4MQ9A

Crystal structure of thermus thermophilus rna polymerase holoenzyme in complex with ge23077
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
226
structure length
226
Chain Sequence
b'LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transcription, transferase/antibiotic
source organism Thermus thermophilus
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
total genus 49
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4mq9A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4mq9A01
4C3IC 2R93K 3H0GK 1SFOK 4A3KC 2E2IC 5C44K 2R92C 2E2JK 3CQZC 4YFXA 3GTMC 3S1MK 4BXXK 1R9TC 3HOXK 4G7HA 2B63K 2NVTC 3S14K 4C3JK 1I50K 3S16K 4BY1K 1YNJA 5D4DA 4C3HK 2PMZL 5IYCC 4ZH4A 4G7ZA 3HOUC 3GTQK 4LJZA 4MQ9A 2JA5K 3S1NK 4A3LK 4A3BK 1YNNA 1I3QC 4JK1A 3RZDK 3HOWK 2WAQD 5FLMC 3HOYC 3S1RK 4Y52K 2Y0SD 5C3EC 4Q5SA 2JA6C 5TMFA 1Y1WC 2E2HK 3S2DK 4A93K 4A3IC 3PO3C 3HOVK 4A3GK 3RZOK 4A3EK 3S2HC 4OIRA 3GTKK 5FJ8K 5IYDC 4A3GC 2WAQL 4A3IK 3M3YK 4QIWD 3HKZD 2JA8K 2PMZD 4YFKA 4Y7NK 5M5YK 3GTQC 3K7AK 5IYCK 4QIWL 4AYBD 4Y7NC 1WCMC 4BBRC 2PPBA 1R9TK 4G7OA 2A69A 2R92K 3EQLA 4OIQA 3H0GC 1SFOC 2WB1D 2R93C 5C4XK 4KN4A 3S2HK 3S1QK 3PO2K 3HOVC 4XSXA 3FKIC 2YU9C 1TWCK 2JA7K 4BY7K 2PA8D 4C2MC 2NVXC 1Y1VK 4Q4ZA 1TWAK 5C3EK 3S1RC 4BY7C 3I4MC 5M3FK 3HOYK 4LK0A 3S1QC 4QJVA 3HOWC 3RZDC 2O5JA 1I3QK 5C4XC 2PA8L 2VUMK 5IP7C 1BDFA 3GTGC 2NVYC 4C3HC 3S15C 5IYBK 4A3JK 2A68A 4C3JC 4LLGA 3S14C 4YG2A 1WCMK 4BBRK 4A3JC 4A3DK 2NVYK 3S15K 3GTPC 1K83K 3GTGK 1XPPA 1HQMA 1ZYRA 2VUMC 4C3IK 1I6HK 4BBSC 5TMCA 3GTOC 3I4MK 1Y1VC 4GZYA 4C2MK 2NVXK 4A3MK 1TWCC 4MEYA 2JA7C 2O5IA 1TWGC 3GTKC 3HOZC 2YU9K 5IYDK 4A3EC 3HKZL 5IP9K 5M5WK 2A6HA 4NOIA 1IW7A 3GTJC 4MEXA 3DXJA 4OIOA 2A6EA 4Y52C 4A3CC 5FLMK 4A3FK 3S17K 2WB1L 4KMUA 5IP9C 3K7AC 1TWFC 4A3BC 3I4NC 3M4OK 4OIPA 4BY1C 1I50C 2BE5A 4A3MC 3S16C 4AYBL 4X6AK 2JA8C 4X6AC 4XLNA 4A3KK 2E2IK 4XSZA 4QJVB 3M4OC 3I4NK 5C4JC 3M3YC 1TWHC 1TWFK 1K83C 4XLPA 3GTPK 3RZOC 1I6VA 4A3DC 3PO3K 4A93C 3WODA 2E2HC 3S17C 3S2DC 1Y1WK 4A3FC 4YFNA 2JA6K 1SMYA 2R7ZC 3GTLC 2NVQK 4OINA 3GTJK 4A3CK 5IYBC 5M3MK 4LK1A 3H3VD 5IP7K 4KN7A 2JA5C 4A3LC 2Y0SL 3S1NC 3HOUK 1TWGK 5M5XK 3HOZK 2NVQC 1TWAC 3GTLK 2R7ZK 2NVTK 2CW0A 3HOXC 2B63C 3H3VL 3S1MC 3FKIK 4BXXC 3CQZK 3PO2C 5C44C 2E2JC 3GTOK 3GTMK 4BBSK 1I6HC 1TWHK 5C4JK
chains in the Genus database with same CATH superfamily
