQR A;  2YU9 C;  2KQ1 A;  4QIW L;  3S15 C;  5EGE A;  1XZP A;  2O5I A;  2CFA A;  4Q5S A;  1DCP A;  1USO A;  5TMC A;  5C4X C;  2V6T A;  2GSN A;  1USM A;  4BBR C;  2KWA A;  3GTO A;  4ILD A;  3ERE D;  2NVY C;  5HL8 A;  2YU9 A;  3I4N C;  2WB1 L;  4A3K K;  5M3M K;  2RGR A;  2A69 A;  4KMD A;  1F9N A;  1G51 A;  1VRQ C;  3S1R K;  4A3D C;  1WSV A;  3Q3Q A;  2FQO A;  4A3G K;  1WOR A;  3OEP A;  1O28 A;  1I6H K;  2PMZ D;  1J6V A;  5IP7 C;  4DDQ A;  2A6E A;  4KM9 A;  2E2H C;  3HOX K;  4C2M C;  3RZD K;  1ZQ1 C;  1EK8 A;  3AQO A;  3S14 K;  4GTC A;  1I3Q K;  4KMH A;  4A3B K;  2PPB A;  4C2M K;  2JA7 C;  4A3L C;  4OIR A;  4KN4 A;  3GTL K;  4G0W A;  3HOU C;  5IYC K;  2R7Z A;  4U67 S;  2A6H A;  1XXC A;  3GTJ A;  1XZQ A;  3S16 C;  1JVI A;  3HOW K;  2FQT A;  4A3C C;  4GFQ A;  3S1N C;  5JVO A;  2R92 A;  2O5J A;  1TWH A;  3H3V L;  1BJT A;  4OIO A;  2ZJP S;  4GZY A;  1BGW A;  2JH3 A;  1PJ5 A;  2NVX C;  1O27 A;  4XSZ A;  2JA7 K;  2XCQ A;  1IL2 A;  2NVQ K;  3G4A A;  3S14 C;  1WCM C;  3PO3 K;  3GEE A;  4YFK A;  4A3E C;  3IPJ A;  2JA6 C;  2Y3P A;  2NVT C;  4FZB A;  3G4C A;  3LAJ A;  4FM9 A;  2GSU A;  5HL7 S;  2ZUF A;  5IP7 K;  3PIO S;  2XCR B;  4AYB D;  3TFI A;  3FHZ A;  1PJ7 A;  3S1R C;  2L5N A;  2VUM A;  1PJ6 A;  4G7Z A;  2JA5 A;  3GTM C;  1AB4 A;  3CQZ C;  2ZFZ A;  4GT9 A;  5FJ8 K;  4LJZ A;  1IBA A;  4QJV B;  1BDF A;  2R92 K;  4M1X A;  3VA7 A;  5JVG S;  2XCO A;  3N3Y A;  3A8J A;  3GTP A;  3S15 K;  4G7O A;  1VJE A;  2B63 K;  4Y7N C;  2D6F C;  3S1M K;  3H0G K;  2E2J K;  4MEY A;  3V4G A;  3S17 C;  4OIP A;  1TWH C;  4QIW D;  5IYB C;  4BY7 C;  1WOS A;  3HOV K;  4LLG A;  3GTL A;  1SFO K;  1IE0 A;  4WFN S;  3FKI C;  4A93 C;  4IOA S;  2JA5 K;  5IOS A;  3DXJ A;  2E2I K;  2JA7 A;  2RH6 A;  4Q4Z A;  3ORE A;  3EQL A;  1RU0 A;  3PO2 K;  3GTL C;  2Y0S L;  1K83 C;  4KC6 A;  1IW7 A;  1EFW A;  3HKZ L;  5D4D A;  3GEI A;  3ADA C;  4IO9 S;  5C44 C;  2B63 A;  5L46 A;  1HI9 A;  1K83 A;  3GTK A;  4A3J C;  4PAB A;  4NOI A;  1DCO A;  1YX2 A;  5IYD K;  4A3G C;  2CFA B;  2KXY A;  1ZXO A;  3S0X A;  1XZP B;  1WOP A;  2VUM K;  4XLP A;  1I50 C;  4LK0 A;  3A8I A;  3HXA A;  1O29 A;  2E2J C;  3GTK C;  3BP8 C;  3FOE A;  3RZO C;  3GTP K;  3GEH A;  3BP3 A;  