5TMFA

Re-refinement of thermus thermophilus rna polymerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
total genus 44
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmfA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmfA01
2PA8L 4A3EK 2R92K 4G7ZA 3S1NK 3K7AK 4A3EC 2R92C 5M5XK 2NVXK 3K7AC 5IP9K 2NVXC 2WB1L 5IP9C 3HOYK 3GTLK 3RZDK 3S2HK 3HOYC 4YG2A 3GTLC 5M5WK 2O5JA 3RZDC 3HOXK 3PO2C 2JA6K 3S1MK 3S2HC 4Y52K 3HOZK 4A3JK 3HOXC 4OIQA 2JA6C 4C2MK 3S1MC 2O5IA 3H3VD 3CQZK 4A93K 4GZYA 4C2MC 4MEXA 4A93C 3CQZC 5IYCK 5M3MK 5M5YK 3GTGK 4OINA 4C3JK 4QIWD 5IYCC 3GTGC 4XSXA 4A3KK 4C3JC 4XSZA 4A3DK 4LLGA 5C4XK 3WODA 5IYDK 3I4MK 3S14K 2B63K 2PMZL 5FJ8K 4A3DC 2R93K 5C4XC 4BY1C 2WB1D 2B63C 3I4MC 4C3IK 3S16K 4OIRA 2R93C 3GTQK 4A3BK 1TWGK 4C3IC 4Q4ZA 3S16C 4KN4A 4C3HK 3GTQC 2R7ZK 3S17K 1SFOK 1TWGC 5M3FK 3S17C 2R7ZC 1XPPA 4XLNA 1Y1VK 1SFOC 5IP7K 2NVTK 3S1QK 4ZH4A 2E2HK 4LK0A 5TMCA 1Y1VC 3S1QC 3DXJA 3I4NK 2E2HC 4NOIA 1TWFK 4BXXK 3I4NC 1TWFC 4A3FK 4A3MK 3HOZC 4BXXC 4A3JC 1R9TK 2JA8K 4A3FC 2Y0SL 4A3MC 3M4OK 3GTJK 5TMFA 1R9TC 1Y1WK 3M4OC 2JA8C 4MEYA 3M3YK 4BY7K 3GTOK 3GTJC 2PMZD 1Y1WC 1TWHK 2E2JK 4Q5SA 3GTOC 5D4DA 1TWCK 1TWHC 4XLPA 5C4JK 2E2JC 4A3GK 4A3KC 5C4JC 5IYDC 4Y7NK 4A3GC 5FLMK 1YNJA 3S14C 2NVYK 1HQMA 1SMYA 4Y7NC 5FLMC 2NVQK 1I3QK 4BBRK 3HOVK 4A3BC 2NVQC 3H0GK 3S2DK 1I6HK 1I3QC 1WCMK 4BBRC 4C3HC 3HOVC 3FKIK 3H0GC 4AYBL 4A3IK 1TWAK 1I6HC 3S1RK 4JK1A 3GTMK 1WCMC 1I6VA 2A6EA 4YFKA 3FKIC 4Y52C 4A3IC 3GTMC 1TWAC 5IP7C 3S1RC 2NVTC 3M3YC 3S1NC 4BBSC 2A69A 2Y0SD 3HKZD 4BY7C 3PO3K 3HOUK 2CW0A 4G7HA 3PO3C 3HOUC 1I50K 1K83K 3HKZL 5C3EK 4X6AK 1I50C 1K83C 5C3EC 4X6AC 4BBSK 3EQLA 4QJVB 3HOWK 2A68A 4OIPA 2JA5K 1BDFA 3S15K 3HOWC 4KMUA 1TWCC 4QJVA 2JA5C 3S15C 3RZOK 4YFNA 2JA7K 2E2IK 4AYBD 4LJZA 3RZOC 2WAQD 2NVYC 3PO2K 2JA7C 2E2IC 2VUMK 1IW7A 2YU9K 4YFXA 5C44K 2WAQL 2VUMC 4KN7A 3S2DC 2YU9C 3GTKK 4A3LK 5C44C 3GTKC 4A3LC 2A6HA 2PPBA 1ZYRA 3H3VL 3GTPK 4OIOA 4A3CK 1YNNA 2PA8D 4LK1A 5IYBK 2BE5A 4G7OA 3GTPC 4A3CC 5IYBC 4MQ9A 4BY1K 4QIWL
chains in the Genus database with same CATH superfamily