2R93K 2KQ1A 3H0GK 2E2IC 2W7VA 1L0WA 1R9TC 3MMLB 1GE9A 4KC6A 2JA6A 4A3BK 3S1NK 3HXAA 1XXCA 2JA5K 1YNNA 2P5MA 3RZDK 1WQFA 5C3EC 4Q5SA 3FKIA 5TMFA 2E2HK 1EI6A 5JFEA 3PO3C 4IOAS 4A3EK 3S0XA 4BLBA 1KQ4A 1O2AA 5IYDC 5FJ8K 4WJ3M 1PJ7A 1O27A 2JA8K 1IQ0A 4C45A 4KM8A 4YFKA 1WSRA 3K7AK 5IYCK 2CFAB 4BBRC 1RU0A 2R92K 1SFOC 2ZUFA 3CAGA 4KB4A 1USMA 3GTGA 2YU9C 1O26A 5C3EK 1TWAK 4KB2A 5M3FK 1XZQA 4QJVA 1BJTA 4WJ4A 3RZDC 4G0VA 3GTGC 2Y3PA 3NUHA 4WILA 2V6TA 3FHZA 4BBRK 2ZFZA 3A8KA 1XXBA 3GTPC 1K83K 1AB4A 4BBSC 3OEPA 1EQRA 3AQOA 1TWGA 4A3MK 3DLLS 5IYDK 3T00A 4A3EC 3TFIA 2L5NA 1XZPB 1IW7A 3GTJA 1WOSA 4KMHA 1ZVUA 1Y1WA 2WB1L 3L4JA 1JVIA 1EFWA 3GDZA 4IOCS 4GTBA 4A3BC 4AYBL 4X6AK 4GTLA 1IL2A 2GAHC 3GTLA 2E2IK 1WORA 4QJVB 3GTMA 3I4NK 1TWHC 5HQHA 4XLPA 3RZOC 4A3DC 4WFBS 4A93C 3S2DC 1Y1WK 2JA6K 4A3FC 3GTLC 1HI9A 1J6XA 4OINA 3GTJK 1IE0A 5IYBC 2RH6A 3H3VD 1VJEA 2Y0SL 1O24A 5JVOA 1DD5A 3GEEA 2CFAA 4LQYA 3T01A 3LAJA 2GSUA 3H3VL 3S1MC 4BXXC 3CQZK 2E2JC 4PABA 1DCHA 5C4JK 1F7UA 4YFXA 2P8TA 3HOXK 4G7HA 2B63K 2GSNA 4C3JK 1I50K 1YNJA 3AD9C 4G7ZA 4LJZA 3AD7C 2ZJQS 1JOEA 1I3QC 4IO9S 1F7VA 3HOYC 2Y0SD 5DM6S 3CQZA 2RGRA 4OIRA 3OREA 2V6UA 3HKZD 2PMZD 2B63A 3AD8C 4KMAA 2GAGC 4Y7NC 1WCMC 2JA5A 1J6VA 4GTFA 4OIQA 3FOFA 1DCPA 3S1QK 3HOVC 1I50A 3BUEA 2PA8D 3T02A 3A8IA 2O5JA 5C4XC 2VUMK 1BDFA 2NVYC 4C3HC 3S15C 5IYBK 4DDQA 2R92A 4YG2A 3AH5A 4A3DK 2NVYK 3S15K 3GTKA 1XPPA 2VUMC 5IOSA 1I6HK 1O2BA 5TMCA 3GTOC 2GSOA 2XCQA 4MEYA 3HOZC 2O5IA 1TWGC 3GTKC 3N3YA 3VA7A 5HL7S 4OIOA 4GTEA 1WIHA 4KMUA 4BLAA 3GEIA 3M4OK 4OIPA 3S16C 4A3MC 5TJ3A 4XSZA 1SFOA 3M3YC 1TWFK 1K83C 1O25A 3GTPK 4U67S 1I6VA 3WODA 3S17C 2E2HA 4A3CK 4P5AA 2NVQK 3FOEA 5M3MK 1J98A 1B4AA 5HL8A 3L4KA 1TWAC 2R7ZK 3HOXC 2B63C 1INNA 1WQHA 3GTPA 4C3IC 1SFOK 4A3KC 2E2JK 2R92C 3CQZC 4BXXK 3S1MK 2XCOA 5E68A 3S14K 3N0BA 2ZJRS 4BY1K 5D4DA 2PMZL 5IYCC 1VH2A 4ZH4A 3IPJA 4MQ9A 5DM7S 4KATA 4JK1A 5CHPA 1R9TA 3HOWK 4KDDA 5FLMC 3S1RK 4Y52K 2JA6C 1Y1WC 3S2DK 3SZYA 4A93K 1USOA 1UV7A 3RZOK 3S2HC 3N0CA 4RMFA 2WAQL 1X31C 4G0UA 1I3QA 3GTQA 5M5YK 3GEHA 2JH3A 4GTCA 1F9NA 4AYBD 3GIRA 3BP8C 3SZZA 3ADAC 1R9TK 2YU9A 4G7OA 3LPXA 3H0GC 2R93C 4KN4A 2ZUEA 3S2HK 5L46A 3PO2K 4XSXA 3FKIC 4GTAA 4BY7K 4WCES 3CF5S 3S1RC 4BY7C 4LK0A 3HOWC 2V6SA 2PHCB 1G51A 2PA8L 1DCOA 1J6WA 3PIOS 3S14C 3GTGK 3Q3QA 1HQMA 1ZYRA 1EK8A 4M1XA 4P5BA 4C3IK 1ZBSA 4FZBA 4G0WA 