5EGH A;  4A3M C;  4WFB S;  4BLB A;  1X31 C;  4BBR K;  1VH2 A;  3H0G A;  5M5Y K;  3JST A;  4LQY A;  3N0B A;  1Y1W K;  4C45 A;  1TWF K;  4A3I C;  2R92 C;  1DD5 A;  3GIR A;  1WOO A;  4KAS A;  3S2H K;  3GTP C;  1IQ0 A;  5C3E K;  3GTK K;  4BY1 K;  1R9T C;  4KAR A;  2E2I A;  4JK1 A;  2R93 K;  3HOY K;  3AD9 C;  1VGX A;  4WF9 S;  3GTG K;  5C3E C;  3K7A K;  1TWC C;  5IP9 C;  3GSI A;  3CF5 S;  1KQ4 A;  5IOR A;  1SFO A;  2A68 A;  3GTQ C;  4A3I K;  4A3J K;  2GAG C;  5C44 K;  4QJV A;  1O2B A;  3PO3 C;  3PIP S;  3LAP A;  4OIQ A;  4BBS C;  1VLO A;  1UV7 A;  2JA6 A;  1K83 K;  1O25 A;  4KM8 A;  1L0W A;  2V6U A;  3L4K A;  1J6W A;  4OIN A;  3A8K A;  2ZUE A;  4O2D A;  5IOQ A;  4WFA S;  2R7Z K;  2PHC B;  2VUM C;  3AQP A;  4AYB L;  3FKI K;  4A93 K;  1ZVU A;  4BKW A;  3H3V D;  5E68 A;  2EBB A;  1B4B A;  4KAT A;  1TWH K;  4C3H K;  3S17 K;  2WB1 D;  4KAW X;  4J3N A;  2GSO A;  1Y1W A;  1B4A A;  4G0V A;  5M5W K;  2JA8 K;  1TWF A;  2B63 C;  4C3I C;  1TWG K;  3TFJ A;  4GTD A;  3HOZ K;  1TWC A;  2BE5 A;  1FEU A;  2WAQ L;  3GTG A;  5C4J C;  3AD7 C;  3GTM K;  4A3K C;  2PA8 L;  3LYW A;  3AD8 C;  3CQZ K;  3QX3 A;  4BY7 K;  3SZY A;  2R93 A;  3FKI A;  1J6X A;  2V6S A;  1C0A A;  1TWA A;  3HOZ C;  4KB4 A;  3MML B;  1F93 A;  3H0G C;  1ZYR A;  1WQG A;  3S1M C;  4GTB A;  4Y7N K;  2NVT K;  2P8T A;  4BLA A;  2JA6 K;  4A3E K;  4YFN A;  3LPX A;  1J98 A;  3M3Y C;  3GTO K;  3GTQ A;  3N0C A;  1O2F B;  1TWA C;  2L3U A;  3TFH A;  5DM7 S;  1TWG A;  5TJ3 A;  4XCH A;  1R9T A;  3CAG A;  2CW0 A;  1WQF A;  4LOW A;  5CJ9 A;  5C4J K;  3HOW C;  4P9S A;  3GDZ A;  3S1N K;  4YG2 A;  3S16 K;  3GTM A;  1Y1V A;  4WJ4 A;  3T01 A; 
#chains in the Genus database with same CATH homology
 3GTK K;  4BY1 K;  1R9T C;  1HQM A;  1TWG C;  5FLM K;  5IP7 K;  4JK1 A;  4AYB D;  4XLN A;  4A3L K;  4X6A C;  3HOY K;  2R93 K;  1SMY A;  5IYC C;  5M5X K;  3GTG K;  3HOU K;  5C3E C;  3S1R C;  1TWC C;  2WAQ D;  5IP9 C;  2JA8 C;  3K7A K;  4A3B C;  2A68 A;  4G7Z A;  3GTQ C;  1I3Q C;  3GTJ K;  4Y52 K;  3GTM C;  4MEX A;  1WCM K;  3CQZ C;  4A3I K;  3M4O C;  4A3J K;  2NVQ C;  4ZH4 A;  1XPP A;  4LJZ A;  5FJ8 K;  5C44 K;  4QJV A;  2E2I C;  4QJV B;  1BDF A;  3PO3 C;  2R92 K;  4YFX A;  4KMU