4MQ9A

Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with ge23077
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 49
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4mq9A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4mq9A01
4Q5SA 1Y1VC 4YFXA 4OIOA 1SFOK 4BBSK 2A6HA 4A3JC 4BY7K 4A3LC 3I4NK 2NVXC 3GTJK 3H3VL 5C3EK 2R92K 3GTMK 1K83K 4MQ9A 3PO3C 4G7HA 4BBSC 2YU9C 4Y52K 1TWFK 4BY7C 4LK0A 2PA8L 4C3IK 4BXXK 3I4NC 3RZOK 3GTJC 4C3JK 4XLNA 3S1MK 5C3EC 2JA8K 1K83C 4GZYA 4OINA 2JA6K 2A6EA 3HKZL 5IYBK 4QIWD 4Y52C 1TWFC 4BXXC 4C3IC 4A3DK 4A3EC 5TMCA 3HOVK 1I50K 3RZOC 4A93K 4C3JC 3S14C 2O5JA 3S1MC 3HOUK 3S1NK 3I4MK 3GTQK 2JA8C 3RZDK 4A3CK 3M4OK 2JA6C 4ZH4A 4A3MC 5IP9K 4KMUA 3S1QK 4A3GK 5IYBC 2E2IC 4A3DC 3HOVC 4OIQA 5M3MK 4A93C 3HOUC 3S2HK 2WB1D 3S1NC 2B63K 2E2JC 3GTQC 3RZDC 4A3CC 4C2MK 3M4OC 3HOWK 3GTGK 5IP9C 3S1QC 4A3GC 2A68A 4OIRA 4XLPA 1R9TK 2JA5K 4BBRK 1SFOC 3FKIK 2E2HK 3S16K 1I6HK 2WAQL 4KN4A 3S2HC 1TWGK 5IYCK 4AYBD 5M3FK 4C2MC 3HOWC 2R92C 3GTMC 2Y0SL 3GTGC 4NOIA 1Y1WK 2PPBA 2PMZL 2JA5C 5IP7K 2R7ZK 3S15K 1R9TC 4BBRC 4A3KK 3FKIC 2E2HC 1I6HC 3DXJA 1TWHK 4XSXA 5IYCC 5M5XK 4LJZA 2R93K 1Y1WC 5IP7C 4Y7NK 4BY1K 3S15C 2CW0A 4A3KC 4LK1A 4G7OA 3HOZK 2O5IA 1XPPA 1TWHC 3S2DK 5M5WK 1I50C 5TMFA 4X6AK 2R93C 3I4MC 2NVQK 3H3VD 5D4DA 1TWAK 5C4XK 5C44K 4Y7NC 4BY1C 3GTLK 3GTPK 3GTOK 4A3FK 1YNJA 4QJVA 2NVYK 1TWCK 3H0GK 3S1RK 5IYDK 3S2DC 4Q4ZA 2PA8D 2NVTK 4X6AC 2B63C 2NVQC 4QIWL 1TWAC 5C4XC 1I3QK 4C3HK 3GTPC 4QJVB 4A3LK 4A3FC 2NVYC 3GTKK 1TWCC 3K7AK 3H0GC 3S1RC 5M5YK 5IYDC 4OIPA 4G7ZA 1BDFA 3S16C 4A3IK 3M3YK 2NVTC 3PO2K 1SMYA 4YG2A 1ZYRA 1TWGC 2VUMK 1I3QC 2YU9K 3HOYK 4C3HC 1WCMK 2R7ZC 2WB1L 3GTKC 3K7AC 3CQZK 4A3IC 3M3YC 3PO2C 1YNNA 2A69A 4KN7A 4MEYA 4YFKA 2VUMC 3HOYC 5C4JK 4JK1A 4A3EK 1WCMC 4MEXA 4XSZA 3S17K 3S14K 3CQZC 3WODA 4AYBL 4A3BK 3HOZC 3HOXK 4A3MK 2JA7K 2WAQD 3EQLA 5FLMK 5C4JC 2BE5A 4YFNA 1Y1VK 2E2IK 1I6VA 2Y0SD 5C44C 1IW7A 2PMZD 3GTLC 4A3JK 3GTOC 3S17C 5FJ8K 2NVXK 3HKZD 4A3BC 2E2JK 3HOXC 2JA7C 1HQMA 5FLMC 3PO3K 4LLGA
chains in the Genus database with same CATH superfamily
