4MQ9A

Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with ge23077
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 49
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4mq9A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4mq9A01
4XSZA 3M4OC 4Y52K 4BY7C 5FJ8K 5D4DA 4MQ9A 4C3JC 5IP7C 1WCMC 3RZDK 1IW7A 4OIQA 4ZH4A 2JA5C 3GTOK 3GTKC 4A3FK 3S1NK 1I6HC 2YU9C 3HOZC 4A3EC 2R7ZC 3I4MC 3RZOC 4X6AK 3GTQK 3GTLC 3CQZK 5M3FK 4A3DK 5C4XC 5IP9K 3H3VD 1TWAK 3M3YK 1HQMA 4BBRC 2NVQK 3I4NK 3GTPK 2E2JK 2WB1L 4AYBL 2PPBA 3HOWC 4A3GC 3GTGK 2E2IK 4A3CK 2JA7C 3HOVK 4YFKA 5M3MK 2JA8K 3S16K 1SFOC 5IYDK 3PO2K 3K7AC 2A6HA 2BE5A 4XLNA 1K83C 2NVTC 3S1QC 4BXXC 3HKZL 4QIWL 4A3KK 1Y1WK 2E2HK 4BBSK 4C3HC 2R92C 5IYCK 5FLMK 3S14C 3H0GK 3GTJC 1ZYRA 2NVXK 2VUMK 1TWHC 4A3IK 1I50K 3S2DK 4C3IC 3HOYK 3DXJA 4JK1A 4KN7A 4C2MC 4A3MK 3S17C 3HOXK 4GZYA 2PMZL 2R93K 1R9TK 2JA6K 4XLPA 3GTMC 3S2HC 1TWFK 5TMCA 4Y7NK 2B63K 3S15K 1I3QK 4A93K 3HOUK 2O5IA 3PO3K 2WB1D 4AYBD 1YNJA 2PA8L 5C3EK 4A3JK 1Y1VK 2NVYC 3M4OK 2A68A 4YFNA 3S1RC 4BY7K 1TWCC 4C3JK 5C4JC 5IP7K 1WCMK 5TMFA 2Y0SL 4MEYA 2JA5K 2A69A 3WODA 4QIWD 3HKZD 4BY1C 4OIRA 3GTKK 1I6HK 2YU9K 3HOZK 4Q4ZA 1TWGC 3S1MC 4A3EK 3I4MK 2R7ZK 3RZOK 3GTLK 1BDFA 5IYBC 4G7HA 5C4XK 1Y1WC 4A3BC 4A3LC 5C44C 5IYCC 4BBRK 4Y52C 1SMYA 3EQLA 2PMZD 3HOWK 4A3GK 3RZDC 4LLGA 3S2DC 4Q5SA 3GTOC 5C44K 2JA7K 2O5JA 4A3FC 3S1NC 1SFOK 4XSXA 4KN4A 1K83K 2PA8D 2NVTK 3FKIK 4BXXK 4X6AC 3S1QK 2WAQL 3GTQC 3CQZC 4A3DC 4C3HK 4LK1A 2R92K 3S14K 2CW0A 5IP9C 3GTJK 1TWAC 3M3YC 1I6VA 2NVQC 3I4NC 1TWHK 5M5YK 3GTPC 2Y0SD 2E2JC 4C3IK 3GTGC 4YFXA 4G7OA 2E2IC 4C2MK 4A3CC 5M5XK 4QJVB 3S17K 3HOVC 2JA8C 3S16C 5IYDC 5M5WK 3PO2C 3GTMK 3S2HK 4QJVA 2A6EA 4A3KC 2E2HC 1YNNA 4YG2A 4BBSC 5FLMC 1XPPA 3H0GC 4KMUA 4LK0A 2NVXC 2VUMC 2NVYK 4G7ZA 3S1RK 4A3IC 4MEXA 1I50C 1TWCK 3HOYC 5C4JK 3H3VL 4NOIA 4A3MC 4LJZA 3HOXC 4BY1K 3K7AK 2WAQD 2R93C 1R9TC 2JA6C 4OINA 1TWFC 1TWGK 3S1MK 4Y7NC 2B63C 3S15C 1I3QC 4A93C 3HOUC 3PO3C 4OIOA 3FKIC 5IYBK 5C3EC 4A3LK 4A3BK 4OIPA 4A3JC 1Y1VC
chains in the Genus database with same CATH superfamily