4GZYA 1VRQC 2FQTA 2YU9K 3HKZL 2A6HA 4NOIA 3G4AA 4J3NA 4PAAA 1WOOA 3ERED 4GFQA 4Y52C 2A6EA 4A3CC 5FLMK 3S17K 1O2FB 5JVGS 5IP9C 3K7AC 1C0AA 1TWFC 4O2DA 1WOPA 1Y1VA 4BY1C 1ZQ1C 2JA8C 2R7ZA 4XLNA 2EBBA 4KM9A 4A3KK 4KAWX 3M4OC 3BP3A 5EGEA 1K83A 4KARA 3PO3K 2E2HC 1IS1A 4YFNA 4P9SA 2R7ZC 1ISEA 4LK1A 5IOTA 5IP7K 2JA5C 3S1NC 1B4BA 1TWGK 3HOZK 1ZXOA 2NVQC 2CW0A 3GTOK 2ZJPS 1I6HC 3M3YK 2KXYA 1BGWA 3TTGA 5C44K 3LYWA 3GTMC 1YCLA 2NVTC 3S16K 4C3HK 1VGXA 1TWAA 3HOUC 3GTQK 4A3LK 1YX2A 1WQGA 4LOWA 1TWFA 4AH6A 2WAQD 3GSIA 1FEUA 4A3IC 4A3GK 3HOVK 3PIPS 4BKWA 3GTKK 4A3GC 4A3IK 1TWHA 5CJ9A 4QIWD 1TWCA 2JA7A 4XCHA 4Y7NK 3GTQC 4QIWL 4KMDA 1PJ5A 2PPBA 2KWAA 4ILDA 2FQOA 2A69A 3EQLA 2WB1D 5EGHA 5C4XK 1TWCK 2JA7K 4C2MC 2NVXC 4WF9S 4Q4ZA 1Y1VK 3HOYK 3I4MC 3S1QC 1I3QK 1EH1A 3JSTA 5IP7C 4WFAS 4A3JK 2A68A 4C3JC 4LLGA 3TFJA 1WCMK 3TFHA 4A3JC 4GTDA 5JVHS 1F93A 1O28A 3G4CA 4GT9A 2L3UA 3V4GA 5IOQA 3I4MK 1Y1VC 4C2MK 2NVXK 2D6FC 3AQPA 1TWCC 2JA7C 1JQWA 2E2IA 1O29A 3GTOA 5IP9K 5M5WK 1XZPA 3GTJC 4MEXA 2R93A 3DXJA 4A3FK 1XZQB 1BS2A 1V5VA 4FM9A 1PJ6A 3I4NC 3OPFA 1I50C 2BE5A 4LR2A 4WFNS 2KPUA 3QX3A 4X6AC 2VUMA 3H0GA 1VLOA 5C4JC 5IORA 1WCMA 2NVYA 1SMYA 1IBAA 1XXAA 4KN7A 4A3LC 4KASA 3HOUK 5M5XK 2XCRB 2NVXA 3GTLK 3A8JA 2NVTK 3LAPA 3GTMK 3FKIK 3PO2C 5C44C 4BBSK 1TWHK 1WSVA
chains in the Genus database with same CATH topology
4C3IC 2R93K 3H0GK 1SFOK 4A3KC 2E2IC 5C44K 2R92C 2E2JK 3CQZC 4YFXA 3GTMC 3S1MK 4BXXK 1R9TC 3HOXK 4G7HA 2B63K 2NVTC 3S14K 4C3JK 1I50K 3S16K 4BY1K 1YNJA 5D4DA 4C3HK 2PMZL 5IYCC 4ZH4A 4G7ZA 3HOUC 3GTQK 4LJZA 4MQ9A 2JA5K 3S1NK 4A3LK 4A3BK 1YNNA 1I3QC 4JK1A 3RZDK 3HOWK 2WAQD 5FLMC 3HOYC 3S1RK 4Y52K 2Y0SD 5C3EC 4Q5SA 2JA6C 5TMFA 1Y1WC 2E2HK 3S2DK 4A93K 4A3IC 3PO3C 3HOVK 4A3GK 3RZOK 4A3EK 3S2HC 4OIRA 3GTKK 5FJ8K 5IYDC 4A3GC 2WAQL 4A3IK 3M3YK 4QIWD 3HKZD 2JA8K 2PMZD 4YFKA 4Y7NK 5M5YK 3GTQC 3K7AK 5IYCK 4QIWL 4AYBD 4Y7NC 1WCMC 4BBRC 2PPBA 1R9TK 4G7OA 2A69A 2R92K 3EQLA 4OIQA 3H0GC 1SFOC 2WB1D 2R93C 5C4XK 4KN4A 3S2HK 3S1QK 3PO2K 3HOVC 4XSXA 3FKIC 2YU9C 1TWCK 2JA7K 4BY7K 2PA8D 4C2MC 2NVXC 1Y1VK 4Q4ZA 1TWAK 5C3EK 3S1RC 4BY7C 3I4MC 5M3FK 3HOYK 4LK0A 3S1QC 4QJVA 3HOWC 3RZDC 2O5JA 1I3QK 5C4XC 2PA8L 2VUMK 5IP7C 1BDFA 3GTGC 2NVYC 4C3HC 3S15C 5IYBK 4A3JK 2A68A 4C3JC 4LLGA 3S14C 4YG2A 1WCMK 4BBRK 4A3JC 4A3DK 2NVYK 3S15K 3GTPC 1K83K 3GTGK 1XPPA 1HQMA 1ZYRA 2VUMC 4C3IK 