4OIOA 4RMFA 4IOCS 4A3JC 2E2IA 1O27A 3GTJK 3H3VL 2R92K 4MQ9A 2KQ1A 2YU9C 1TWFK 1USOA 2PA8L 4C3IK 1SFOA 4WCES 2FQTA 1UV7A 1BS2A 4GTBA 4C3JK 4XLNA 2P8TA 3L4JA 5EGEA 1K83C 4KMHA 4BLBA 2JA8K 4GZYA 2W7VA 3GTMA 3GTGA 4Y52C 4BXXC 1XZQA 2FQOA 4GTEA 1R9TA 5CJ9A 1RU0A 3HOVK 4A93K 3HOUK 3RZDK 3QX3A 4ZH4A 1XZPA 3G4AA 5IP9K 4KMUA 4BLAA 4FM9A 5IYBC 1O25A 4A3DC 1WQGA 3AD7C 3S1NC 1USMA 3S0XA 4A3CC 2CFAA 4C2MK 3M4OC 1I50A 3GTGK 4A3GC 1R9TK 2E2HK 1WOOA 2RH6A 3S2HC 4WJ3M 3PIPS 3HOWC 3BP8C 1Y1WK 2PMZL 2B63A 2JA5C 3S15K 4BBRC 1PJ6A 1TWHK 1IQ0A 4XSXA 4KMAA 3N3YA 4XCHA 5IOQA 4GTCA 1TWGA 5IP7C 3GEIA 4BY1K 1DCHA 2CW0A 5M5WK 3FOEA 4X6AK 2R93C 4GTFA 2R93A 4A3FK 1YNJA 3S2DC 4PABA 2NVQC 1JVIA 3IPJA 5C4XC 1I3QK 1DD5A 2KPUA 2GAHC 3K7AK 3S1RC 2GSOA 4A3IK 4C3HC 2R7ZC 4WILA 3GTKC 4KB4A 3PO2C 1YNNA 5C4JK 2L5NA 3FOFA 4A3EK 1WCMC 3S17K 2XCQA 3WODA 3S14K 1EH1A 1O2AA 1GE9A 3N0BA 2Y0SD 5C44C 5CHPA 1EQRA 2NVXK 3HKZD 2E2JK 1C0AA 3PO3K 1Y1VC 4YFXA 3DLLS 2JA6A 5IORA 4BY7K 1Y1VA 5IOSA 4M1XA 4WFAS 1WQFA 5C3EK 2XCRB 4G0VA 3GTQA 4FZBA 4G7HA 4LK0A 1DCOA 3GTJC 2ZJRS 1WSRA 1EFWA 5JVGS 5IOTA 3GTJA 2V6TA 2JA6K 4OINA 2R92A 4QIWD 1TWFC 4C3IC 5DM7S 3N0CA 4C3JC 1TWFA 3GTQK 2JA8C 2KXYA 1XZQB 2E2IC 5TJ3A 3HOVC 5M3MK 4A93C 3HOUC 2ZJPS 1VLOA 5DM6S 3RZDC 1XZPB 1ZBSA 3HXAA 5IP9C 1SFOC 3S16K 1XXBA 2WAQL 2CFAB 5IYCK 5M3FK 4C2MC 3GTMC 3GTGC 4NOIA 4BKWA 1TWAA 1R9TC 4A3KK 2E2HC 2ZFZA 3G4CA 3H0GA 2E2HA 1J98A 1KQ4A 4LJZA 1Y1WC 4KM8A 4Y7NK 3S15C 1Y1WA 4LK1A 3HOZK 2O5IA 1TWHC 1I50C 4J3NA 1HI9A 1TWHA 3I4MC 3H3VD 1DCPA 1XXAA 1TWAK 3FHZA 4BY1C 3GTLK 3GTOK 5JFEA 5L46A 3H0GK 1JOEA 5IYDK 3BP3A 2RGRA 2PA8D 1IS1A 3AH5A 2NVTK 1O2BA 4X6AC 2B63C 1WORA 4A3FC 5M5YK 4OIPA 4G7ZA 2PHCB 3AD8C 2ZUEA 1TWGC 3ERED 3AQOA 4P9SA 3LPXA 2VUMK 1I3QC 2YU9K 1V5VA 3HOYK 4KDDA 3VA7A 3TFJA 5HL8A 2WB1L 1I3QA 3K7AC 1WIHA 4A3IC 4KATA 4AH6A 4XSZA 3CF5S 4AYBL 4A3BK 1J6XA 3HOXK 2JA7K 5C4JC 2BE5A 4YFNA 1I6VA 2PMZD 3S17C 2XCOA 3LAPA 1WOSA 4ILDA 4Q5SA 5JVHS 1O2FB 4BBSK 1G51A 4A3LC 4O2DA 3I4NK 2NVXC 2NVXA 3PO3C 1BGWA 2Y3PA 1FEUA 1AB4A 3PIOS 4BY7C 4DDQA 3RZOK 4G0WA 3S1MK 5C3EC 1VRQC 3HKZL 2GSUA 5E68A 4GTLA 3OEPA 2O5JA 4C45A 4LOWA 2JA6C 4A3MC 3S1QK 3AQPA 3OPFA 3T00A 3GTQC 3TFIA 4KASA 2A68A 3FKIK 1I6HK 4KN4A 2R92C 3A8IA 4GT9A 2V6SA 2R7ZK 3Q3QA 4GTDA 3DXJA 3TFHA 5IYCC 2L3UA 1EK8A 4A3KC 4G7OA 4KARA 1ZQ1C 1PJ7A 3NUHA 5C44K 4Y7NC 3GTPK 4QJVA 2NVYK 1TWCK 3ADAC 1IE0A 5EGHA 1TWAC 2D6FC 3GDZA 3H0GC 3GTLA 5IYDC 3GTOA 3M3YK 2NVTC 3GIRA 5HQHA 3GEEA 1WOPA 3JSTA 4WJ4A 3CQZK 3CAGA 4KN7A 4MEYA 2VUMC 3HOYC 2KWAA 2VUMA 2YU9A 2GSNA 3TTGA 2ZUFA 