4XSZA 1IBAA 4GTLA 5D4DA 4IOAS 1TWCA 1I6HC 1WQFA 4GTAA 2EBBA 3I4MC 4BKWA 2ZJQS 1IL2A 3CQZK 1TWGA 5IOTA 3H3VD 3CF5S 4BBRC 3A8IA 2NVQK 3GTPK 2E2JK 2WB1L 3N3YA 1INNA 3HOVK 5CHPA 4LQYA 5IYDK 2V6TA 4ILDA 4XLNA 4KM9A 4FM9A 3GTOA 1Y1WK 4DDQA 3TFIA 3LAPA 5EGHA 3GTQA 2W7VA 3SZYA 4JK1A 4KN7A 1YCLA 4GZYA 4G0WA 2PMZL 2GSOA 3VA7A 3GTGA 4XLPA 1TWFK 5TMCA 3FOFA 3PO3K 3Q3QA 1F7VA 5C3EK 1YNJA 2PA8L 4GTFA 1KQ4A 2GSUA 2A68A 4KDDA 4BY7K 3AD9C 3H0GA 4C3JK 2RGRA 2NVXA 3WODA 4BY1C 4OIRA 2XCOA 3T02A 3S1MC 1O2BA 1RU0A 1IQ0A 3MMLB 3GTLK 1R9TA 1VH2A 2KQ1A 4XCHA 5IYCC 4WFBS 1WQGA 4XSXA 3S1QK 2JA5A 1O26A 3CQZC 3S14K 2CW0A 1I6VA 2NVQC 1HI9A 3GTPC 2E2JC 1AB4A 4YFXA 1X31C 5M5XK 3S17K 1WOPA 3HOVC 4IO9S 1USOA 1IS1A 3BP8C 5IYDC 3A8JA 1O25A 2JA7A 3IPJA 1SFOA 1K83A 3FKIA 2L3UA 3TFJA 3GTJA 4KARA 4KB4A 1TWFC 2ZJRS 3PO3C 5C3EC 4A3LK 3GTMA 4BLAA 5C44K 3LPXA 1ZBSA 2FQOA 4Y52K 4BY7C 5FJ8K 4C3JC 1IW7A 4OIQA 2NVYA 1ISEA 2ZFZA 3G4AA 4A3FK 3T00A 4PAAA 3GTLC 5M3FK 1TWAK 3M3YK 4LOWA 1WIHA 3AD7C 4AYBL 4KAWX 4KATA 4A3CK 4BLBA 4AH6A 5IORA 3K7AC 5JVGS 5HL7S 3S1QC 4QIWL 4BBSK 3A8KA 5IYCK 3S14C 1F7UA 2VUMK 1DCHA 2ZUFA 5L46A 4KASA 4A3IK 1I50K 4PABA 3S17C 1XXCA 3S0XA 4KMAA 2KWAA 2E2IA 1WSVA 4Y7NK 3S15K 1I3QK 2O5IA 1XZPA 2GSNA 1PJ5A 1Y1VK 2E2HA 4GTCA 4C45A 4P5BA 1WCMK 2FQTA 3GTKK 5HQHA 3HKZD 3GEHA 2RH6A 2YU9K 3HOZK 2R7ZK 1J6XA 2R93A 1EH1A 1BDFA 4G7HA 2JA6A 2D6FC 4A3LC 4KM8A 5C44C 2B63A 1PJ6A 1XZQB 1BS2A 4Y52C 1SMYA 1USMA 3HOWK 1C0AA 5CJ9A 3S2DC 1XZQA 3CAGA 4A3FC 2NVTK 1L0WA 2R92K 2CFAB 5JVHS 1TWAC 3M3YC 1TWHK 2Y0SD 3HXAA 2CFAA 4WJ4A 4WFNS 5HL8A 4C3IK 4FZBA 4A3CC 4G0VA 4QJVB 1O24A 5M5WK 4QJVA 4BBSC 1JQWA 2VUMC 3AD8C 4A3IC 3S1RK 4MEXA 1I50C 1TWCK 2XCRB 3H3VL 1B4AA 1DCPA 3K7AK 2WAQD 1IE0A 1TWGK 5JFEA 4Y7NC 4KMDA 3S15C 1I3QC 4OIOA 3FKIC 5IYBK 3AQPA 4A3BK 4OIPA 4GTBA 1Y1VC 1O2FB 2XCQA 1WCMC 2ZUEA 4ZH4A 3GTOK 3GTKC 3N0CA 3S1NK 1WOSA 2YU9C 3HOZC 2R7ZC 2ZJPS 2GAGC 4X6AK 5E68A 3GTQK 5IOQA 3BUEA 1O29A 4P9SA 5IP9K 1HQMA 2PPBA 3HOWC 3GTGK 4YFKA 2JA8K 4WF9S 2BE5A 2NVTC 1O28A 2R92C 1VGXA 2PHCB 3H0GK 2NVXK 1XXBA 1TWHC 3CQZA 3TFHA 3TTGA 3S2DK 4C3IC 3DXJA 3GDZA 4A3MK 3HOXK 3GTPA 3AH5A 1R9TK 2WB1D 4U67S 1DD5A 4A3JK 1Y1WA 3GSIA 3M4OK 5DM7S 3S1RC 1J6VA 1TWCC 3LAJA 5IP7K 4M1XA 1V5VA 5TMFA 2JA5K 4MEYA 4Q4ZA 1EFWA 1TWGC 4A3EK 3RZOK 2KPUA 5IYBC 5C4XK 3L4KA 4A3BC 1TWFA 4LR2A 4KMHA 1PJ7A 3EQLA 2PMZD 1ZVUA 4A3GK 4LLGA 3OEPA 4GTEA 3PIOS 3GTOC 4Q5SA 1XZPB 2O5JA 2JA7K 3S1NC 1SFOK 1K83K 2PA8D 3GEEA 3FKIK 4BXXK 4X6AC 3GTQC 4C3HK 2KXYA 4LK1A 4IOCS 5IP9C 1VLOA 2JH3A 3GTJK 5M5YK 1VJEA 5IOSA 3GTLA 