1I6HK 4BBSC 5TMCA 3GTOC 3I4MK 1Y1VC 4GZYA 4C2MK 2NVXK 4A3MK 1TWCC 4MEYA 2JA7C 2O5IA 1TWGC 3GTKC 3HOZC 2YU9K 5IYDK 4A3EC 3HKZL 5IP9K 5M5WK 2A6HA 4NOIA 1IW7A 3GTJC 4MEXA 3DXJA 4OIOA 2A6EA 4Y52C 4A3CC 5FLMK 4A3FK 3S17K 2WB1L 4KMUA 5IP9C 3K7AC 1TWFC 4A3BC 3I4NC 3M4OK 4OIPA 4BY1C 1I50C 2BE5A 4A3MC 3S16C 4AYBL 4X6AK 2JA8C 4X6AC 4XLNA 4A3KK 2E2IK 4XSZA 4QJVB 3M4OC 3I4NK 5C4JC 3M3YC 1TWHC 1TWFK 1K83C 4XLPA 3GTPK 3RZOC 1I6VA 4A3DC 3PO3K 4A93C 3WODA 2E2HC 3S17C 3S2DC 1Y1WK 4A3FC 4YFNA 2JA6K 1SMYA 2R7ZC 3GTLC 2NVQK 4OINA 3GTJK 4A3CK 5IYBC 5M3MK 4LK1A 3H3VD 5IP7K 4KN7A 2JA5C 4A3LC 2Y0SL 3S1NC 3HOUK 1TWGK 5M5XK 3HOZK 2NVQC 1TWAC 3GTLK 2R7ZK 2NVTK 2CW0A 3HOXC 2B63C 3H3VL 3S1MC 3FKIK 4BXXC 3CQZK 3PO2C 5C44C 2E2JC 3GTOK 3GTMK 4BBSK 1I6HC 1TWHK 5C4JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I C;  2R93 K;  3H0G K;  1SFO K;  4A3K C;  2E2I C;  5C44 K;  2R92 C;  2E2J K;  3CQZ C;  4YFX A;  3GTM C;  3S1M K;  4BXX K;  1R9T C;  3HOX K;  4G7H A;  2B63 K;  2NVT C;  3S14 K;  4C3J K;  1I50 K;  3S16 K;  4BY1 K;  1YNJ A;  5D4D A;  4C3H K;  2PMZ L;  5IYC C;  4ZH4 A;  4G7Z A;  3HOU C;  3GTQ K;  4LJZ A;  4MQ9 A;  2JA5 K;  3S1N K;  4A3L K;  4A3B K;  1YNN A;  1I3Q C;  4JK1 A;  3RZD K;  3HOW K;  2WAQ D;  5FLM C;  3HOY C;  3S1R K;  4Y52 K;  2Y0S D;  5C3E C;  4Q5S A;  2JA6 C;  5TMF A;  1Y1W C;  2E2H K;  3S2D K;  4A93 K;  4A3I C;  3PO3 C;  3HOV K;  4A3G K;  3RZO K;  4A3E K;  3S2H C;  4OIR A;  3GTK K;  5FJ8 K;  5IYD C;  4A3G C;  2WAQ L;  4A3I K;  3M3Y K;  4QIW D;  3HKZ D;  2JA8 K;  2PMZ D;  4YFK A;  4Y7N K;  5M5Y K;  3GTQ C;  3K7A K;  5IYC K;  4QIW L;  4AYB D;  4Y7N C;  1WCM C;  4BBR C;  2PPB A;  1R9T K;  4G7O A;  2A69 A;  2R92 K;  3EQL A;  4OIQ A;  3H0G C;  1SFO C;  2WB1 D;  2R93 C;  5C4X K;  4KN4 A;  3S2H K;  3S1Q K;  3PO2 K;  3HOV C;  4XSX A;  3FKI C;  2YU9 C;  1TWC K;  2JA7 K;  4BY7 K;  2PA8 D;  4C2M C;  2NVX C;  1Y1V K;  4Q4Z A;  1TWA K;  5C3E K;  3S1R C;  4BY7 C;  3I4M C;  5M3F K;  3HOY K;  4LK0 A;  3S1Q C;  4QJV A;  3HOW C;  3RZD C;  2O5J A;  1I3Q K;  5C4X C;  2PA8 L;  2VUM K;  5IP7 C;  1BDF A;  3GTG C;  2NVY C;  4C3H C;  3S15 C;  5IYB K;  4A3J K;  2A68 A;  4C3J C;  4LLG A;  3S14 C;  4YG2 A;  1WCM K;  4BBR K;  4A3J C;  4A3D K;  2NVY K;  3S15 K;  3GTP C;  1K83 K;  3GTG K;  1XPP A;  1HQM A;  1ZYR A;  2VUM C;  4C3I K;  1I6H K;  4BBS C;  5TMC A;  3GTO