2WAQD 3EQLA 4WFNS 5FLMK 1F7VA 1K83A 2E2IK 4G0UA 1WQHA 1O24A 1O28A 4A3JK 1IW7A 5FJ8K 3V4GA 1EI6A 4A3BC 3HOXC 1IL2A 2JA7C 1HQMA 3OREA 3SZZA 1PJ5A 1SFOK 2JA7A 2A6HA 1ISEA 1IBAA 4U67S 3GTMK 4KMDA 1K83K 4BBSC 3L4KA 4Y52K 4BXXK 3I4NC 4WF9S 1F9NA 1BJTA 3A8JA 2A6EA 5IYBK 2JA5A 4A3DK 3A8KA 4A3EC 5TMCA 1I50K 3RZOC 1O26A 3GEHA 3S14C 3AD9C 3S1MC 3S1NK 3I4MK 4A3CK 4KC6A 3M4OK 3LAJA 4A3GK 1J6VA 4OIQA 1INNA 1YCLA 3S2HK 2WB1D 2B63K 4IOAS 3LYWA 2E2JC 4P5BA 3HOWK 4WFBS 2JA5K 3S1QC 4OIRA 4XLPA 4LR2A 4BBRK 4KB2A 3GSIA 1TWGK 4AYBD 2Y0SL 2PPBA 5IP7K 5JVOA 1F93A 3FKIC 1VGXA 1ZVUA 3T02A 1B4BA 1ZXOA 1I6HC 3FKIA 4KM9A 5M5XK 2R93K 4LQYA 4GTAA 4KAWX 3SZYA 2R7ZA 1XPPA 3S2DK 3GTKA 1X31C 2V6UA 5TMFA 1VH2A 2JH3A 2GAGC 2NVQK 5D4DA 5C4XK 4GFQA 1WCMA 3S1RK 1B4AA 4Q4ZA 3MMLB 3BUEA 4QIWL 4C3HK 1WSVA 3GTPC 4QJVB 4A3LK 2EBBA 2NVYC 3GTKK 1TWCC 3GTPA 1L0WA 3S16C 1BDFA 1F7UA 2NVYA 1TWCA 3PO2K 1SMYA 4YG2A 1ZYRA 5HL7S 1XXCA 1YX2A 1WCMK 1VJEA 3M3YC 1J6WA 2A69A 4YFKA 4JK1A 4MEXA 1O29A 3T01A 3CQZC 3HOZC 1JQWA 2P5MA 3CQZA 4A3MK 1Y1VK 4P5AA 3GTLC 4IO9S 3GTOC 4PAAA 2ZJQS 5FLMC 4LLGA
chains in the Genus database with same CATH topology
4Q5SA 1Y1VC 4YFXA 4OIOA 1SFOK 4BBSK 2A6HA 4A3JC 4BY7K 4A3LC 3I4NK 2NVXC 3GTJK 3H3VL 5C3EK 2R92K 3GTMK 1K83K 4MQ9A 3PO3C 4G7HA 4BBSC 2YU9C 4Y52K 1TWFK 4BY7C 4LK0A 2PA8L 4C3IK 4BXXK 3I4NC 3RZOK 3GTJC 4C3JK 4XLNA 3S1MK 5C3EC 2JA8K 1K83C 4GZYA 4OINA 2JA6K 2A6EA 3HKZL 5IYBK 4QIWD 4Y52C 1TWFC 4BXXC 4C3IC 4A3DK 4A3EC 5TMCA 3HOVK 1I50K 3RZOC 4A93K 4C3JC 3S14C 2O5JA 3S1MC 3HOUK 3S1NK 3I4MK 3GTQK 2JA8C 3RZDK 4A3CK 3M4OK 2JA6C 4ZH4A 4A3MC 5IP9K 4KMUA 3S1QK 4A3GK 5IYBC 2E2IC 4A3DC 3HOVC 4OIQA 5M3MK 4A93C 3HOUC 3S2HK 2WB1D 3S1NC 2B63K 2E2JC 3GTQC 3RZDC 4A3CC 4C2MK 3M4OC 3HOWK 3GTGK 5IP9C 3S1QC 4A3GC 2A68A 4OIRA 4XLPA 1R9TK 2JA5K 4BBRK 1SFOC 3FKIK 2E2HK 3S16K 1I6HK 2WAQL 4KN4A 3S2HC 1TWGK 5IYCK 4AYBD 5M3FK 4C2MC 3HOWC 2R92C 3GTMC 2Y0SL 3GTGC 4NOIA 1Y1WK 2PPBA 2PMZL 2JA5C 5IP7K 2R7ZK 3S15K 1R9TC 4BBRC 4A3KK 3FKIC 2E2HC 1I6HC 3DXJA 1TWHK 4XSXA 5IYCC 5M5XK 4LJZA 2R93K 1Y1WC 5IP7C 4Y7NK 4BY1K 3S15C 2CW0A 4A3KC 4LK1A 4G7OA 3HOZK 2O5IA 1XPPA 1TWHC 3S2DK 5M5WK 1I50C 5TMFA 4X6AK 2R93C 3I4MC 2NVQK 3H3VD 5D4DA 1TWAK 5C4XK 5C44K 4Y7NC 4BY1C 3GTLK 3GTPK 3GTOK 4A3FK 1YNJA 4QJVA 2NVYK 1TWCK 3H0GK 3S1RK 5IYDK 3S2DC 4Q4ZA 2PA8D 2NVTK 4X6AC 