1F9NA 3GTGC 4WCES 3JSTA 4C2MK 2JA8C 3GTMK 3S2HK 1BGWA 4YG2A 4RMFA 1G51A 1XPPA 3H0GC 4LK0A 2NVXC 2NVYK 4G7ZA 3ERED 2P8TA 5C4JK 4NOIA 1DCOA 4A3MC 4LJZA 3HOXC 1R9TC 4OINA 3V4GA 3PIPS 4J3NA 2P5MA 1EI6A 4A3JC 4GFQA 3M4OC 4MQ9A 5IP7C 3RZDK 2JA5C 4WILA 5TJ3A 4A3EC 3RZOC 1GE9A 1ZXOA 4A3DK 5C4XC 4KC6A 3SZZA 2GAHC 3I4NK 5DM6S 4A3GC 3OREA 2E2IK 2V6UA 4P5AA 2JA7C 5M3MK 3S16K 1EK8A 1SFOC 1XXAA 3PO2K 2A6HA 1K83C 4BXXC 3HKZL 4A3KK 2E2HK 4G0UA 4C3HC 5FLMK 2Y3PA 4GT9A 2L5NA 3GTJC 1ZYRA 1O2AA 3HOYK 1TWAA 4C2MC 1JVIA 1JOEA 2R93K 1O27A 2JA6K 3GTMC 3S2HC 4WFAS 2B63K 3NUHA 4A93K 3GIRA 3HOUK 3QX3A 4AYBD 3T01A 2NVYC 4YFNA 3DLLS 1J98A 5JVOA 5C4JC 3BP3A 3L4JA 2VUMA 2Y0SL 2A69A 1BJTA 4QIWD 1WORA 3OPFA 4GTDA 1I50A 1I6HK 3I4MK 1EQRA 1WOOA 1Y1WC 4BBRK 1WQHA 1I3QA 1J6WA 3RZDC 1Y1VA 3FHZA 3GEIA 1WCMA 4KN4A 3LYWA 3GTKA 2WAQL 4A3DC 2YU9A 1UV7A 2R7ZA 3I4NC 3N0BA 4KB2A 4G7OA 2E2IC 1ZQ1C 3S16C 3PO2C 3ADAC 1YX2A 2A6EA 4A3KC 2E2HC 1YNNA 4WJ3M 5FLMC 1VRQC 4KMUA 1F93A 3FOEA 2R92A 2V6SA 3HOYC 1WSRA 1TWHA 4BY1K 1B4BA 1FEUA 2R93C 2JA6C 3S1MK 2B63C 4A93C 3HOUC 3G4CA 4O2DA 3AQOA 5EGEA
chains in the Genus database with same CATH topology
4XSZA 3M4OC 4Y52K 4BY7C 5FJ8K 5D4DA 4MQ9A 4C3JC 5IP7C 1WCMC 3RZDK 1IW7A 4OIQA 4ZH4A 2JA5C 3GTOK 3GTKC 4A3FK 3S1NK 1I6HC 2YU9C 3HOZC 4A3EC 2R7ZC 3I4MC 3RZOC 4X6AK 3GTQK 3GTLC 3CQZK 5M3FK 4A3DK 5C4XC 5IP9K 3H3VD 1TWAK 3M3YK 1HQMA 4BBRC 2NVQK 3I4NK 3GTPK 2E2JK 2WB1L 4AYBL 2PPBA 3HOWC 4A3GC 3GTGK 2E2IK 4A3CK 2JA7C 3HOVK 4YFKA 5M3MK 2JA8K 3S16K 1SFOC 5IYDK 3PO2K 3K7AC 2A6HA 2BE5A 4XLNA 1K83C 2NVTC 3S1QC 4BXXC 3HKZL 4QIWL 4A3KK 1Y1WK 2E2HK 4BBSK 4C3HC 2R92C 5IYCK 5FLMK 3S14C 3H0GK 3GTJC 1ZYRA 2NVXK 2VUMK 1TWHC 4A3IK 1I50K 3S2DK 4C3IC 3HOYK 3DXJA 4JK1A 4KN7A 4C2MC 4A3MK 3S17C 3HOXK 4GZYA 2PMZL 2R93K 1R9TK 2JA6K 4XLPA 3GTMC 3S2HC 1TWFK 5TMCA 4Y7NK 2B63K 3S15K 1I3QK 4A93K 3HOUK 2O5IA 3PO3K 2WB1D 4AYBD 1YNJA 2PA8L 5C3EK 4A3JK 1Y1VK 2NVYC 3M4OK 2A68A 4YFNA 3S1RC 4BY7K 1TWCC 4C3JK 5C4JC 5IP7K 1WCMK 5TMFA 2Y0SL 4MEYA 2JA5K 2A69A 3WODA 4QIWD 3HKZD 4BY1C 4OIRA 3GTKK 1I6HK 2YU9K 3HOZK 4Q4ZA 1TWGC 3S1MC 4A3EK 3I4MK 2R7ZK 3RZOK 3GTLK 1BDFA 5IYBC 4G7HA 5C4XK 1Y1WC 4A3BC 4A3LC 5C44C 5IYCC 4BBRK 4Y52C 1SMYA 3EQLA 2PMZD 3HOWK 4A3GK 3RZDC 4LLGA 3S2DC 4Q5SA 3GTOC 5C44K 2JA7K 2O5JA 4A3FC 3S1NC 1SFOK 4XSXA 4KN4A 1K83K 2PA8D 2NVTK 