2R92K 5M5XK 1VJEA 2NVXC 3GEHA 1I3QA 3AD9C 3TFIA 3HOYK 3RZDK 3FKIA 3S2HK 1TWAA 2PHCB 4YG2A 1EFWA 2O5JA 3HOXK 2V6TA 2JA6K 4IOAS 1WIHA 3S1MC 3G4AA 5EGEA 1I50A 1ZVUA 4OINA 1O2FB 2ZJRS 3OEPA 3WODA 5C4XK 5IYDK 5TJ3A 2B63K 2PMZL 3PIPS 5FJ8K 2WB1D 4LR2A 4C3IK 2R93C 1PJ5A 2E2IA 3TFJA 1SFOK 5M3FK 1O2AA 1ZXOA 2Y3PA 5IP7K 1YCLA 1XZPB 1Y1VC 5CHPA 3DXJA 2E2HC 1TWFC 1BJTA 1R9TK 2L5NA 3M4OK 4A3MC 1F9NA 5TMFA 2JH3A 2JA8C 5E68A 1TWHK 1IL2A 5CJ9A 1X31C 5D4DA 3V4GA 3N3YA 2E2JC 1WOOA 1WOPA 5IYDC 5JVOA 1SMYA 3TTGA 2EBBA 3GTLA 3S2DK 4AYBL 2KPUA 3HOVC 3GTMK 3S1RK 4IO9S 4JK1A 1WQFA 1WCMC 4YFKA 3S1NC 2KXYA 5IP7C 1WOSA 1ISEA 3M3YC 2A69A 2CW0A 4G7HA 3HKZL 1K83K 1DCPA 5C3EC 2XCRB 2W7VA 2XCOA 1O29A 4QJVB 4P5AA 2A68A 1BDFA 3GTQA 2JA5C 3LYWA 3RZOK 3BUEA 4BLBA 4KMAA 2CFAA 2VUMK 1IW7A 4YFXA 1JQWA 4KN7A 3S2DC 2YU9C 4A3LK 1ZQ1C 4FM9A 2GSOA 4GTDA 3GTPK 3IPJA 3GTJA 1YNNA 4A3CK 2BE5A 3GTOA 4G7OA 2P5MA 5IYBC 1TWCA 2PA8L 1BGWA 4A3EC 3LPXA 3S0XA 2NVXK 3AD7C 3K7AC 2NVYA 4U67S 3FHZA 2L3UA 2WB1L 4WCES 3H0GA 4KC6A 1EI6A 1XXCA 3BP3A 5DM7S 3S1MK 3HOZK 1O27A 1DCHA 2P8TA 4C2MC 3CQZC 1PJ6A 2D6FC 5IYCC 2ZFZA 3GTGC 1F7UA 4C3JC 4LLGA 3S14K 2R93K 3CAGA 4OIRA 4KAWX 4Q4ZA 2JA7A 4KN4A 1TWGC 3L4KA 2R7ZC 1Y1VK 4XLNA 4GTCA 3OREA 3N0BA 2E2HK 3S1QC 3GTKA 1TWFK 4GTLA 2GAHC 4A3MK 3HOZC 4BXXC 2JA8K 5JVHS 4A3FC 5EGHA 1B4AA 4J3NA 1Y1WC 2E2JK 4KARA 4Q5SA 1VRQC 2R92A 4GTAA 3ADAC 5C4JC 1YNJA 3S14C 4Y7NC 3HOVK 1AB4A 1I3QC 1VH2A 4BBRC 1WCMK 3S1NK 1IBAA 1I6HC 2JA6A 1WQHA 3M3YK 4Y52C 1ZBSA 3FKIC 3ERED 1TWAC 4BBSC 4GTEA 1KQ4A 1O25A 3PO3C 5C3EK 3AH5A 1IE0A 1I50C 1IQ0A 1J6WA 2B63A 3GEIA 2JA5K 1O26A 1HI9A 3S15C 5JVGS 2RH6A 2CFAB 1SFOA 2E2IC 1G51A 4WILA 5IOSA 2YU9K 2WAQL 5C44C 1RU0A 3Q3QA 3DLLS 1WORA 2A6HA 1R9TA 1UV7A 3AQPA 2PPBA 1JOEA 4LK1A 5IYBK 1TWHA 4A3EK 3K7AK 4G0VA 1XZQA 4O2DA 4G0WA 3HXAA 4LOWA 1DCOA 5IP9C 4GTBA 5HL8A 3GTMA 5HL7S 3GTLC 3FOEA 3G4CA 4KB2A 4A3JK 4C2MK 3H3VD 3CQZK 2ZUFA 4GZYA 4MEXA 4A93C 5IYCK 1K83A 3GTGK 4KATA 4C3JK 4QIWD 4XSXA 4A3KK 4KDDA 4RMFA 3A8KA 4PABA 4A3DC 3I4MC 4GT9A 4M1XA 4A3BK 1VLOA 1TWGK 3S16C 3GTQC 3LAJA 2XCQA 2R7ZK 3S17C 1V5VA 2VUMA 3S1QK 4KM9A 2NVTK 5TMCA 4GFQA 4NOIA 4BXXK 3I4NC 4A3FK 1EK8A 2KWAA 4A3JC 3SZYA 1B4BA 4C45A 3GTPA 4FZBA 3TFHA 1J6VA 1Y1WK 3GTJC 3GTOC 5C4JK 1JVIA 1WQGA 4WFNS 1WSRA 2NVXA 2KQ1A 4A3KC 4P9SA 4Y7NK 4A3GC 4BKWA 1F7VA 4KMHA 1HQMA 5FLMC 1I3QK 4BBRK 3CF5S 4A3BC 2NVQC 3NUHA 3FOFA 1I6HK 4WFBS 1IS1A 3GIRA 4Y52K 3FKIK 3H0GC 5IOTA 4G0UA 1TWAK 4BBSK 4A3IC 3GDZA 1L0WA 2NVTC 1J98A 4KMDA 2Y0SD 3HKZD 4BY7C 3PO3K 1BS2A 4WFAS 3HOUC 1I50K 5JFEA 4X6AC 3JSTA 