2B63C 2NVQC 4QIWL 1TWAC 5C4XC 1I3QK 4C3HK 3GTPC 4QJVB 4A3LK 4A3FC 2NVYC 3GTKK 1TWCC 3K7AK 3H0GC 3S1RC 5M5YK 5IYDC 4OIPA 4G7ZA 1BDFA 3S16C 4A3IK 3M3YK 2NVTC 3PO2K 1SMYA 4YG2A 1ZYRA 1TWGC 2VUMK 1I3QC 2YU9K 3HOYK 4C3HC 1WCMK 2R7ZC 2WB1L 3GTKC 3K7AC 3CQZK 4A3IC 3M3YC 3PO2C 1YNNA 2A69A 4KN7A 4MEYA 4YFKA 2VUMC 3HOYC 5C4JK 4JK1A 4A3EK 1WCMC 4MEXA 4XSZA 3S17K 3S14K 3CQZC 3WODA 4AYBL 4A3BK 3HOZC 3HOXK 4A3MK 2JA7K 2WAQD 3EQLA 5FLMK 5C4JC 2BE5A 4YFNA 1Y1VK 2E2IK 1I6VA 2Y0SD 5C44C 1IW7A 2PMZD 3GTLC 4A3JK 3GTOC 3S17C 5FJ8K 2NVXK 3HKZD 4A3BC 2E2JK 3HOXC 2JA7C 1HQMA 5FLMC 3PO3K 4LLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5S A;  1Y1V C;  4YFX A;  4OIO A;  1SFO K;  4BBS K;  2A6H A;  4A3J C;  4BY7 K;  4A3L C;  3I4N K;  2NVX C;  3GTJ K;  3H3V L;  5C3E K;  2R92 K;  3GTM K;  1K83 K;  4MQ9 A;  3PO3 C;  4G7H A;  4BBS C;  2YU9 C;  4Y52 K;  1TWF K;  4BY7 C;  4LK0 A;  2PA8 L;  4C3I K;  4BXX K;  3I4N C;  3RZO K;  3GTJ C;  4C3J K;  4XLN A;  3S1M K;  5C3E C;  2JA8 K;  1K83 C;  4GZY A;  4OIN A;  2JA6 K;  2A6E A;  3HKZ L;  5IYB K;  4QIW D;  4Y52 C;  1TWF C;  4BXX C;  4C3I C;  4A3D K;  4A3E C;  5TMC A;  3HOV K;  1I50 K;  3RZO C;  4A93 K;  4C3J C;  3S14 C;  2O5J A;  3S1M C;  3HOU K;  3S1N K;  3I4M K;  3GTQ K;  2JA8 C;  3RZD K;  4A3C K;  3M4O K;  2JA6 C;  4ZH4 A;  4A3M C;  5IP9 K;  4KMU A;  3S1Q K;  4A3G K;  5IYB C;  2E2I C;  4A3D C;  3HOV C;  4OIQ A;  5M3M K;  4A93 C;  3HOU C;  3S2H K;  2WB1 D;  3S1N C;  2B63 K;  2E2J C;  3GTQ C;  3RZD C;  4A3C C;  4C2M K;  3M4O C;  3HOW K;  3GTG K;  5IP9 C;  3S1Q C;  4A3G C;  2A68 A;  4OIR A;  4XLP A;  1R9T K;  2JA5 K;  4BBR K;  1SFO C;  3FKI K;  2E2H K;  3S16 K;  1I6H K;  2WAQ L;  4KN4 A;  3S2H C;  1TWG K;  5IYC K;  4AYB D;  5M3F K;  4C2M C;  3HOW C;  2R92 C;  3GTM C;  2Y0S L;  3GTG C;  4NOI A;  1Y1W K;  2PPB A;  2PMZ L;  2JA5 C;  5IP7 K;  2R7Z K;  3S15 K;  1R9T C;  4BBR C;  4A3K K;  3FKI C;  2E2H C;  1I6H C;  3DXJ A;  1TWH K;  4XSX A;  5IYC C;  5M5X K;  4LJZ A;  2R93 K;  1Y1W C;  5IP7 C;  4Y7N K;  4BY1 K;  3S15 C;  2CW0 A;  4A3K C;  4LK1 A;  4G7O A;  3HOZ K;  2O5I A;  1XPP A;  1TWH C;  3S2D K;  5M5W K;  1I50 C;  5TMF A;  4X6A K;  2R93 C;  3I4M C;  2NVQ K;  3H3V D;  5D4D A;  1TWA K;  5C4X K;  5C44 K;  4Y7N C;  4BY1 C;  3GTL K;  3GTP K;  3GTO K;  4A3F K;  1YNJ A;  4QJV A;  2NVY