C;  3I4M K;  1Y1V C;  4GZY A;  4C2M K;  2NVX K;  4A3M K;  1TWC C;  4MEY A;  2JA7 C;  2O5I A;  1TWG C;  3GTK C;  3HOZ C;  2YU9 K;  5IYD K;  4A3E C;  3HKZ L;  5IP9 K;  5M5W K;  2A6H A;  4NOI A;  1IW7 A;  3GTJ C;  4MEX A;  3DXJ A;  4OIO A;  2A6E A;  4Y52 C;  4A3C C;  5FLM K;  4A3F K;  3S17 K;  2WB1 L;  4KMU A;  5IP9 C;  3K7A C;  1TWF C;  4A3B C;  3I4N C;  3M4O K;  4OIP A;  4BY1 C;  1I50 C;  2BE5 A;  4A3M C;  3S16 C;  4AYB L;  4X6A K;  2JA8 C;  4X6A C;  4XLN A;  4A3K K;  2E2I K;  4XSZ A;  4QJV B;  3M4O C;  3I4N K;  5C4J C;  3M3Y C;  1TWH C;  1TWF K;  1K83 C;  4XLP A;  3GTP K;  3RZO C;  1I6V A;  4A3D C;  3PO3 K;  4A93 C;  3WOD A;  2E2H C;  3S17 C;  3S2D C;  1Y1W K;  4A3F C;  4YFN A;  2JA6 K;  1SMY A;  2R7Z C;  3GTL C;  2NVQ K;  4OIN A;  3GTJ K;  4A3C K;  5IYB C;  5M3M K;  4LK1 A;  3H3V D;  5IP7 K;  4KN7 A;  2JA5 C;  4A3L C;  2Y0S L;  3S1N C;  3HOU K;  1TWG K;  5M5X K;  3HOZ K;  2NVQ C;  1TWA C;  3GTL K;  2R7Z K;  2NVT K;  2CW0 A;  3HOX C;  2B63 C;  3H3V L;  3S1M C;  3FKI K;  4BXX C;  3CQZ K;  3PO2 C;  5C44 C;  2E2J C;  3GTO K;  3GTM K;  4BBS K;  1I6H C;  1TWH K;  5C4J K; 
#chains in the Genus database with same CATH topology
 2R93 K;  2KQ1 A;  3H0G K;  2E2I C;  2W7V A;  1L0W A;  1R9T C;  3MML B;  1GE9 A;  4KC6 A;  2JA6 A;  4A3B K;  3S1N K;  3HXA A;  1XXC A;  2JA5 K;  1YNN A;  2P5M A;  3RZD K;  1WQF A;  5C3E C;  4Q5S A;  3FKI A;  5TMF A;  2E2H K;  1EI6 A;  5JFE A;  3PO3 C;  4IOA S;  4A3E K;  3S0X A;  4BLB A;  1KQ4 A;  1O2A A;  5IYD C;  5FJ8 K;  4WJ3 M;  1PJ7 A;  1O27 A;  2JA8 K;  1IQ0 A;  4C45 A;  4KM8 A;  4YFK A;  1WSR A;  3K7A K;  5IYC K;  2CFA B;  4BBR C;  1RU0 A;  2R92 K;  1SFO C;  2ZUF A;  3CAG A;  4KB4 A;  1USM A;  3GTG A;  2YU9 C;  1O26 A;  5C3E K;  1TWA K;  4KB2 A;  5M3F K;  1XZQ A;  4QJV A;  1BJT A;  4WJ4 A;  3RZD C;  4G0V A;  3GTG C;  2Y3P A;  3NUH A;  4WIL A;  2V6T A;  3FHZ A;  4BBR K;  2ZFZ A;  3A8K A;  1XXB A;  3GTP C;  1K83 K;  1AB4 A;  4BBS C;  3OEP A;  1EQR A;  3AQO A;  1TWG A;  4A3M K;  3DLL S;  5IYD K;  3T00 A;  4A3E C;  3TFI A;  2L5N A;  1XZP B;  1IW7 A;  3GTJ A;  1WOS A;  4KMH A;  1ZVU A;  1Y1W A;  2WB1 L;  3L4J A;  1JVI A;  1EFW A;  3GDZ A;  4IOC S;  4GTB A;  4A3B C;  4AYB L;  4X6A K;  4GTL A;  1IL2 A;  2GAH C;  3GTL A;  2E2I K;  1WOR A;  4QJV B;  3GTM A;  3I4N K;  1TWH C;  5HQH A;  4XLP A;  3RZO C;  4A3D C;  