3FKIK 4BXXK 4X6AC 3S1QK 2WAQL 3GTQC 3CQZC 4A3DC 4C3HK 4LK1A 2R92K 3S14K 2CW0A 5IP9C 3GTJK 1TWAC 3M3YC 1I6VA 2NVQC 3I4NC 1TWHK 5M5YK 3GTPC 2Y0SD 2E2JC 4C3IK 3GTGC 4YFXA 4G7OA 2E2IC 4C2MK 4A3CC 5M5XK 4QJVB 3S17K 3HOVC 2JA8C 3S16C 5IYDC 5M5WK 3PO2C 3GTMK 3S2HK 4QJVA 2A6EA 4A3KC 2E2HC 1YNNA 4YG2A 4BBSC 5FLMC 1XPPA 3H0GC 4KMUA 4LK0A 2NVXC 2VUMC 2NVYK 4G7ZA 3S1RK 4A3IC 4MEXA 1I50C 1TWCK 3HOYC 5C4JK 3H3VL 4NOIA 4A3MC 4LJZA 3HOXC 4BY1K 3K7AK 2WAQD 2R93C 1R9TC 2JA6C 4OINA 1TWFC 1TWGK 3S1MK 4Y7NC 2B63C 3S15C 1I3QC 4A93C 3HOUC 3PO3C 4OIOA 3FKIC 5IYBK 5C3EC 4A3LK 4A3BK 4OIPA 4A3JC 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XSZ A;  3M4O C;  4Y52 K;  4BY7 C;  5FJ8 K;  5D4D A;  4MQ9 A;  4C3J C;  5IP7 C;  1WCM C;  3RZD K;  1IW7 A;  4OIQ A;  4ZH4 A;  2JA5 C;  3GTO K;  3GTK C;  4A3F K;  3S1N K;  1I6H C;  2YU9 C;  3HOZ C;  4A3E C;  2R7Z C;  3I4M C;  3RZO C;  4X6A K;  3GTQ K;  3GTL C;  3CQZ K;  5M3F K;  4A3D K;  5C4X C;  5IP9 K;  3H3V D;  1TWA K;  3M3Y K;  1HQM A;  4BBR C;  2NVQ K;  3I4N K;  3GTP K;  2E2J K;  2WB1 L;  4AYB L;  2PPB A;  3HOW C;  4A3G C;  3GTG K;  2E2I K;  4A3C K;  2JA7 C;  3HOV K;  4YFK A;  5M3M K;  2JA8 K;  3S16 K;  1SFO C;  5IYD K;  3PO2 K;  3K7A C;  2A6H A;  2BE5 A;  4XLN A;  1K83 C;  2NVT C;  3S1Q C;  4BXX C;  3HKZ L;  4QIW L;  4A3K K;  1Y1W K;  2E2H K;  4BBS K;  4C3H C;  2R92 C;  5IYC K;  5FLM K;  3S14 C;  3H0G K;  3GTJ C;  1ZYR A;  2NVX K;  2VUM K;  1TWH C;  4A3I K;  1I50 K;  3S2D K;  4C3I C;  3HOY K;  3DXJ A;  4JK1 A;  4KN7 A;  4C2M C;  4A3M K;  3S17 C;  3HOX K;  4GZY A;  2PMZ L;  2R93 K;  1R9T K;  2JA6 K;  4XLP A;  3GTM C;  3S2H C;  1TWF K;  5TMC A;  4Y7N K;  2B63 K;  3S15 K;  1I3Q K;  4A93 K;  3HOU K;  2O5I A;  3PO3 K;  2WB1 D;  4AYB D;  1YNJ A;  2PA8 L;  5C3E K;  4A3J K;  1Y1V K;  2NVY C;  3M4O K;  2A68 A;  4YFN A;  3S1R C;  4BY7 K;  1TWC C;  4C3J K;  5C4J C;  5IP7 K;  1WCM K;  5TMF A;  2Y0S L;  4MEY A;  2JA5 K;  2A69 A;  3WOD A;  4QIW D;  3HKZ D;  4BY1 C;  4OIR A;  3GTK K;  1I6H K;  2YU9 K;  3HOZ K;  4Q4Z A;  1TWG C;  3S1M C;  4A3E K;  3I4M K;  2R7Z K;  3RZO K;  3GTL K;  1BDF A;  5IYB C;  4G7H A;  5C4X K;  1Y1W C;  4A3B C;  4A3L C;  5C44 C;  5IYC C;  4BBR K;  4Y52 C;  1SMY A;  3EQL A;  2PMZ D;  3HOW K;  4A3G K;  3RZD C;  4LLG A;  3S2D C;  4Q5S A;  3GTO C;  5C44 K;  2JA7 K;  