K;  1TWC K;  3H0G K;  3S1R K;  5IYD K;  3S2D C;  4Q4Z A;  2PA8 D;  2NVT K;  4X6A C;  2B63 C;  2NVQ C;  4QIW L;  1TWA C;  5C4X C;  1I3Q K;  4C3H K;  3GTP C;  4QJV B;  4A3L K;  4A3F C;  2NVY C;  3GTK K;  1TWC C;  3K7A K;  3H0G C;  3S1R C;  5M5Y K;  5IYD C;  4OIP A;  4G7Z A;  1BDF A;  3S16 C;  4A3I K;  3M3Y K;  2NVT C;  3PO2 K;  1SMY A;  4YG2 A;  1ZYR A;  1TWG C;  2VUM K;  1I3Q C;  2YU9 K;  3HOY K;  4C3H C;  1WCM K;  2R7Z C;  2WB1 L;  3GTK C;  3K7A C;  3CQZ K;  4A3I C;  3M3Y C;  3PO2 C;  1YNN A;  2A69 A;  4KN7 A;  4MEY A;  4YFK A;  2VUM C;  3HOY C;  5C4J K;  4JK1 A;  4A3E K;  1WCM C;  4MEX A;  4XSZ A;  3S17 K;  3S14 K;  3CQZ C;  3WOD A;  4AYB L;  4A3B K;  3HOZ C;  3HOX K;  4A3M K;  2JA7 K;  2WAQ D;  3EQL A;  5FLM K;  5C4J C;  2BE5 A;  4YFN A;  1Y1V K;  2E2I K;  1I6V A;  2Y0S D;  5C44 C;  1IW7 A;  2PMZ D;  3GTL C;  4A3J K;  3GTO C;  3S17 C;  5FJ8 K;  2NVX K;  3HKZ D;  4A3B C;  2E2J K;  3HOX C;  2JA7 C;  1HQM A;  5FLM C;  3PO3 K;  4LLG A; 
#chains in the Genus database with same CATH topology
 4OIO A;  4RMF A;  4IOC S;  4A3J C;  2E2I A;  1O27 A;  3GTJ K;  3H3V L;  2R92 K;  4MQ9 A;  2KQ1 A;  2YU9 C;  1TWF K;  1USO A;  2PA8 L;  4C3I K;  1SFO A;  4WCE S;  2FQT A;  1UV7 A;  1BS2 A;  4GTB A;  4C3J K;  4XLN A;  2P8T A;  3L4J A;  5EGE A;  1K83 C;  4KMH A;  4BLB A;  2JA8 K;  4GZY A;  2W7V A;  3GTM A;  3GTG A;  4Y52 C;  4BXX C;  1XZQ A;  2FQO A;  4GTE A;  1R9T A;  5CJ9 A;  1RU0 A;  3HOV K;  4A93 K;  3HOU K;  3RZD K;  3QX3 A;  4ZH4 A;  1XZP A;  3G4A A;  5IP9 K;  4KMU A;  4BLA A;  4FM9 A;  5IYB C;  1O25 A;  4A3D C;  1WQG A;  3AD7 C;  3S1N C;  1USM A;  3S0X A;  4A3C C;  2CFA A;  4C2M K;  3M4O C;  1I50 A;  3GTG K;  4A3G C;  1R9T K;  2E2H K;  1WOO A;  2RH6 A;  3S2H C;  4WJ3 M;  3PIP S;  3HOW C;  3BP8 C;  1Y1W K;  2PMZ L;  2B63 A;  2JA5 C;  3S15 K;  4BBR C;  1PJ6 A;  1TWH K;  1IQ0 A;  4XSX A;  4KMA A;  3N3Y A;  4XCH A;  5IOQ A;  4GTC A;  1TWG A;  5IP7 C;  3GEI A;  4BY1 K;  1DCH A;  2CW0 A;  5M5W K;  3FOE A;  4X6A K;  2R93 C;  4GTF A;  2R93 A;  4A3F K;  1YNJ A;  3S2D C;  4PAB A;  2NVQ C;  1JVI A;  3IPJ A;  5C4X C;  1I3Q K;  1DD5 A;  2KPU A;  2GAH C;  3K7A K;  3S1R C;  2GSO A;  4A3I K;  4C3H C;  2R7Z C;  4WIL A;  3GTK C;  4KB4 A;  3PO2 C;  1YNN A;  5C4J K;  2L5N A;  3FOF A;  4A3E K;  1WCM C;  3S17 K;  2XCQ A;  