5TMFA

Re-refinement of thermus thermophilus rna polymerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
total genus 44
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmfA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmfA01
3GTOK 1TWGC 3GTGK 3H0GK 3S2DK 3CQZK 3S1QK 1TWFC 3HOVC 3GTOC 2YU9K 4A3KK 4XLPA 3GTGC 3H0GC 5C4JC 3CQZC 3S1QC 3S2DC 4A3CK 2NVTK 5M3FK 2PMZL 2YU9C 4A3KC 3FKIK 3H3VL 4C3HK 4Q4ZA 4A3CC 4A93K 2NVTC 1ZYRA 2E2HK 4G7HA 2NVYK 2JA6K 3S14K 3FKIC 4C3HC 1K83K 4A93C 3S15K 2E2HC 2JA6C 3S14C 2NVYC 4Q5SA 2PA8D 1K83C 4GZYA 2E2IK 3HOXK 4YG2A 4OIQA 2PPBA 4G7OA 1I6HK 4A3DK 5D4DA 5IYBK 2E2IC 3HOXC 2WAQD 3GTMK 4MEXA 3GTPK 2R93K 1I6HC 4X6AK 4YFNA 4KN7A 4YFKA 3I4MK 4A3DC 4BY1K 5IYBC 2Y0SD 4KMUA 3GTMC 3GTPC 1YNJA 2R93C 4X6AC 4MQ9A 1TWCK 2WB1L 5C4JK 3HOZK 3I4MC 4BY1C 4C3IK 4BBSK 1TWCC 5FLMK 4G7ZA 3HOZC 1WCMK 4OINA 4C3IC 4BBSC 5FLMC 1WCMC 1SFOK 2VUMK 3PO3K 2A6EA 3HOUK 5IP9K 5M5YK 2JA7K 3HOVK 2NVXK 2A6HA 1SFOC 4YFXA 4OIOA 2VUMC 3PO3C 1TWAK 3HOUC 3DXJA 5IP9C 2JA7C 3WODA 2NVXC 4BBRK 4A3BK 2R7ZK 4QIWD 2R92K 1TWAC 1SMYA 4A3BC 4BBRC 4Y7NK 2BE5A 4BXXK 3K7AK 4QJVA 3GTJK 2R7ZC 2JA8K 4Y52K 2R92C 1IW7A 3S1RK 2O5IA 4Y7NC 4BXXC 3HKZD 3K7AC 1I50K 3GTJC 1TWHK 4A3JK 4Y52C 2JA8C 5C4XK 3GTKK 3S1RC 1I3QK 4AYBL 4KN4A 2PA8L 3RZDK 3S16K 1TWHC 1I50C 4LJZA 4A3JC 3S15C 3GTKC 1HQMA 5C4XC 3S16C 1I3QC 3RZDC 3HOYK 5M5WK 4A3FK 4XSZA 1R9TK 2A68A 3M3YK 5TMCA 3HOYC 4A3MK 2WB1D 4A3FC 1R9TC 3M3YC 3S1NK 4A3MC 5IYCK 4OIRA 3HOWK 2PMZD 4ZH4A 5TMFA 3S1NC 3H3VD 5IYCC 2JA5K 5IYDK 3HOWC 2NVQK 1Y1VK 5C44K 3GTQK 3I4NK 3RZOK 4JK1A 5IYDC 2JA5C 2A69A 3EQLA 4NOIA 1XPPA 5M5XK 2E2JK 4QJVB 4LLGA 3PO2K 2NVQC 1Y1VC 5C44C 3GTQC 3RZOC 3I4NC 5FJ8K 3S2HK 2B63K 2E2JC 4C2MK 1Y1WK 3PO2C 4QIWL 3S2HC 3GTLK 5IP7K 3M4OK 4C3JK 2B63C 4C2MC 1Y1WC 4A3GK 3GTLC 4MEYA 2WAQL 5IP7C 3S17K 4OIPA 4A3IK 3M4OC 4C3JC 4XLNA 4AYBD 4LK0A 3HKZL 4A3GC 2Y0SL 5C3EK 1YNNA 2O5JA 4A3EK 3S1MK 3S17C 5M3MK 4LK1A 4A3IC 4A3LK 4BY7K 4A3EC 3S1MC 5C3EC 1BDFA 1TWGK 4A3LC 4XSXA 4BY7C 1TWFK 1I6VA 2CW0A