1YX2A 4OIPA 2R93A 3S15K 3A8JA 3HOWC 4KMUA 1USMA 4YFNA 2E2IK 4LJZA 1USOA 3PO2K 2JA7C 1Y1VA 3MMLB 4KASA 1XXAA 4WF9S 2E2HA 4IOCS 5C44K 1TWFA 3GTKC 4KM8A 1F93A 3H3VL 4OIOA 2PA8D 3AQOA 3SZZA 4BY1K 4QIWL 2ZJQS 1XZQB 4P5BA 4G7ZA 2R92C 3LAPA 3T02A 5IP9K 4GTFA 4LQYA 1INNA 3GTLK 1WCMA 2V6UA 3HOYC 5M5WK 3RZDC 4ILDA 3PO2C 3S2HC 3HOXC 4OIQA 2JA6C 2O5IA 4A93K 1XXBA 5M3MK 1O24A 5M5YK 2ZUEA 4KB4A 4XSZA 4A3DK 3L4JA 3I4MK 2JA5A 5C4XC 4BY1C 1O28A 2B63C 3S16K 3GTQK 4C3IC 5HQHA 3QX3A 4C3HK 3S17K 4WJ3M 1O2BA 2FQTA 5DM6S 1WSVA 1J6XA 1XPPA 1SFOC 2YU9A 4ZH4A 4LK0A 2GSNA 3T00A 3I4NK 1XZPA 5IOQA 2Y0SL 2ZJPS 3GTJK 1R9TC 3M4OC 3AD8C 4MEYA 3GTOK 2PMZD 1FEUA 1TWCK 1TWHC 4XLPA 3VA7A 4A3GK 5FLMK 2NVYK 3T01A 3GSIA 2NVQK 2GSUA 3H0GK 4C3HC 4A3IK 4WJ4A 1I6VA 2A6EA 3GTMC 1EQRA 3A8IA 3GEEA 3S1RC 4BY7K 4AH6A 1VGXA 3CQZA 3HOUK 5IORA 3GTGA 4X6AK 1K83C 1EH1A 3PIOS 3EQLA 3HOWK 2FQOA 4BLAA 1TWCC 4QJVA 3BP8C 2GAGC 4DDQA 2RGRA 1TWGA 1GE9A 2R7ZA 2JA7K 3OPFA 4AYBD 1PJ7A 3RZOC 2WAQD 2NVYC 2VUMC 3GTKK 4XCHA 1DD5A 5L46A 4A3LC 3N0CA 1ZYRA 1Y1WA 1C0AA 2V6SA 4PAAA 3GTPC 4A3CC 4MQ9A
chains in the Genus database with same CATH topology
2PA8L 4A3EK 2R92K 4G7ZA 3S1NK 3K7AK 4A3EC 2R92C 5M5XK 2NVXK 3K7AC 5IP9K 2NVXC 2WB1L 5IP9C 3HOYK 3GTLK 3RZDK 3S2HK 3HOYC 4YG2A 3GTLC 5M5WK 2O5JA 3RZDC 3HOXK 3PO2C 2JA6K 3S1MK 3S2HC 4Y52K 3HOZK 4A3JK 3HOXC 4OIQA 2JA6C 4C2MK 3S1MC 2O5IA 3H3VD 3CQZK 4A93K 4GZYA 4C2MC 4MEXA 4A93C 3CQZC 5IYCK 5M3MK 5M5YK 3GTGK 4OINA 4C3JK 4QIWD 5IYCC 3GTGC 4XSXA 4A3KK 4C3JC 4XSZA 4A3DK 4LLGA 5C4XK 3WODA 5IYDK 3I4MK 3S14K 2B63K 2PMZL 5FJ8K 4A3DC 2R93K 5C4XC 4BY1C 2WB1D 2B63C 3I4MC 4C3IK 3S16K 4OIRA 2R93C 3GTQK 4A3BK 1TWGK 4C3IC 4Q4ZA 3S16C 4KN4A 4C3HK 3GTQC 2R7ZK 3S17K 1SFOK 1TWGC 5M3FK 3S17C 2R7ZC 1XPPA 4XLNA 1Y1VK 1SFOC 5IP7K 2NVTK 3S1QK 4ZH4A 2E2HK 4LK0A 5TMCA 1Y1VC 3S1QC 3DXJA 3I4NK 2E2HC 4NOIA 1TWFK 4BXXK 3I4NC 1TWFC 4A3FK 4A3MK 3HOZC 4BXXC 4A3JC 1R9TK 2JA8K 4A3FC 2Y0SL 4A3MC 3M4OK 3GTJK 5TMFA 1R9TC 1Y1WK 3M4OC 2JA8C 4MEYA 3M3YK 4BY7K 3GTOK 3GTJC 2PMZD 1Y1WC 1TWHK 2E2JK 4Q5SA 3GTOC 5D4DA 1TWCK 1TWHC 4XLPA 5C4JK 2E2JC 4A3GK 4A3KC 5C4JC 5IYDC 4Y7NK 4A3GC 5FLMK 1YNJA 3S14C 2NVYK 1HQMA 1SMYA 4Y7NC 5FLMC 2NVQK 1I3QK 4BBRK 3HOVK 4A3BC 2NVQC 3H0GK 3S2DK 1I6HK 1I3QC 1WCMK 4BBRC 4C3HC 3HOVC 3FKIK 3H0GC 4AYBL 4A3IK 1TWAK 1I6HC 3S1RK 4JK1A 3GTMK 