3WOD A;  3S14 K;  1EH1 A;  1O2A A;  1GE9 A;  3N0B A;  2Y0S D;  5C44 C;  5CHP A;  1EQR A;  2NVX K;  3HKZ D;  2E2J K;  1C0A A;  3PO3 K;  1Y1V C;  4YFX A;  3DLL S;  2JA6 A;  5IOR A;  4BY7 K;  1Y1V A;  5IOS A;  4M1X A;  4WFA S;  1WQF A;  5C3E K;  2XCR B;  4G0V A;  3GTQ A;  4FZB A;  4G7H A;  4LK0 A;  1DCO A;  3GTJ C;  2ZJR S;  1WSR A;  1EFW A;  5JVG S;  5IOT A;  3GTJ A;  2V6T A;  2JA6 K;  4OIN A;  2R92 A;  4QIW D;  1TWF C;  4C3I C;  5DM7 S;  3N0C A;  4C3J C;  1TWF A;  3GTQ K;  2JA8 C;  2KXY A;  1XZQ B;  2E2I C;  5TJ3 A;  3HOV C;  5M3M K;  4A93 C;  3HOU C;  2ZJP S;  1VLO A;  5DM6 S;  3RZD C;  1XZP B;  1ZBS A;  3HXA A;  5IP9 C;  1SFO C;  3S16 K;  1XXB A;  2WAQ L;  2CFA B;  5IYC K;  5M3F K;  4C2M C;  3GTM C;  3GTG C;  4NOI A;  4BKW A;  1TWA A;  1R9T C;  4A3K K;  2E2H C;  2ZFZ A;  3G4C A;  3H0G A;  2E2H A;  1J98 A;  1KQ4 A;  4LJZ A;  1Y1W C;  4KM8 A;  4Y7N K;  3S15 C;  1Y1W A;  4LK1 A;  3HOZ K;  2O5I A;  1TWH C;  1I50 C;  4J3N A;  1HI9 A;  1TWH A;  3I4M C;  3H3V D;  1DCP A;  1XXA A;  1TWA K;  3FHZ A;  4BY1 C;  3GTL K;  3GTO K;  5JFE A;  5L46 A;  3H0G K;  1JOE A;  5IYD K;  3BP3 A;  2RGR A;  2PA8 D;  1IS1 A;  3AH5 A;  2NVT K;  1O2B A;  4X6A C;  2B63 C;  1WOR A;  4A3F C;  5M5Y K;  4OIP A;  4G7Z A;  2PHC B;  3AD8 C;  2ZUE A;  1TWG C;  3ERE D;  3AQO A;  4P9S A;  3LPX A;  2VUM K;  1I3Q C;  2YU9 K;  1V5V A;  3HOY K;  4KDD A;  3VA7 A;  3TFJ A;  5HL8 A;  2WB1 L;  1I3Q A;  3K7A C;  1WIH A;  4A3I C;  4KAT A;  4AH6 A;  4XSZ A;  3CF5 S;  4AYB L;  4A3B K;  1J6X A;  3HOX K;  2JA7 K;  5C4J C;  2BE5 A;  4YFN A;  1I6V A;  2PMZ D;  3S17 C;  2XCO A;  3LAP A;  1WOS A;  4ILD A;  4Q5S A;  5JVH S;  1O2F B;  4BBS K;  1G51 A;  4A3L C;  4O2D A;  3I4N K;  2NVX C;  2NVX A;  3PO3 C;  1BGW A;  2Y3P A;  1FEU A;  1AB4 A;  3PIO S;  4BY7 C;  4DDQ A;  3RZO K;  4G0W A;  3S1M K;  5C3E C;  1VRQ C;  3HKZ L;  2GSU A;  5E68 A;  4GTL A;  3OEP A;  2O5J A;  4C45 A;  4LOW A;  2JA6 C;  4A3M C;  3S1Q K;  3AQP A;  3OPF A;  3T00 A;  3GTQ C;  3TFI A;  4KAS A;  2A68 A;  3FKI K;  1I6H K;  4KN4 A;  2R92 C;  3A8I A;  4GT9 A;  2V6S A;  2R7Z K;  3Q3Q A;  4GTD A;  3DXJ A;  3TFH A;  5IYC C;  2L3U A;  1EK8 A;  4A3K C;  4G7O A;  4KAR A;  1ZQ1 C;  1PJ7 A;  3NUH A;  5C44 K;  4Y7N C;  3GTP K;  4QJV A;  2NVY K;  1TWC K;  3ADA C;  1IE0 A;  5EGH A;  1TWA C;  2D6F C;  