chains in the Genus database with same CATH superfamily
3CQZA 2RH6A 4GFQA 5JVGS 5C4JC 3CQZC 1X31C 1VH2A 4A3KC 3H3VL 4PAAA 4A93K 2NVTC 5EGEA 1K83A 2NVYK 2E2HK 2JA6K 3S14K 4C3HC 4FM9A 3CAGA 4KMAA 1XZQB 1ZVUA 1K83C 4GZYA 2E2IK 4KAWX 3HOXK 1B4AA 4WFAS 3GTMA 1EK8A 1EH1A 2Y3PA 3GTPA 1I6HC 4X6AK 2XCQA 5IYBC 1DD5A 3GTMC 3GTPC 1TWCK 1WIHA 1WQHA 5C4JK 4BY1C 5FLMK 1WCMK 2KWAA 3LAPA 4C3IC 2VUMA 1SFOK 2JA7A 5M5YK 1PJ5A 4OIOA 2VUMC 3HOUC 2JA7C 1WOOA 3WODA 4G0WA 1F7UA 1O2AA 4A3BC 4BXXK 3K7AK 2P5MA 1I50A 3S1RK 4A3JK 4GTFA 4KB2A 5C4XK 4WFBS 1I50C 3HOYK 1R9TA 5M5WK 2A68A 4RMFA 2XCOA 1AB4A 3GSIA 2WB1D 1R9TC 3GEEA 2D6FC 2ZJQS 1USOA 4KMDA 3S1NC 3N3YA 3Q3QA 4GTDA 3RZOK 4JK1A 5IYDC 1WQGA 3EQLA 1WOSA 3PO2K 5C44C 2B63A 3GDZA 3NUHA 3GTLA 5DM7S 1IQ0A 5IP7K 2B63C 4C2MC 4U67S 3GTLC 3S17K 4OIPA 4XLNA 4AYBD 5HQHA 1DCPA 1ZBSA 3T02A 3AD9C 4WF9S 3DLLS 1J6XA 4FZBA 4A3LC 4KARA 1TWFK 1I6VA 3GEHA 3HOVK 3GTOK 5JVHS 3GTGK 3H0GK 3S2DK 1O2BA 4WILA 2L3UA 2YU9K 2RGRA 1G51A 2W7VA 4KM8A 3FKIK 1F7VA 4O2DA 2E2HA 4Q4ZA 2JA6A 2NVYA 3FOEA 1ZYRA 4G7HA 1O28A 5CHPA 4A93C 4GTLA 2E2HC 2JA6C 3S14C 2NVYC 4Q5SA 2E2IA 2ZUEA 2PA8D 3TFHA 4OIQA 4G7OA 1DCOA 1O26A 1VJEA 1IE0A 2E2IC 3HOXC 2ZJPS 2R93K 1GE9A 3I4MK 1TWCA 2KXYA 2Y0SD 4KMUA 1YX2A 4X6AC 3HOZK 5IOQA 1XXCA 1WCMA 4BBSK 1TWCC 4G7ZA 4WJ3M 5CJ9A 4OINA 2V6UA 4BLAA 1SFOA 5FLMC 1WCMC 5IOSA 1ZXOA 3PO3K 2A6EA 5IP9K 4GT9A 1SFOC 4YFXA 1TWAK 4BBRK 2R7ZK 2R92K 4QJVA 2JA8K 4Y52K 4IO9S 3S15K 4BXXC 3K7AC 3N0BA 3SZZA 3QX3A 3S16K 3S1RC 3RZDK 2PA8L 4A3JC 1XZPA 5C4XC 3LAJA 3TFIA 3FHZA 3A8KA 3HOYC 4A3MK 2ZJRS 3L4KA 1O2FB 3BP3A 4LQYA 4AH6A 3PIOS 4GTCA 5TMFA 4LR2A 1JQWA 4PABA 4BLBA 2NVQK 1Y1VK 3GTQK 3I4NK 2ZUFA 2A69A 2E2JK 4NOIA 5L46A 4QJVB 3RZOC 4BKWA 1Y1WK 3PO2C 3GEIA 5E68A 5JFEA 2GSNA 1XZPB 5JVOA 4A3GK 4MEYA 5EGHA 5IP7C 3TFJA 4KASA 3S1MK 5C3EK 1YNNA 3S17C 1BS2A 4BY7K 1IL2A 4C45A 1EFWA 1TWFA 3LYWA 1J6VA 1TWGK 4XSXA 3GTOA 4J3NA 3GTGA 3H0GA 3LPXA 4WJ4A 1YCLA 