1WCMC 1I6VA 2A6EA 4YFKA 3FKIC 4Y52C 4A3IC 3GTMC 1TWAC 5IP7C 3S1RC 2NVTC 3M3YC 3S1NC 4BBSC 2A69A 2Y0SD 3HKZD 4BY7C 3PO3K 3HOUK 2CW0A 4G7HA 3PO3C 3HOUC 1I50K 1K83K 3HKZL 5C3EK 4X6AK 1I50C 1K83C 5C3EC 4X6AC 4BBSK 3EQLA 4QJVB 3HOWK 2A68A 4OIPA 2JA5K 1BDFA 3S15K 3HOWC 4KMUA 1TWCC 4QJVA 2JA5C 3S15C 3RZOK 4YFNA 2JA7K 2E2IK 4AYBD 4LJZA 3RZOC 2WAQD 2NVYC 3PO2K 2JA7C 2E2IC 2VUMK 1IW7A 2YU9K 4YFXA 5C44K 2WAQL 2VUMC 4KN7A 3S2DC 2YU9C 3GTKK 4A3LK 5C44C 3GTKC 4A3LC 2A6HA 2PPBA 1ZYRA 3H3VL 3GTPK 4OIOA 4A3CK 1YNNA 2PA8D 4LK1A 5IYBK 2BE5A 4G7OA 3GTPC 4A3CC 5IYBC 4MQ9A 4BY1K 4QIWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 L;  4A3E K;  2R92 K;  4G7Z A;  3S1N K;  3K7A K;  4A3E C;  2R92 C;  5M5X K;  2NVX K;  3K7A C;  5IP9 K;  2NVX C;  2WB1 L;  5IP9 C;  3HOY K;  3GTL K;  3RZD K;  3S2H K;  3HOY C;  4YG2 A;  3GTL C;  5M5W K;  2O5J A;  3RZD C;  3HOX K;  3PO2 C;  2JA6 K;  3S1M K;  3S2H C;  4Y52 K;  3HOZ K;  4A3J K;  3HOX C;  4OIQ A;  2JA6 C;  4C2M K;  3S1M C;  2O5I A;  3H3V D;  3CQZ K;  4A93 K;  4GZY A;  4C2M C;  4MEX A;  4A93 C;  3CQZ C;  5IYC K;  5M3M K;  5M5Y K;  3GTG K;  4OIN A;  4C3J K;  4QIW D;  5IYC C;  3GTG C;  4XSX A;  4A3K K;  4C3J C;  4XSZ A;  4A3D K;  4LLG A;  5C4X K;  3WOD A;  5IYD K;  3I4M K;  3S14 K;  2B63 K;  2PMZ L;  5FJ8 K;  4A3D C;  2R93 K;  5C4X C;  4BY1 C;  2WB1 D;  2B63 C;  3I4M C;  4C3I K;  3S16 K;  4OIR A;  2R93 C;  3GTQ K;  4A3B K;  1TWG K;  4C3I C;  4Q4Z A;  3S16 C;  4KN4 A;  4C3H K;  3GTQ C;  2R7Z K;  3S17 K;  1SFO K;  1TWG C;  5M3F K;  3S17 C;  2R7Z C;  1XPP A;  4XLN A;  1Y1V K;  1SFO C;  5IP7 K;  2NVT K;  3S1Q K;  4ZH4 A;  2E2H K;  4LK0 A;  5TMC A;  1Y1V C;  3S1Q C;  3DXJ A;  3I4N K;  2E2H C;  4NOI A;  1TWF K;  4BXX K;  3I4N C;  1TWF C;  4A3F K;  4A3M K;  3HOZ C;  4BXX C;  4A3J C;  1R9T K;  2JA8 K;  4A3F C;  2Y0S L;  4A3M C;  3M4O K;  3GTJ K;  5TMF A;  1R9T C;  1Y1W K;  3M4O C;  2JA8 C;  4MEY A;  3M3Y K;  4BY7 K;  3GTO K;  3GTJ C;  2PMZ D;  1Y1W C;  1TWH K;  2E2J K;  4Q5S A;  3GTO C;  5D4D A;  1TWC K;  1TWH C;  4XLP A;  5C4J K;  2E2J C;  4A3G K;  4A3K C;  5C4J C;  5IYD C;  4Y7N K;  4A3G C;  5FLM K;  1YNJ A;  3S14 C;  2NVY K;  1HQM A;  1SMY A;  4Y7N C;  5FLM C;  2NVQ K;  1I3Q K;  4BBR K;  3HOV K;  4A3B C;  2NVQ C;  3H0G K;  3S2D K;  1I6H K;  1I3Q C;  1WCM K;  4BBR C;  4C3H C;  