3GDZ A;  3H0G C;  3GTL A;  5IYD C;  3GTO A;  3M3Y K;  2NVT C;  3GIR A;  5HQH A;  3GEE A;  1WOP A;  3JST A;  4WJ4 A;  3CQZ K;  3CAG A;  4KN7 A;  4MEY A;  2VUM C;  3HOY C;  2KWA A;  2VUM A;  2YU9 A;  2GSN A;  3TTG A;  2ZUF A;  2WAQ D;  3EQL A;  4WFN S;  5FLM K;  1F7V A;  1K83 A;  2E2I K;  4G0U A;  1WQH A;  1O24 A;  1O28 A;  4A3J K;  1IW7 A;  5FJ8 K;  3V4G A;  1EI6 A;  4A3B C;  3HOX C;  1IL2 A;  2JA7 C;  1HQM A;  3ORE A;  3SZZ A;  1PJ5 A;  1SFO K;  2JA7 A;  2A6H A;  1ISE A;  1IBA A;  4U67 S;  3GTM K;  4KMD A;  1K83 K;  4BBS C;  3L4K A;  4Y52 K;  4BXX K;  3I4N C;  4WF9 S;  1F9N A;  1BJT A;  3A8J A;  2A6E A;  5IYB K;  2JA5 A;  4A3D K;  3A8K A;  4A3E C;  5TMC A;  1I50 K;  3RZO C;  1O26 A;  3GEH A;  3S14 C;  3AD9 C;  3S1M C;  3S1N K;  3I4M K;  4A3C K;  4KC6 A;  3M4O K;  3LAJ A;  4A3G K;  1J6V A;  4OIQ A;  1INN A;  1YCL A;  3S2H K;  2WB1 D;  2B63 K;  4IOA S;  3LYW A;  2E2J C;  4P5B A;  3HOW K;  4WFB S;  2JA5 K;  3S1Q C;  4OIR A;  4XLP A;  4LR2 A;  4BBR K;  4KB2 A;  3GSI A;  1TWG K;  4AYB D;  2Y0S L;  2PPB A;  5IP7 K;  5JVO A;  1F93 A;  3FKI C;  1VGX A;  1ZVU A;  3T02 A;  1B4B A;  1ZXO A;  1I6H C;  3FKI A;  4KM9 A;  5M5X K;  2R93 K;  4LQY A;  4GTA A;  4KAW X;  3SZY A;  2R7Z A;  1XPP A;  3S2D K;  3GTK A;  1X31 C;  2V6U A;  5TMF A;  1VH2 A;  2JH3 A;  2GAG C;  2NVQ K;  5D4D A;  5C4X K;  4GFQ A;  1WCM A;  3S1R K;  1B4A A;  4Q4Z A;  3MML B;  3BUE A;  4QIW L;  4C3H K;  1WSV A;  3GTP C;  4QJV B;  4A3L K;  2EBB A;  2NVY C;  3GTK K;  1TWC C;  3GTP A;  1L0W A;  3S16 C;  1BDF A;  1F7U A;  2NVY A;  1TWC A;  3PO2 K;  1SMY A;  4YG2 A;  1ZYR A;  5HL7 S;  1XXC A;  1YX2 A;  1WCM K;  1VJE A;  3M3Y C;  1J6W A;  2A69 A;  4YFK A;  4JK1 A;  4MEX A;  1O29 A;  3T01 A;  3CQZ C;  3HOZ C;  1JQW A;  2P5M A;  3CQZ A;  4A3M K;  1Y1V K;  4P5A A;  3GTL C;  4IO9 S;  3GTO C;  4PAA A;  2ZJQ S;  5FLM C;  4LLG A; 
#chains in the Genus database with same CATH homology
 4Q5S A;  1Y1V C;  4YFX A;  4OIO A;  1SFO K;  4BBS K;  2A6H A;  4A3J C;  4BY7 K;  4A3L C;  3I4N K;  2NVX C;  3GTJ K;  3H3V L;  5C3E K;  2R92 K;  3GTM K;  1K83 K;  4MQ9 A;  3PO3 C;  4G7H A;  4BBS C;  2YU9 C;  4Y52 K;  1TWF K;  4BY7 C;  4LK0 A;  2PA8 L;  4C3I K;  4BXX K;  3I4N C;  3RZO K;  3GTJ C;  4C3J K;  4XLN A;  3S1M K;  5C3E C;  2JA8 K;  1K83 C;  4GZY A;  4OIN A;  2JA6 