2YU9A 3S1QK 1TWFC 3CF5S 3HOVC 3GTOC 2KQ1A 3H0GC 3GTGC 3S2DC 1F93A 3FKIA 4A3CK 3GIRA 2YU9C 4IOAS 3AD7C 3MMLB 1XXBA 1RU0A 3FKIC 3HXAA 5HL7S 4IOCS 1HI9A 4YG2A 2PPBA 3T00A 4A3DK 3G4AA 2R93A 2GSUA 1XXAA 2WAQD 4MEXA 1BJTA 4YFNA 2GAGC 4YFKA 1YNJA 2R93C 1O27A 3A8JA 2WB1L 3I4MC 3AQPA 3HOZC 1ZQ1C 4BBSC 3V4GA 2PHCB 4GTEA 2NVXK 1TWAA 3PO3C 2R7ZA 5IP9C 2R92A 3G4CA 1TWAC 1SMYA 3IPJA 4BBRC 4Y7NK 2BE5A 3GTJK 2R7ZC 2R92C 1IW7A 1WSRA 2O5IA 1TWHK 4Y52C 2JA8C 3GTKK 3AQOA 1I3QK 4ILDA 4AYBL 3S15C 3S16C 3RZDC 4A3FK 4XSZA 3M3YK 1O25A 5TMCA 3TTGA 1L0WA 4KDDA 4A3MC 5IOTA 5IYCK 4OIRA 3HOWK 2PMZD 3BUEA 1JVIA 2JA5K 3GTQA 1Y1VA 3ERED 1USMA 1XPPA 5M5XK 3S2HK 2NVQC 1Y1VC 3GTQC 3I4NC 2JH3A 1Y1WA 2E2JC 3M4OK 4C3JK 1Y1WC 3VA7A 4M1XA 1INNA 1JOEA 4A3IK 4A3EK 4LK0A 4P5BA 4A3GC 2Y0SL 2O5JA 3S1MC 5C3EC 3S0XA 1TWGA 1WORA 4BY7C 1DCHA 4WCES 2CW0A 1TWGC 3CQZK 1EQRA 4A3KK 4XLPA 2CFAA 3S1QC 1WOPA 2NVTK 4WFNS 5M3FK 2PMZL 3AD8C 4C3HK 4A3CC 1J6WA 1PJ6A 3BP8C 1K83K 3A8IA 4P9SA 4G0UA 5DM6S 2FQTA 1I6HK 5D4DA 3OEPA 5IYBK 2V6SA 3GTMK 4KB4A 3GTPK 4KN7A 4A3DC 4BY1K 2FQOA 1EI6A 3N0CA 4MQ9A 1KQ4A 1J98A 2ZFZA 4C3IK 1VRQC 1O24A 2CFAB 2NVXA 2VUMK 3HOUK 1FEUA 2JA7K 2A6HA 3DXJA 4A3BK 2NVXC 2L5NA 1ISEA 4QIWD 4LOWA 4KC6A 3ADAC 3GTJA 3T01A 3FOFA 2P8TA 4GTBA 3L4JA 1TWHA 3AH5A 4KM9A 3GTKA 4Y7NC 1I50K 3HKZD 1I3QA 3GTJC 4P5AA 4KN4A 1BGWA 1TWHC 4LJZA 3GTKC 1HQMA 4KMHA 1I3QC 2V6TA 3OREA 3JSTA 1R9TK 2EBBA 1F9NA 4A3FC 3M3YC 3S1NK 1WSVA 1C0AA 3SZYA 1IBAA 4ZH4A 4XCHA 1UV7A 3H3VD 2JA5A 5IYCC 5IYDK 3HOWC 5IORA 1V5VA 5C44K 1VLOA 2JA5C 5TJ3A 4LLGA 5FJ8K 1PJ7A 2B63K 4C2MK 3GTLK 4QIWL 3S2HC 1O29A 1IS1A 2XCRB 1VGXA 1XZQA 4G0VA 2WAQL 4GTAA 3M4OC 4C3JC 2GAHC 3HKZL 1B4BA 4KATA 1WQFA 3OPFA 5M3MK 3PIPS 4LK1A 4A3IC 4A3LK 4A3EC 5HL8A 1BDFA 2KPUA 4DDQA 2GSOA
chains in the Genus database with same CATH topology