3HOV C;  3FKI K;  3H0G C;  4AYB L;  4A3I K;  1TWA K;  1I6H C;  3S1R K;  4JK1 A;  3GTM K;  1WCM C;  1I6V A;  2A6E A;  4YFK A;  3FKI C;  4Y52 C;  4A3I C;  3GTM C;  1TWA C;  5IP7 C;  3S1R C;  2NVT C;  3M3Y C;  3S1N C;  4BBS C;  2A69 A;  2Y0S D;  3HKZ D;  4BY7 C;  3PO3 K;  3HOU K;  2CW0 A;  4G7H A;  3PO3 C;  3HOU C;  1I50 K;  1K83 K;  3HKZ L;  5C3E K;  4X6A K;  1I50 C;  1K83 C;  5C3E C;  4X6A C;  4BBS K;  3EQL A;  4QJV B;  3HOW K;  2A68 A;  4OIP A;  2JA5 K;  1BDF A;  3S15 K;  3HOW C;  4KMU A;  1TWC C;  4QJV A;  2JA5 C;  3S15 C;  3RZO K;  4YFN A;  2JA7 K;  2E2I K;  4AYB D;  4LJZ A;  3RZO C;  2WAQ D;  2NVY C;  3PO2 K;  2JA7 C;  2E2I C;  2VUM K;  1IW7 A;  2YU9 K;  4YFX A;  5C44 K;  2WAQ L;  2VUM C;  4KN7 A;  3S2D C;  2YU9 C;  3GTK K;  4A3L K;  5C44 C;  3GTK C;  4A3L C;  2A6H A;  2PPB A;  1ZYR A;  3H3V L;  3GTP K;  4OIO A;  4A3C K;  1YNN A;  2PA8 D;  4LK1 A;  5IYB K;  2BE5 A;  4G7O A;  3GTP C;  4A3C C;  5IYB C;  4MQ9 A;  4BY1 K;  4QIW L; 
#chains in the Genus database with same CATH topology
 2R92 K;  5M5X K;  1VJE A;  2NVX C;  3GEH A;  1I3Q A;  3AD9 C;  3TFI A;  3HOY K;  3RZD K;  3FKI A;  3S2H K;  1TWA A;  2PHC B;  4YG2 A;  1EFW A;  2O5J A;  3HOX K;  2V6T A;  2JA6 K;  4IOA S;  1WIH A;  3S1M C;  3G4A A;  5EGE A;  1I50 A;  1ZVU A;  4OIN A;  1O2F B;  2ZJR S;  3OEP A;  3WOD A;  5C4X K;  5IYD K;  5TJ3 A;  2B63 K;  2PMZ L;  3PIP S;  5FJ8 K;  2WB1 D;  4LR2 A;  4C3I K;  2R93 C;  1PJ5 A;  2E2I A;  3TFJ A;  1SFO K;  5M3F K;  1O2A A;  1ZXO A;  2Y3P A;  5IP7 K;  1YCL A;  1XZP B;  1Y1V C;  5CHP A;  3DXJ A;  2E2H C;  1TWF C;  1BJT A;  1R9T K;  2L5N A;  3M4O K;  4A3M C;  1F9N A;  5TMF A;  2JH3 A;  2JA8 C;  5E68 A;  1TWH K;  1IL2 A;  5CJ9 A;  1X31 C;  5D4D A;  3V4G A;  3N3Y A;  2E2J C;  1WOO A;  1WOP A;  5IYD C;  5JVO A;  1SMY A;  3TTG A;  2EBB A;  3GTL A;  3S2D K;  4AYB L;  2KPU A;  3HOV C;  3GTM K;  3S1R K;  4IO9 S;  4JK1 A;  1WQF A;  1WCM C;  4YFK A;  3S1N C;  2KXY A;  5IP7 C;  1WOS A;  1ISE A;  3M3Y C;  2A69 A;  2CW0 A;  4G7H A;  3HKZ L;  1K83 K;  1DCP A;  5C3E C;  2XCR B;  2W7V A;  2XCO A;  1O29 A;  4QJV B;  4P5A A;  2A68 A;  1BDF A;  3GTQ A;  2JA5 C;  3LYW A;  3RZO K;  3BUE A;  4BLB A;  4KMA A;  2CFA A;  2VUM K;  1IW7 A;  4YFX A;  1JQW A;  4KN7 A;  3S2D C;  2YU9 C;  4A3L K;  1ZQ1 C;  4FM9 A;  2GSO A;  4GTD