K;  2A6E A;  3HKZ L;  5IYB K;  4QIW D;  4Y52 C;  1TWF C;  4BXX C;  4C3I C;  4A3D K;  4A3E C;  5TMC A;  3HOV K;  1I50 K;  3RZO C;  4A93 K;  4C3J C;  3S14 C;  2O5J A;  3S1M C;  3HOU K;  3S1N K;  3I4M K;  3GTQ K;  2JA8 C;  3RZD K;  4A3C K;  3M4O K;  2JA6 C;  4ZH4 A;  4A3M C;  5IP9 K;  4KMU A;  3S1Q K;  4A3G K;  5IYB C;  2E2I C;  4A3D C;  3HOV C;  4OIQ A;  5M3M K;  4A93 C;  3HOU C;  3S2H K;  2WB1 D;  3S1N C;  2B63 K;  2E2J C;  3GTQ C;  3RZD C;  4A3C C;  4C2M K;  3M4O C;  3HOW K;  3GTG K;  5IP9 C;  3S1Q C;  4A3G C;  2A68 A;  4OIR A;  4XLP A;  1R9T K;  2JA5 K;  4BBR K;  1SFO C;  3FKI K;  2E2H K;  3S16 K;  1I6H K;  2WAQ L;  4KN4 A;  3S2H C;  1TWG K;  5IYC K;  4AYB D;  5M3F K;  4C2M C;  3HOW C;  2R92 C;  3GTM C;  2Y0S L;  3GTG C;  4NOI A;  1Y1W K;  2PPB A;  2PMZ L;  2JA5 C;  5IP7 K;  2R7Z K;  3S15 K;  1R9T C;  4BBR C;  4A3K K;  3FKI C;  2E2H C;  1I6H C;  3DXJ A;  1TWH K;  4XSX A;  5IYC C;  5M5X K;  4LJZ A;  2R93 K;  1Y1W C;  5IP7 C;  4Y7N K;  4BY1 K;  3S15 C;  2CW0 A;  4A3K C;  4LK1 A;  4G7O A;  3HOZ K;  2O5I A;  1XPP A;  1TWH C;  3S2D K;  5M5W K;  1I50 C;  5TMF A;  4X6A K;  2R93 C;  3I4M C;  2NVQ K;  3H3V D;  5D4D A;  1TWA K;  5C4X K;  5C44 K;  4Y7N C;  4BY1 C;  3GTL K;  3GTP K;  3GTO K;  4A3F K;  1YNJ A;  4QJV A;  2NVY K;  1TWC K;  3H0G K;  3S1R K;  5IYD K;  3S2D C;  4Q4Z A;  2PA8 D;  2NVT K;  4X6A C;  2B63 C;  2NVQ C;  4QIW L;  1TWA C;  5C4X C;  1I3Q K;  4C3H K;  3GTP C;  4QJV B;  4A3L K;  4A3F C;  2NVY C;  3GTK K;  1TWC C;  3K7A K;  3H0G C;  3S1R C;  5M5Y K;  5IYD C;  4OIP A;  4G7Z A;  1BDF A;  3S16 C;  4A3I K;  3M3Y K;  2NVT C;  3PO2 K;  1SMY A;  4YG2 A;  1ZYR A;  1TWG C;  2VUM K;  1I3Q C;  2YU9 K;  3HOY K;  4C3H C;  1WCM K;  2R7Z C;  2WB1 L;  3GTK C;  3K7A C;  3CQZ K;  4A3I C;  3M3Y C;  3PO2 C;  1YNN A;  2A69 A;  4KN7 A;  4MEY A;  4YFK A;  2VUM C;  3HOY C;  5C4J K;  4JK1 A;  4A3E K;  1WCM C;  4MEX A;  4XSZ A;  3S17 K;  3S14 K;  3CQZ C;  3WOD A;  4AYB L;  4A3B K;  3HOZ C;  3HOX K;  4A3M K;  2JA7 K;  2WAQ D;  3EQL A;  5FLM K;  5C4J C;  2BE5 A;  4YFN A;  1Y1V K;  2E2I K;  1I6V A;  2Y0S D;  5C44 C;  1IW7 A;  2PMZ D;  3GTL C;  4A3J K;  3GTO C;  3S17 C;  5FJ8 K;  2NVX K;  3HKZ D;  4A3B C;  2E2J K;  3HOX C;  2JA7 C;  1HQM A;  5FLM C;  3PO3 K;  4LLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...