A;  2NVX K;  4OIQ A;  4BBS C;  2PA8 D;  4KN7 A;  3I4M K;  4C3H C;  1SFO C;  4X6A K;  1K83 K;  1TWC K;  5IP9 K;  5FLM C;  1Y1V C;  3S15 K;  2R7Z C;  3S2D C;  3HOY C;  3GTO C;  3M3Y K;  1I6V A;  4G7O A;  4G7H A;  4A3F C;  4OIN A;  4Y7N C;  2YU9 C;  2B63 K;  3S1M K;  4A3D K;  3H0G K;  2R7Z K;  4QIW L;  3S15 C;  2E2J K;  1YNJ A;  5TMF A;  4MEY A;  2O5I A;  2VUM C;  2NVY K;  3S17 C;  4OIP A;  1TWH C;  4Q5S A;  4AYB L;  3FKI K;  4A93 K;  4QIW D;  5TMC A;  4BBS K;  5IYB C;  4BY7 C;  5C4X C;  3HOV K;  4LLG A;  4BBR C;  3H3V D;  1TWA K;  4XSX A;  1TWH K;  4C3H K;  1SFO K;  3S17 K;  2WB1 D;  2NVY C;  3FKI C;  4A93 C;  4BXX K;  2JA5 K;  3I4N C;  3DXJ A;  3HOX C;  3RZD C;  2E2H K;  2E2I K;  2WB1 L;  4C3J K;  4A3K K;  4Q4Z A;  5M3M K;  2A69 A;  3EQL A;  5M5W K;  1I6H C;  3PO2 K;  3K7A C;  3S1R K;  2JA8 K;  3GTG C;  3GTQ K;  3HKZ D;  2B63 C;  4A3D C;  3S1Q K;  3GTL C;  2Y0S L;  1K83 C;  4C3I C;  1IW7 A;  1TWG K;  4A3G K;  1YNN A;  1R9T K;  1Y1V K;  3HKZ L;  5D4D A;  3HOZ K;  1I6H K;  2PMZ D;  2R93 C;  3S2H C;  2BE5 A;  3RZO K;  5IP7 C;  2A6E A;  3S1Q C;  4BY1 C;  5C44 C;  2E2H C;  3HOX K;  4C2M C;  3RZD K;  2WAQ L;  3I4N K;  1TWF C;  5C4J C;  3S14 K;  3GTM K;  4C3J C;  4Y52 C;  3GTJ C;  4A3K C;  1I3Q K;  2PA8 L;  4BXX C;  5M3F K;  4A3J C;  3M4O K;  4A3B K;  3CQZ K;  2PPB A;  4A3C K;  4LK1 A;  4NOI A;  4C2M K;  5C4X K;  4BY7 K;  5IYD K;  2Y0S D;  4A3G C;  4C3I K;  1Y1W C;  2JA7 C;  4A3L C;  4OIR A;  4KN4 A;  3HOZ C;  2VUM K;  3GTL K;  4XLP A;  3HOU C;  2PMZ L;  5IYC K;  1I50 C;  3H0G C;  1ZYR A;  2A6H A;  4A3M K;  3S1M C;  4Y7N K;  3S16 C;  2YU9 K;  4LK0 A;  2NVT K;  2JA6 K;  2E2J C;  4A3E K;  3GTK C;  3HOW K;  3PO2 C;  3RZO C;  3S2D K;  4YFN A;  4A3C C;  1I50 K;  3GTP K;  4A3F K;  3S1N C;  2O5J A;  3M3Y C;  3H3V L;  3GTO K;  4A3M C;  2JA5 C;  4OIO A;  4GZY A;  1TWA C;  4BBR K;  4MQ9 A;  2NVX C;  3I4M C;  5M5Y K;  4XSZ A;  1Y1W K;  2JA7 K;  5IYD C;  2CW0 A;  3HOV C;  5IYB K;  2NVQ K;  3S14 C;  5C4J K;  1TWF K;  1WCM C;  4A3I C;  2R92 C;  3PO3 K;  3HOW C;  4YFK A;  3WOD A;  4A3E C;  2JA6 C;  3S1N K;  4YG2 A;  2NVT C;  3S16 K;  3S2H K;  3GTP C;  5C3E K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...