A;  3GTP K;  3IPJ A;  3GTJ A;  1YNN A;  4A3C K;  2BE5 A;  3GTO A;  4G7O A;  2P5M A;  5IYB C;  1TWC A;  2PA8 L;  1BGW A;  4A3E C;  3LPX A;  3S0X A;  2NVX K;  3AD7 C;  3K7A C;  2NVY A;  4U67 S;  3FHZ A;  2L3U A;  2WB1 L;  4WCE S;  3H0G A;  4KC6 A;  1EI6 A;  1XXC A;  3BP3 A;  5DM7 S;  3S1M K;  3HOZ K;  1O27 A;  1DCH A;  2P8T A;  4C2M C;  3CQZ C;  1PJ6 A;  2D6F C;  5IYC C;  2ZFZ A;  3GTG C;  1F7U A;  4C3J C;  4LLG A;  3S14 K;  2R93 K;  3CAG A;  4OIR A;  4KAW X;  4Q4Z A;  2JA7 A;  4KN4 A;  1TWG C;  3L4K A;  2R7Z C;  1Y1V K;  4XLN A;  4GTC A;  3ORE A;  3N0B A;  2E2H K;  3S1Q C;  3GTK A;  1TWF K;  4GTL A;  2GAH C;  4A3M K;  3HOZ C;  4BXX C;  2JA8 K;  5JVH S;  4A3F C;  5EGH A;  1B4A A;  4J3N A;  1Y1W C;  2E2J K;  4KAR A;  4Q5S A;  1VRQ C;  2R92 A;  4GTA A;  3ADA C;  5C4J C;  1YNJ A;  3S14 C;  4Y7N C;  3HOV K;  1AB4 A;  1I3Q C;  1VH2 A;  4BBR C;  1WCM K;  3S1N K;  1IBA A;  1I6H C;  2JA6 A;  1WQH A;  3M3Y K;  4Y52 C;  1ZBS A;  3FKI C;  3ERE D;  1TWA C;  4BBS C;  4GTE A;  1KQ4 A;  1O25 A;  3PO3 C;  5C3E K;  3AH5 A;  1IE0 A;  1I50 C;  1IQ0 A;  1J6W A;  2B63 A;  3GEI A;  2JA5 K;  1O26 A;  1HI9 A;  3S15 C;  5JVG S;  2RH6 A;  2CFA B;  1SFO A;  2E2I C;  1G51 A;  4WIL A;  5IOS A;  2YU9 K;  2WAQ L;  5C44 C;  1RU0 A;  3Q3Q A;  3DLL S;  1WOR A;  2A6H A;  1R9T A;  1UV7 A;  3AQP A;  2PPB A;  1JOE A;  4LK1 A;  5IYB K;  1TWH A;  4A3E K;  3K7A K;  4G0V A;  1XZQ A;  4O2D A;  4G0W A;  3HXA A;  4LOW A;  1DCO A;  5IP9 C;  4GTB A;  5HL8 A;  3GTM A;  5HL7 S;  3GTL C;  3FOE A;  3G4C A;  4KB2 A;  4A3J K;  4C2M K;  3H3V D;  3CQZ K;  2ZUF A;  4GZY A;  4MEX A;  4A93 C;  5IYC K;  1K83 A;  3GTG K;  4KAT A;  4C3J K;  4QIW D;  4XSX A;  4A3K K;  4KDD A;  4RMF A;  3A8K A;  4PAB A;  4A3D C;  3I4M C;  4GT9 A;  4M1X A;  4A3B K;  1VLO A;  1TWG K;  3S16 C;  3GTQ C;  3LAJ A;  2XCQ A;  2R7Z K;  3S17 C;  1V5V A;  2VUM A;  3S1Q K;  4KM9 A;  2NVT K;  5TMC A;  4GFQ A;  4NOI A;  4BXX K;  3I4N C;  4A3F K;  1EK8 A;  2KWA A;  4A3J C;  3SZY A;  1B4B A;  4C45 A;  3GTP A;  4FZB A;  3TFH A;  1J6V A;  1Y1W K;  3GTJ C;  3GTO C;  5C4J K;  1JVI A;  1WQG A;  4WFN S;  1WSR A;  2NVX A;  2KQ1 A;  4A3K C;  4P9S A;  4Y7N K;  4A3G C;  4BKW A;  1F7V A;  4KMH A;  1HQM A;  5FLM C;  1I3Q K;  4BBR K;  3CF5 S;  4A3B C;  2NVQ C;  3NUH A;  3FOF A;  1I6H K;  4WFB S;  1IS1 