3GTOK 1TWGC 3GTGK 3H0GK 3S2DK 3CQZK 3S1QK 1TWFC 3HOVC 3GTOC 2YU9K 4A3KK 4XLPA 3GTGC 3H0GC 5C4JC 3CQZC 3S1QC 3S2DC 4A3CK 2NVTK 5M3FK 2PMZL 2YU9C 4A3KC 3FKIK 3H3VL 4C3HK 4Q4ZA 4A3CC 4A93K 2NVTC 1ZYRA 2E2HK 4G7HA 2NVYK 2JA6K 3S14K 3FKIC 4C3HC 1K83K 4A93C 3S15K 2E2HC 2JA6C 3S14C 2NVYC 4Q5SA 2PA8D 1K83C 4GZYA 2E2IK 3HOXK 4YG2A 4OIQA 2PPBA 4G7OA 1I6HK 4A3DK 5D4DA 5IYBK 2E2IC 3HOXC 2WAQD 3GTMK 4MEXA 3GTPK 2R93K 1I6HC 4X6AK 4YFNA 4KN7A 4YFKA 3I4MK 4A3DC 4BY1K 5IYBC 2Y0SD 4KMUA 3GTMC 3GTPC 1YNJA 2R93C 4X6AC 4MQ9A 1TWCK 2WB1L 5C4JK 3HOZK 3I4MC 4BY1C 4C3IK 4BBSK 1TWCC 5FLMK 4G7ZA 3HOZC 1WCMK 4OINA 4C3IC 4BBSC 5FLMC 1WCMC 1SFOK 2VUMK 3PO3K 2A6EA 3HOUK 5IP9K 5M5YK 2JA7K 3HOVK 2NVXK 2A6HA 1SFOC 4YFXA 4OIOA 2VUMC 3PO3C 1TWAK 3HOUC 3DXJA 5IP9C 2JA7C 3WODA 2NVXC 4BBRK 4A3BK 2R7ZK 4QIWD 2R92K 1TWAC 1SMYA 4A3BC 4BBRC 4Y7NK 2BE5A 4BXXK 3K7AK 4QJVA 3GTJK 2R7ZC 2JA8K 4Y52K 2R92C 1IW7A 3S1RK 2O5IA 4Y7NC 4BXXC 3HKZD 3K7AC 1I50K 3GTJC 1TWHK 4A3JK 4Y52C 2JA8C 5C4XK 3GTKK 3S1RC 1I3QK 4AYBL 4KN4A 2PA8L 3RZDK 3S16K 1TWHC 1I50C 4LJZA 4A3JC 3S15C 3GTKC 1HQMA 5C4XC 3S16C 1I3QC 3RZDC 3HOYK 5M5WK 4A3FK 4XSZA 1R9TK 2A68A 3M3YK 5TMCA 3HOYC 4A3MK 2WB1D 4A3FC 1R9TC 3M3YC 3S1NK 4A3MC 5IYCK 4OIRA 3HOWK 2PMZD 4ZH4A 5TMFA 3S1NC 3H3VD 5IYCC 2JA5K 5IYDK 3HOWC 2NVQK 1Y1VK 5C44K 3GTQK 3I4NK 3RZOK 4JK1A 5IYDC 2JA5C 2A69A 3EQLA 4NOIA 1XPPA 5M5XK 2E2JK 4QJVB 4LLGA 3PO2K 2NVQC 1Y1VC 5C44C 3GTQC 3RZOC 3I4NC 5FJ8K 3S2HK 2B63K 2E2JC 4C2MK 1Y1WK 3PO2C 4QIWL 3S2HC 3GTLK 5IP7K 3M4OK 4C3JK 2B63C 4C2MC 1Y1WC 4A3GK 3GTLC 4MEYA 2WAQL 5IP7C 3S17K 4OIPA 4A3IK 3M4OC 4C3JC 4XLNA 4AYBD 4LK0A 3HKZL 4A3GC 2Y0SL 5C3EK 1YNNA 2O5JA 4A3EK 3S1MK 3S17C 5M3MK 4LK1A 4A3IC 4A3LK 4BY7K 4A3EC 3S1MC 5C3EC 1BDFA 1TWGK 4A3LC 4XSXA 4BY7C 1TWFK 1I6VA 2CW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO K;  1TWG C;  3GTG K;  3H0G K;  3S2D K;  3CQZ K;  3S1Q K;  1TWF C;  3HOV C;  3GTO C;  2YU9 K;  4A3K K;  4XLP A;  3GTG C;  3H0G C;  5C4J C;  3CQZ C;  3S1Q C;  3S2D C;  4A3C K;  2NVT K;  5M3F K;  2PMZ L;  2YU9 C;  4A3K C;  3FKI K;  3H3V L;  4C3H K;  4Q4Z A;  4A3C C;  4A93 K;  2NVT C;  1ZYR A;  2E2H