2O5J A;  4A3F C;  3S1N C;  1SFO K;  4XSX A;  4KN4 A;  1K83 K;  2PA8 D;  2NVT K;  3FKI K;  4BXX K;  4X6A C;  3S1Q K;  2WAQ L;  3GTQ C;  3CQZ C;  4A3D C;  4C3H K;  4LK1 A;  2R92 K;  3S14 K;  2CW0 A;  5IP9 C;  3GTJ K;  1TWA C;  3M3Y C;  1I6V A;  2NVQ C;  3I4N C;  1TWH K;  5M5Y K;  3GTP C;  2Y0S D;  2E2J C;  4C3I K;  3GTG C;  4YFX A;  4G7O A;  2E2I C;  4C2M K;  4A3C C;  5M5X K;  4QJV B;  3S17 K;  3HOV C;  2JA8 C;  3S16 C;  5IYD C;  5M5W K;  3PO2 C;  3GTM K;  3S2H K;  4QJV A;  2A6E A;  4A3K C;  2E2H C;  1YNN A;  4YG2 A;  4BBS C;  5FLM C;  1XPP A;  3H0G C;  4KMU A;  4LK0 A;  2NVX C;  2VUM C;  2NVY K;  4G7Z A;  3S1R K;  4A3I C;  4MEX A;  1I50 C;  1TWC K;  3HOY C;  5C4J K;  3H3V L;  4NOI A;  4A3M C;  4LJZ A;  3HOX C;  4BY1 K;  3K7A K;  2WAQ D;  2R93 C;  1R9T C;  2JA6 C;  4OIN A;  1TWF C;  1TWG K;  3S1M K;  4Y7N C;  2B63 C;  3S15 C;  1I3Q C;  4A93 C;  3HOU C;  3PO3 C;  4OIO A;  3FKI C;  5IYB K;  5C3E C;  4A3L K;  4A3B K;  4OIP A;  4A3J C;  1Y1V C; 
#chains in the Genus database with same CATH topology
 4XSZ A;  1IBA A;  4GTL A;  5D4D A;  4IOA S;  1TWC A;  1I6H C;  1WQF A;  4GTA A;  2EBB A;  3I4M C;  4BKW A;  2ZJQ S;  1IL2 A;  3CQZ K;  1TWG A;  5IOT A;  3H3V D;  3CF5 S;  4BBR C;  3A8I A;  2NVQ K;  3GTP K;  2E2J K;  2WB1 L;  3N3Y A;  1INN A;  3HOV K;  5CHP A;  4LQY A;  5IYD K;  2V6T A;  4ILD A;  4XLN A;  4KM9 A;  4FM9 A;  3GTO A;  1Y1W K;  4DDQ A;  3TFI A;  3LAP A;  5EGH A;  3GTQ A;  2W7V A;  3SZY A;  4JK1 A;  4KN7 A;  1YCL A;  4GZY A;  4G0W A;  2PMZ L;  2GSO A;  3VA7 A;  3GTG A;  4XLP A;  1TWF K;  5TMC A;  3FOF A;  3PO3 K;  3Q3Q A;  1F7V A;  5C3E K;  1YNJ A;  2PA8 L;  4GTF A;  1KQ4 A;  2GSU A;  2A68 A;  4KDD A;  4BY7 K;  3AD9 C;  3H0G A;  4C3J K;  2RGR A;  2NVX A;  3WOD A;  4BY1 C;  4OIR A;  2XCO A;  3T02 A;  3S1M C;  1O2B A;  1RU0 A;  1IQ0 A;  3MML B;  3GTL K;  1R9T A;  1VH2 A;  2KQ1 A;  4XCH A;  5IYC C;  4WFB S;  1WQG A;  4XSX A;  3S1Q K;  2JA5 A;  1O26 A;  3CQZ C;  3S14 K;  2CW0 A;  1I6V A;  2NVQ C;  1HI9 A;  3GTP C;  2E2J C;  1AB4 A;  4YFX A;  1X31 C;  5M5X K;  3S17 K;  1WOP A;  3HOV C;  4IO9 S;  1USO A;  1IS1 A;  3BP8 C;  5IYD C;  3A8J A;  1O25 A;  2JA7 A;  3IPJ A;  1SFO A;  1K83 A;  3FKI A;  2L3U A;  3TFJ A;  3GTJ A;  4KAR A;  4KB4 A;  1TWF C;  2ZJR S;  3PO3 C;  5C3E C;  4A3L K;  3GTM A;  4BLA A;  