A;  3GIR A;  4Y52 K;  3FKI K;  3H0G C;  5IOT A;  4G0U A;  1TWA K;  4BBS K;  4A3I C;  3GDZ A;  1L0W A;  2NVT C;  1J98 A;  4KMD A;  2Y0S D;  3HKZ D;  4BY7 C;  3PO3 K;  1BS2 A;  4WFA S;  3HOU C;  1I50 K;  5JFE A;  4X6A C;  3JST A;  1YX2 A;  4OIP A;  2R93 A;  3S15 K;  3A8J A;  3HOW C;  4KMU A;  1USM A;  4YFN A;  2E2I K;  4LJZ A;  1USO A;  3PO2 K;  2JA7 C;  1Y1V A;  3MML B;  4KAS A;  1XXA A;  4WF9 S;  2E2H A;  4IOC S;  5C44 K;  1TWF A;  3GTK C;  4KM8 A;  1F93 A;  3H3V L;  4OIO A;  2PA8 D;  3AQO A;  3SZZ A;  4BY1 K;  4QIW L;  2ZJQ S;  1XZQ B;  4P5B A;  4G7Z A;  2R92 C;  3LAP A;  3T02 A;  5IP9 K;  4GTF A;  4LQY A;  1INN A;  3GTL K;  1WCM A;  2V6U A;  3HOY C;  5M5W K;  3RZD C;  4ILD A;  3PO2 C;  3S2H C;  3HOX C;  4OIQ A;  2JA6 C;  2O5I A;  4A93 K;  1XXB A;  5M3M K;  1O24 A;  5M5Y K;  2ZUE A;  4KB4 A;  4XSZ A;  4A3D K;  3L4J A;  3I4M K;  2JA5 A;  5C4X C;  4BY1 C;  1O28 A;  2B63 C;  3S16 K;  3GTQ K;  4C3I C;  5HQH A;  3QX3 A;  4C3H K;  3S17 K;  4WJ3 M;  1O2B A;  2FQT A;  5DM6 S;  1WSV A;  1J6X A;  1XPP A;  1SFO C;  2YU9 A;  4ZH4 A;  4LK0 A;  2GSN A;  3T00 A;  3I4N K;  1XZP A;  5IOQ A;  2Y0S L;  2ZJP S;  3GTJ K;  1R9T C;  3M4O C;  3AD8 C;  4MEY A;  3GTO K;  2PMZ D;  1FEU A;  1TWC K;  1TWH C;  4XLP A;  3VA7 A;  4A3G K;  5FLM K;  2NVY K;  3T01 A;  3GSI A;  2NVQ K;  2GSU A;  3H0G K;  4C3H C;  4A3I K;  4WJ4 A;  1I6V A;  2A6E A;  3GTM C;  1EQR A;  3A8I A;  3GEE A;  3S1R C;  4BY7 K;  4AH6 A;  1VGX A;  3CQZ A;  3HOU K;  5IOR A;  3GTG A;  4X6A K;  1K83 C;  1EH1 A;  3PIO S;  3EQL A;  3HOW K;  2FQO A;  4BLA A;  1TWC C;  4QJV A;  3BP8 C;  2GAG C;  4DDQ A;  2RGR A;  1TWG A;  1GE9 A;  2R7Z A;  2JA7 K;  3OPF A;  4AYB D;  1PJ7 A;  3RZO C;  2WAQ D;  2NVY C;  2VUM C;  3GTK K;  4XCH A;  1DD5 A;  5L46 A;  4A3L C;  3N0C A;  1ZYR A;  1Y1W A;  1C0A A;  2V6S A;  4PAA A;  3GTP C;  4A3C C;  4MQ9 A; 
#chains in the Genus database with same CATH homology
 2PA8 L;  4A3E K;  2R92 K;  4G7Z A;  3S1N K;  3K7A K;  4A3E C;  2R92 C;  5M5X K;  2NVX K;  3K7A C;  5IP9 K;  2NVX C;  2WB1 L;  5IP9 C;  3HOY K;  3GTL K;  3RZD K;  3S2H K;  3HOY C;  4YG2 A;  3GTL C;  5M5W K;  2O5J A;  3RZD C;  3HOX K;  3PO2 C;  2JA6 K;  3S1M K;  3S2H C;  4Y52 K;  3HOZ K;  4A3J K;  3HOX C;  4OIQ A;  2JA6 C;  4C2M K;  3S1M C;  2O5I A;  3H3V D;  3CQZ K;  4A93 K;  