4WFB S;  4A93 C;  3S2D C;  1Y1W K;  2JA6 K;  4A3F C;  3GTL C;  1HI9 A;  1J6X A;  4OIN A;  3GTJ K;  1IE0 A;  5IYB C;  2RH6 A;  3H3V D;  1VJE A;  2Y0S L;  1O24 A;  5JVO A;  1DD5 A;  3GEE A;  2CFA A;  4LQY A;  3T01 A;  3LAJ A;  2GSU A;  3H3V L;  3S1M C;  4BXX C;  3CQZ K;  2E2J C;  4PAB A;  1DCH A;  5C4J K;  1F7U A;  4YFX A;  2P8T A;  3HOX K;  4G7H A;  2B63 K;  2GSN A;  4C3J K;  1I50 K;  1YNJ A;  3AD9 C;  4G7Z A;  4LJZ A;  3AD7 C;  2ZJQ S;  1JOE A;  1I3Q C;  4IO9 S;  1F7V A;  3HOY C;  2Y0S D;  5DM6 S;  3CQZ A;  2RGR A;  4OIR A;  3ORE A;  2V6U A;  3HKZ D;  2PMZ D;  2B63 A;  3AD8 C;  4KMA A;  2GAG C;  4Y7N C;  1WCM C;  2JA5 A;  1J6V A;  4GTF A;  4OIQ A;  3FOF A;  1DCP A;  3S1Q K;  3HOV C;  1I50 A;  3BUE A;  2PA8 D;  3T02 A;  3A8I A;  2O5J A;  5C4X C;  2VUM K;  1BDF A;  2NVY C;  4C3H C;  3S15 C;  5IYB K;  4DDQ A;  2R92 A;  4YG2 A;  3AH5 A;  4A3D K;  2NVY K;  3S15 K;  3GTK A;  1XPP A;  2VUM C;  5IOS A;  1I6H K;  1O2B A;  5TMC A;  3GTO C;  2GSO A;  2XCQ A;  4MEY A;  3HOZ C;  2O5I A;  1TWG C;  3GTK C;  3N3Y A;  3VA7 A;  5HL7 S;  4OIO A;  4GTE A;  1WIH A;  4KMU A;  4BLA A;  3GEI A;  3M4O K;  4OIP A;  3S16 C;  4A3M C;  5TJ3 A;  4XSZ A;  1SFO A;  3M3Y C;  1TWF K;  1K83 C;  1O25 A;  3GTP K;  4U67 S;  1I6V A;  3WOD A;  3S17 C;  2E2H A;  4A3C K;  4P5A A;  2NVQ K;  3FOE A;  5M3M K;  1J98 A;  1B4A A;  5HL8 A;  3L4K A;  1TWA C;  2R7Z K;  3HOX C;  2B63 C;  1INN A;  1WQH A;  3GTP A;  4C3I C;  1SFO K;  4A3K C;  2E2J K;  2R92 C;  3CQZ C;  4BXX K;  3S1M K;  2XCO A;  5E68 A;  3S14 K;  3N0B A;  2ZJR S;  4BY1 K;  5D4D A;  2PMZ L;  5IYC C;  1VH2 A;  4ZH4 A;  3IPJ A;  4MQ9 A;  5DM7 S;  4KAT A;  4JK1 A;  5CHP A;  1R9T A;  3HOW K;  4KDD A;  5FLM C;  3S1R K;  4Y52 K;  2JA6 C;  1Y1W C;  3S2D K;  3SZY A;  4A93 K;  1USO A;  1UV7 A;  3RZO K;  3S2H C;  3N0C A;  4RMF A;  2WAQ L;  1X31 C;  4G0U A;  1I3Q A;  3GTQ A;  5M5Y K;  3GEH A;  2JH3 A;  4GTC A;  1F9N A;  4AYB D;  3GIR A;  3BP8 C;  3SZZ A;  3ADA C;  1R9T K;  2YU9 A;  4G7O A;  3LPX A;  3H0G C;  2R93 C;  4KN4 A;  2ZUE A;  3S2H K;  5L46 A;  3PO2 K;  4XSX A;  3FKI C;  4GTA A;  4BY7 K;  4WCE S;  3CF5 S;  3S1R C;  4BY7 C;  4LK0 A;  3HOW C;  2V6S A;  2PHC B;  1G51 A;  2PA8 L;  1DCO A;  1J6W A;  3PIO S;  3S14 C;  3GTG K;  3Q3Q A;  1HQM A;  1ZYR A;  1EK8 A;  4M1X A;  4P5B A;  4C3I K;  1ZBS A;  4FZB A;  4G0W A;  4GZY