5C44 K;  3LPX A;  1ZBS A;  2FQO A;  4Y52 K;  4BY7 C;  5FJ8 K;  4C3J C;  1IW7 A;  4OIQ A;  2NVY A;  1ISE A;  2ZFZ A;  3G4A A;  4A3F K;  3T00 A;  4PAA A;  3GTL C;  5M3F K;  1TWA K;  3M3Y K;  4LOW A;  1WIH A;  3AD7 C;  4AYB L;  4KAW X;  4KAT A;  4A3C K;  4BLB A;  4AH6 A;  5IOR A;  3K7A C;  5JVG S;  5HL7 S;  3S1Q C;  4QIW L;  4BBS K;  3A8K A;  5IYC K;  3S14 C;  1F7U A;  2VUM K;  1DCH A;  2ZUF A;  5L46 A;  4KAS A;  4A3I K;  1I50 K;  4PAB A;  3S17 C;  1XXC A;  3S0X A;  4KMA A;  2KWA A;  2E2I A;  1WSV A;  4Y7N K;  3S15 K;  1I3Q K;  2O5I A;  1XZP A;  2GSN A;  1PJ5 A;  1Y1V K;  2E2H A;  4GTC A;  4C45 A;  4P5B A;  1WCM K;  2FQT A;  3GTK K;  5HQH A;  3HKZ D;  3GEH A;  2RH6 A;  2YU9 K;  3HOZ K;  2R7Z K;  1J6X A;  2R93 A;  1EH1 A;  1BDF A;  4G7H A;  2JA6 A;  2D6F C;  4A3L C;  4KM8 A;  5C44 C;  2B63 A;  1PJ6 A;  1XZQ B;  1BS2 A;  4Y52 C;  1SMY A;  1USM A;  3HOW K;  1C0A A;  5CJ9 A;  3S2D C;  1XZQ A;  3CAG A;  4A3F C;  2NVT K;  1L0W A;  2R92 K;  2CFA B;  5JVH S;  1TWA C;  3M3Y C;  1TWH K;  2Y0S D;  3HXA A;  2CFA A;  4WJ4 A;  4WFN S;  5HL8 A;  4C3I K;  4FZB A;  4A3C C;  4G0V A;  4QJV B;  1O24 A;  5M5W K;  4QJV A;  4BBS C;  1JQW A;  2VUM C;  3AD8 C;  4A3I C;  3S1R K;  4MEX A;  1I50 C;  1TWC K;  2XCR B;  3H3V L;  1B4A A;  1DCP A;  3K7A K;  2WAQ D;  1IE0 A;  1TWG K;  5JFE A;  4Y7N C;  4KMD A;  3S15 C;  1I3Q C;  4OIO A;  3FKI C;  5IYB K;  3AQP A;  4A3B K;  4OIP A;  4GTB A;  1Y1V C;  1O2F B;  2XCQ A;  1WCM C;  2ZUE A;  4ZH4 A;  3GTO K;  3GTK C;  3N0C A;  3S1N K;  1WOS A;  2YU9 C;  3HOZ C;  2R7Z C;  2ZJP S;  2GAG C;  4X6A K;  5E68 A;  3GTQ K;  5IOQ A;  3BUE A;  1O29 A;  4P9S A;  5IP9 K;  1HQM A;  2PPB A;  3HOW C;  3GTG K;  4YFK A;  2JA8 K;  4WF9 S;  2BE5 A;  2NVT C;  1O28 A;  2R92 C;  1VGX A;  2PHC B;  3H0G K;  2NVX K;  1XXB A;  1TWH C;  3CQZ A;  3TFH A;  3TTG A;  3S2D K;  4C3I C;  3DXJ A;  3GDZ A;  4A3M K;  3HOX K;  3GTP A;  3AH5 A;  1R9T K;  2WB1 D;  4U67 S;  1DD5 A;  4A3J K;  1Y1W A;  3GSI A;  3M4O K;  5DM7 S;  3S1R C;  1J6V A;  1TWC C;  3LAJ A;  5IP7 K;  4M1X A;  1V5V A;  5TMF A;  2JA5 K;  4MEY A;  4Q4Z A;  1EFW A;  1TWG C;  4A3E K;  3RZO K;  2KPU A;  5IYB C;  5C4X K;  3L4K A;  4A3B C;  1TWF A;  4LR2 A;  4KMH A;  1PJ7 A;  3EQL A;  2PMZ D;  1ZVU A;  4A3G K;  4LLG A;  3OEP A;  4GTE A;  3PIO S;  3GTO C;  4Q5S