4GZY A;  4C2M C;  4MEX A;  4A93 C;  3CQZ C;  5IYC K;  5M3M K;  5M5Y K;  3GTG K;  4OIN A;  4C3J K;  4QIW D;  5IYC C;  3GTG C;  4XSX A;  4A3K K;  4C3J C;  4XSZ A;  4A3D K;  4LLG A;  5C4X K;  3WOD A;  5IYD K;  3I4M K;  3S14 K;  2B63 K;  2PMZ L;  5FJ8 K;  4A3D C;  2R93 K;  5C4X C;  4BY1 C;  2WB1 D;  2B63 C;  3I4M C;  4C3I K;  3S16 K;  4OIR A;  2R93 C;  3GTQ K;  4A3B K;  1TWG K;  4C3I C;  4Q4Z A;  3S16 C;  4KN4 A;  4C3H K;  3GTQ C;  2R7Z K;  3S17 K;  1SFO K;  1TWG C;  5M3F K;  3S17 C;  2R7Z C;  1XPP A;  4XLN A;  1Y1V K;  1SFO C;  5IP7 K;  2NVT K;  3S1Q K;  4ZH4 A;  2E2H K;  4LK0 A;  5TMC A;  1Y1V C;  3S1Q C;  3DXJ A;  3I4N K;  2E2H C;  4NOI A;  1TWF K;  4BXX K;  3I4N C;  1TWF C;  4A3F K;  4A3M K;  3HOZ C;  4BXX C;  4A3J C;  1R9T K;  2JA8 K;  4A3F C;  2Y0S L;  4A3M C;  3M4O K;  3GTJ K;  5TMF A;  1R9T C;  1Y1W K;  3M4O C;  2JA8 C;  4MEY A;  3M3Y K;  4BY7 K;  3GTO K;  3GTJ C;  2PMZ D;  1Y1W C;  1TWH K;  2E2J K;  4Q5S A;  3GTO C;  5D4D A;  1TWC K;  1TWH C;  4XLP A;  5C4J K;  2E2J C;  4A3G K;  4A3K C;  5C4J C;  5IYD C;  4Y7N K;  4A3G C;  5FLM K;  1YNJ A;  3S14 C;  2NVY K;  1HQM A;  1SMY A;  4Y7N C;  5FLM C;  2NVQ K;  1I3Q K;  4BBR K;  3HOV K;  4A3B C;  2NVQ C;  3H0G K;  3S2D K;  1I6H K;  1I3Q C;  1WCM K;  4BBR C;  4C3H C;  3HOV C;  3FKI K;  3H0G C;  4AYB L;  4A3I K;  1TWA K;  1I6H C;  3S1R K;  4JK1 A;  3GTM K;  1WCM C;  1I6V A;  2A6E A;  4YFK A;  3FKI C;  4Y52 C;  4A3I C;  3GTM C;  1TWA C;  5IP7 C;  3S1R C;  2NVT C;  3M3Y C;  3S1N C;  4BBS C;  2A69 A;  2Y0S D;  3HKZ D;  4BY7 C;  3PO3 K;  3HOU K;  2CW0 A;  4G7H A;  3PO3 C;  3HOU C;  1I50 K;  1K83 K;  3HKZ L;  5C3E K;  4X6A K;  1I50 C;  1K83 C;  5C3E C;  4X6A C;  4BBS K;  3EQL A;  4QJV B;  3HOW K;  2A68 A;  4OIP A;  2JA5 K;  1BDF A;  3S15 K;  3HOW C;  4KMU A;  1TWC C;  4QJV A;  2JA5 C;  3S15 C;  3RZO K;  4YFN A;  2JA7 K;  2E2I K;  4AYB D;  4LJZ A;  3RZO C;  2WAQ D;  2NVY C;  3PO2 K;  2JA7 C;  2E2I C;  2VUM K;  1IW7 A;  2YU9 K;  4YFX A;  5C44 K;  2WAQ L;  2VUM C;  4KN7 A;  3S2D C;  2YU9 C;  3GTK K;  4A3L K;  5C44 C;  3GTK C;  4A3L C;  2A6H A;  2PPB A;  1ZYR A;  3H3V L;  3GTP K;  4OIO A;  4A3C K;  1YNN A;  2PA8 D;  4LK1 A;  5IYB K;  2BE5 A;  4G7O A;  3GTP C;  4A3C C;  5IYB C;  4MQ9 A;  4BY1 K;  4QIW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...