A;  1VRQ C;  2FQT A;  2YU9 K;  3HKZ L;  2A6H A;  4NOI A;  3G4A A;  4J3N A;  4PAA A;  1WOO A;  3ERE D;  4GFQ A;  4Y52 C;  2A6E A;  4A3C C;  5FLM K;  3S17 K;  1O2F B;  5JVG S;  5IP9 C;  3K7A C;  1C0A A;  1TWF C;  4O2D A;  1WOP A;  1Y1V A;  4BY1 C;  1ZQ1 C;  2JA8 C;  2R7Z A;  4XLN A;  2EBB A;  4KM9 A;  4A3K K;  4KAW X;  3M4O C;  3BP3 A;  5EGE A;  1K83 A;  4KAR A;  3PO3 K;  2E2H C;  1IS1 A;  4YFN A;  4P9S A;  2R7Z C;  1ISE A;  4LK1 A;  5IOT A;  5IP7 K;  2JA5 C;  3S1N C;  1B4B A;  1TWG K;  3HOZ K;  1ZXO A;  2NVQ C;  2CW0 A;  3GTO K;  2ZJP S;  1I6H C;  3M3Y K;  2KXY A;  1BGW A;  3TTG A;  5C44 K;  3LYW A;  3GTM C;  1YCL A;  2NVT C;  3S16 K;  4C3H K;  1VGX A;  1TWA A;  3HOU C;  3GTQ K;  4A3L K;  1YX2 A;  1WQG A;  4LOW A;  1TWF A;  4AH6 A;  2WAQ D;  3GSI A;  1FEU A;  4A3I C;  4A3G K;  3HOV K;  3PIP S;  4BKW A;  3GTK K;  4A3G C;  4A3I K;  1TWH A;  5CJ9 A;  4QIW D;  1TWC A;  2JA7 A;  4XCH A;  4Y7N K;  3GTQ C;  4QIW L;  4KMD A;  1PJ5 A;  2PPB A;  2KWA A;  4ILD A;  2FQO A;  2A69 A;  3EQL A;  2WB1 D;  5EGH A;  5C4X K;  1TWC K;  2JA7 K;  4C2M C;  2NVX C;  4WF9 S;  4Q4Z A;  1Y1V K;  3HOY K;  3I4M C;  3S1Q C;  1I3Q K;  1EH1 A;  3JST A;  5IP7 C;  4WFA S;  4A3J K;  2A68 A;  4C3J C;  4LLG A;  3TFJ A;  1WCM K;  3TFH A;  4A3J C;  4GTD A;  5JVH S;  1F93 A;  1O28 A;  3G4C A;  4GT9 A;  2L3U A;  3V4G A;  5IOQ A;  3I4M K;  1Y1V C;  4C2M K;  2NVX K;  2D6F C;  3AQP A;  1TWC C;  2JA7 C;  1JQW A;  2E2I A;  1O29 A;  3GTO A;  5IP9 K;  5M5W K;  1XZP A;  3GTJ C;  4MEX A;  2R93 A;  3DXJ A;  4A3F K;  1XZQ B;  1BS2 A;  1V5V A;  4FM9 A;  1PJ6 A;  3I4N C;  3OPF A;  1I50 C;  2BE5 A;  4LR2 A;  4WFN S;  2KPU A;  3QX3 A;  4X6A C;  2VUM A;  3H0G A;  1VLO A;  5C4J C;  5IOR A;  1WCM A;  2NVY A;  1SMY A;  1IBA A;  1XXA A;  4KN7 A;  4A3L C;  4KAS A;  3HOU K;  5M5X K;  2XCR B;  2NVX A;  3GTL K;  3A8J A;  2NVT K;  3LAP A;  3GTM K;  3FKI K;  3PO2 C;  5C44 C;  4BBS K;  1TWH K;  1WSV A; 
#chains in the Genus database with same CATH homology
 4C3I C;  2R93 K;  3H0G K;  1SFO K;  4A3K C;  2E2I C;  5C44 K;  2R92 C;  2E2J K;  3CQZ C;  4YFX A;  3GTM C;  3S1M K;  4BXX K;  1R9T C;  3HOX K;  4G7H A;  2B63 K;  2NVT C;  3S14 K;  4C3J K;  1I50 K;  3S16 K;  4BY1 K;  1YNJ A;  5D4D A;  4C3H K;  2PMZ L;  5IYC C;  4ZH4 A;  4G7Z A;  3HOU C;  3GTQ K;  4LJZ A;  4MQ9 A;  2JA5 K;  3S1N K;  4A3L K;  