A;  1XZP B;  2O5J A;  2JA7 K;  3S1N C;  1SFO K;  1K83 K;  2PA8 D;  3GEE A;  3FKI K;  4BXX K;  4X6A C;  3GTQ C;  4C3H K;  2KXY A;  4LK1 A;  4IOC S;  5IP9 C;  1VLO A;  2JH3 A;  3GTJ K;  5M5Y K;  1VJE A;  5IOS A;  3GTL A;  1F9N A;  3GTG C;  4WCE S;  3JST A;  4C2M K;  2JA8 C;  3GTM K;  3S2H K;  1BGW A;  4YG2 A;  4RMF A;  1G51 A;  1XPP A;  3H0G C;  4LK0 A;  2NVX C;  2NVY K;  4G7Z A;  3ERE D;  2P8T A;  5C4J K;  4NOI A;  1DCO A;  4A3M C;  4LJZ A;  3HOX C;  1R9T C;  4OIN A;  3V4G A;  3PIP S;  4J3N A;  2P5M A;  1EI6 A;  4A3J C;  4GFQ A;  3M4O C;  4MQ9 A;  5IP7 C;  3RZD K;  2JA5 C;  4WIL A;  5TJ3 A;  4A3E C;  3RZO C;  1GE9 A;  1ZXO A;  4A3D K;  5C4X C;  4KC6 A;  3SZZ A;  2GAH C;  3I4N K;  5DM6 S;  4A3G C;  3ORE A;  2E2I K;  2V6U A;  4P5A A;  2JA7 C;  5M3M K;  3S16 K;  1EK8 A;  1SFO C;  1XXA A;  3PO2 K;  2A6H A;  1K83 C;  4BXX C;  3HKZ L;  4A3K K;  2E2H K;  4G0U A;  4C3H C;  5FLM K;  2Y3P A;  4GT9 A;  2L5N A;  3GTJ C;  1ZYR A;  1O2A A;  3HOY K;  1TWA A;  4C2M C;  1JVI A;  1JOE A;  2R93 K;  1O27 A;  2JA6 K;  3GTM C;  3S2H C;  4WFA S;  2B63 K;  3NUH A;  4A93 K;  3GIR A;  3HOU K;  3QX3 A;  4AYB D;  3T01 A;  2NVY C;  4YFN A;  3DLL S;  1J98 A;  5JVO A;  5C4J C;  3BP3 A;  3L4J A;  2VUM A;  2Y0S L;  2A69 A;  1BJT A;  4QIW D;  1WOR A;  3OPF A;  4GTD A;  1I50 A;  1I6H K;  3I4M K;  1EQR A;  1WOO A;  1Y1W C;  4BBR K;  1WQH A;  1I3Q A;  1J6W A;  3RZD C;  1Y1V A;  3FHZ A;  3GEI A;  1WCM A;  4KN4 A;  3LYW A;  3GTK A;  2WAQ L;  4A3D C;  2YU9 A;  1UV7 A;  2R7Z A;  3I4N C;  3N0B A;  4KB2 A;  4G7O A;  2E2I C;  1ZQ1 C;  3S16 C;  3PO2 C;  3ADA C;  1YX2 A;  2A6E A;  4A3K C;  2E2H C;  1YNN A;  4WJ3 M;  5FLM C;  1VRQ C;  4KMU A;  1F93 A;  3FOE A;  2R92 A;  2V6S A;  3HOY C;  1WSR A;  1TWH A;  4BY1 K;  1B4B A;  1FEU A;  2R93 C;  2JA6 C;  3S1M K;  2B63 C;  4A93 C;  3HOU C;  3G4C A;  4O2D A;  3AQO A;  5EGE A; 
#chains in the Genus database with same CATH homology
 4XSZ A;  3M4O C;  4Y52 K;  4BY7 C;  5FJ8 K;  5D4D A;  4MQ9 A;  4C3J C;  5IP7 C;  1WCM C;  3RZD K;  1IW7 A;  4OIQ A;  4ZH4 A;  2JA5 C;  3GTO K;  3GTK C;  4A3F K;  3S1N K;  1I6H C;  2YU9 C;  3HOZ C;  4A3E C;  2R7Z C;  3I4M C;  3RZO C;  4X6A K;  3GTQ K;  3GTL C;  3CQZ K;  5M3F K;  4A3D K;  5C4X C;  5IP9 K;  3H3V D;  1TWA K;  3M3Y K;  1HQM A;  4BBR C;  2NVQ K;  3I4N K;  