4A3B K;  1YNN A;  1I3Q C;  4JK1 A;  3RZD K;  3HOW K;  2WAQ D;  5FLM C;  3HOY C;  3S1R K;  4Y52 K;  2Y0S D;  5C3E C;  4Q5S A;  2JA6 C;  5TMF A;  1Y1W C;  2E2H K;  3S2D K;  4A93 K;  4A3I C;  3PO3 C;  3HOV K;  4A3G K;  3RZO K;  4A3E K;  3S2H C;  4OIR A;  3GTK K;  5FJ8 K;  5IYD C;  4A3G C;  2WAQ L;  4A3I K;  3M3Y K;  4QIW D;  3HKZ D;  2JA8 K;  2PMZ D;  4YFK A;  4Y7N K;  5M5Y K;  3GTQ C;  3K7A K;  5IYC K;  4QIW L;  4AYB D;  4Y7N C;  1WCM C;  4BBR C;  2PPB A;  1R9T K;  4G7O A;  2A69 A;  2R92 K;  3EQL A;  4OIQ A;  3H0G C;  1SFO C;  2WB1 D;  2R93 C;  5C4X K;  4KN4 A;  3S2H K;  3S1Q K;  3PO2 K;  3HOV C;  4XSX A;  3FKI C;  2YU9 C;  1TWC K;  2JA7 K;  4BY7 K;  2PA8 D;  4C2M C;  2NVX C;  1Y1V K;  4Q4Z A;  1TWA K;  5C3E K;  3S1R C;  4BY7 C;  3I4M C;  5M3F K;  3HOY K;  4LK0 A;  3S1Q C;  4QJV A;  3HOW C;  3RZD C;  2O5J A;  1I3Q K;  5C4X C;  2PA8 L;  2VUM K;  5IP7 C;  1BDF A;  3GTG C;  2NVY C;  4C3H C;  3S15 C;  5IYB K;  4A3J K;  2A68 A;  4C3J C;  4LLG A;  3S14 C;  4YG2 A;  1WCM K;  4BBR K;  4A3J C;  4A3D K;  2NVY K;  3S15 K;  3GTP C;  1K83 K;  3GTG K;  1XPP A;  1HQM A;  1ZYR A;  2VUM C;  4C3I K;  1I6H K;  4BBS C;  5TMC A;  3GTO C;  3I4M K;  1Y1V C;  4GZY A;  4C2M K;  2NVX K;  4A3M K;  1TWC C;  4MEY A;  2JA7 C;  2O5I A;  1TWG C;  3GTK C;  3HOZ C;  2YU9 K;  5IYD K;  4A3E C;  3HKZ L;  5IP9 K;  5M5W K;  2A6H A;  4NOI A;  1IW7 A;  3GTJ C;  4MEX A;  3DXJ A;  4OIO A;  2A6E A;  4Y52 C;  4A3C C;  5FLM K;  4A3F K;  3S17 K;  2WB1 L;  4KMU A;  5IP9 C;  3K7A C;  1TWF C;  4A3B C;  3I4N C;  3M4O K;  4OIP A;  4BY1 C;  1I50 C;  2BE5 A;  4A3M C;  3S16 C;  4AYB L;  4X6A K;  2JA8 C;  4X6A C;  4XLN A;  4A3K K;  2E2I K;  4XSZ A;  4QJV B;  3M4O C;  3I4N K;  5C4J C;  3M3Y C;  1TWH C;  1TWF K;  1K83 C;  4XLP A;  3GTP K;  3RZO C;  1I6V A;  4A3D C;  3PO3 K;  4A93 C;  3WOD A;  2E2H C;  3S17 C;  3S2D C;  1Y1W K;  4A3F C;  4YFN A;  2JA6 K;  1SMY A;  2R7Z C;  3GTL C;  2NVQ K;  4OIN A;  3GTJ K;  4A3C K;  5IYB C;  5M3M K;  4LK1 A;  3H3V D;  5IP7 K;  4KN7 A;  2JA5 C;  4A3L C;  2Y0S L;  3S1N C;  3HOU K;  1TWG K;  5M5X K;  3HOZ K;  2NVQ C;  1TWA C;  3GTL K;  2R7Z K;  2NVT K;  2CW0 A;  3HOX C;  2B63 C;  3H3V L;  3S1M C;  3FKI K;  4BXX C;  3CQZ K;  3PO2 C;  5C44 C;  2E2J C;  3GTO K;  3GTM K;  4BBS K;  1I6H C;  1TWH K;  5C4J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...