3GTP K;  2E2J K;  2WB1 L;  4AYB L;  2PPB A;  3HOW C;  4A3G C;  3GTG K;  2E2I K;  4A3C K;  2JA7 C;  3HOV K;  4YFK A;  5M3M K;  2JA8 K;  3S16 K;  1SFO C;  5IYD K;  3PO2 K;  3K7A C;  2A6H A;  2BE5 A;  4XLN A;  1K83 C;  2NVT C;  3S1Q C;  4BXX C;  3HKZ L;  4QIW L;  4A3K K;  1Y1W K;  2E2H K;  4BBS K;  4C3H C;  2R92 C;  5IYC K;  5FLM K;  3S14 C;  3H0G K;  3GTJ C;  1ZYR A;  2NVX K;  2VUM K;  1TWH C;  4A3I K;  1I50 K;  3S2D K;  4C3I C;  3HOY K;  3DXJ A;  4JK1 A;  4KN7 A;  4C2M C;  4A3M K;  3S17 C;  3HOX K;  4GZY A;  2PMZ L;  2R93 K;  1R9T K;  2JA6 K;  4XLP A;  3GTM C;  3S2H C;  1TWF K;  5TMC A;  4Y7N K;  2B63 K;  3S15 K;  1I3Q K;  4A93 K;  3HOU K;  2O5I A;  3PO3 K;  2WB1 D;  4AYB D;  1YNJ A;  2PA8 L;  5C3E K;  4A3J K;  1Y1V K;  2NVY C;  3M4O K;  2A68 A;  4YFN A;  3S1R C;  4BY7 K;  1TWC C;  4C3J K;  5C4J C;  5IP7 K;  1WCM K;  5TMF A;  2Y0S L;  4MEY A;  2JA5 K;  2A69 A;  3WOD A;  4QIW D;  3HKZ D;  4BY1 C;  4OIR A;  3GTK K;  1I6H K;  2YU9 K;  3HOZ K;  4Q4Z A;  1TWG C;  3S1M C;  4A3E K;  3I4M K;  2R7Z K;  3RZO K;  3GTL K;  1BDF A;  5IYB C;  4G7H A;  5C4X K;  1Y1W C;  4A3B C;  4A3L C;  5C44 C;  5IYC C;  4BBR K;  4Y52 C;  1SMY A;  3EQL A;  2PMZ D;  3HOW K;  4A3G K;  3RZD C;  4LLG A;  3S2D C;  4Q5S A;  3GTO C;  5C44 K;  2JA7 K;  2O5J A;  4A3F C;  3S1N C;  1SFO K;  4XSX A;  4KN4 A;  1K83 K;  2PA8 D;  2NVT K;  3FKI K;  4BXX K;  4X6A C;  3S1Q K;  2WAQ L;  3GTQ C;  3CQZ C;  4A3D C;  4C3H K;  4LK1 A;  2R92 K;  3S14 K;  2CW0 A;  5IP9 C;  3GTJ K;  1TWA C;  3M3Y C;  1I6V A;  2NVQ C;  3I4N C;  1TWH K;  5M5Y K;  3GTP C;  2Y0S D;  2E2J C;  4C3I K;  3GTG C;  4YFX A;  4G7O A;  2E2I C;  4C2M K;  4A3C C;  5M5X K;  4QJV B;  3S17 K;  3HOV C;  2JA8 C;  3S16 C;  5IYD C;  5M5W K;  3PO2 C;  3GTM K;  3S2H K;  4QJV A;  2A6E A;  4A3K C;  2E2H C;  1YNN A;  4YG2 A;  4BBS C;  5FLM C;  1XPP A;  3H0G C;  4KMU A;  4LK0 A;  2NVX C;  2VUM C;  2NVY K;  4G7Z A;  3S1R K;  4A3I C;  4MEX A;  1I50 C;  1TWC K;  3HOY C;  5C4J K;  3H3V L;  4NOI A;  4A3M C;  4LJZ A;  3HOX C;  4BY1 K;  3K7A K;  2WAQ D;  2R93 C;  1R9T C;  2JA6 C;  4OIN A;  1TWF C;  1TWG K;  3S1M K;  4Y7N C;  2B63 C;  3S15 C;  1I3Q C;  4A93 C;  3HOU C;  3PO3 C;  4OIO A;  3FKI C;  5IYB K;  5C3E C;  4A3L K;  4A3B K;  4OIP A;  4A3J C;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...