K;  4G7H A;  2NVY K;  2JA6 K;  3S14 K;  3FKI C;  4C3H C;  1K83 K;  4A93 C;  3S15 K;  2E2H C;  2JA6 C;  3S14 C;  2NVY C;  4Q5S A;  2PA8 D;  1K83 C;  4GZY A;  2E2I K;  3HOX K;  4YG2 A;  4OIQ A;  2PPB A;  4G7O A;  1I6H K;  4A3D K;  5D4D A;  5IYB K;  2E2I C;  3HOX C;  2WAQ D;  3GTM K;  4MEX A;  3GTP K;  2R93 K;  1I6H C;  4X6A K;  4YFN A;  4KN7 A;  4YFK A;  3I4M K;  4A3D C;  4BY1 K;  5IYB C;  2Y0S D;  4KMU A;  3GTM C;  3GTP C;  1YNJ A;  2R93 C;  4X6A C;  4MQ9 A;  1TWC K;  2WB1 L;  5C4J K;  3HOZ K;  3I4M C;  4BY1 C;  4C3I K;  4BBS K;  1TWC C;  5FLM K;  4G7Z A;  3HOZ C;  1WCM K;  4OIN A;  4C3I C;  4BBS C;  5FLM C;  1WCM C;  1SFO K;  2VUM K;  3PO3 K;  2A6E A;  3HOU K;  5IP9 K;  5M5Y K;  2JA7 K;  3HOV K;  2NVX K;  2A6H A;  1SFO C;  4YFX A;  4OIO A;  2VUM C;  3PO3 C;  1TWA K;  3HOU C;  3DXJ A;  5IP9 C;  2JA7 C;  3WOD A;  2NVX C;  4BBR K;  4A3B K;  2R7Z K;  4QIW D;  2R92 K;  1TWA C;  1SMY A;  4A3B C;  4BBR C;  4Y7N K;  2BE5 A;  4BXX K;  3K7A K;  4QJV A;  3GTJ K;  2R7Z C;  2JA8 K;  4Y52 K;  2R92 C;  1IW7 A;  3S1R K;  2O5I A;  4Y7N C;  4BXX C;  3HKZ D;  3K7A C;  1I50 K;  3GTJ C;  1TWH K;  4A3J K;  4Y52 C;  2JA8 C;  5C4X K;  3GTK K;  3S1R C;  1I3Q K;  4AYB L;  4KN4 A;  2PA8 L;  3RZD K;  3S16 K;  1TWH C;  1I50 C;  4LJZ A;  4A3J C;  3S15 C;  3GTK C;  1HQM A;  5C4X C;  3S16 C;  1I3Q C;  3RZD C;  3HOY K;  5M5W K;  4A3F K;  4XSZ A;  1R9T K;  2A68 A;  3M3Y K;  5TMC A;  3HOY C;  4A3M K;  2WB1 D;  4A3F C;  1R9T C;  3M3Y C;  3S1N K;  4A3M C;  5IYC K;  4OIR A;  3HOW K;  2PMZ D;  4ZH4 A;  5TMF A;  3S1N C;  3H3V D;  5IYC C;  2JA5 K;  5IYD K;  3HOW C;  2NVQ K;  1Y1V K;  5C44 K;  3GTQ K;  3I4N K;  3RZO K;  4JK1 A;  5IYD C;  2JA5 C;  2A69 A;  3EQL A;  4NOI A;  1XPP A;  5M5X K;  2E2J K;  4QJV B;  4LLG A;  3PO2 K;  2NVQ C;  1Y1V C;  5C44 C;  3GTQ C;  3RZO C;  3I4N C;  5FJ8 K;  3S2H K;  2B63 K;  2E2J C;  4C2M K;  1Y1W K;  3PO2 C;  4QIW L;  3S2H C;  3GTL K;  5IP7 K;  3M4O K;  4C3J K;  2B63 C;  4C2M C;  1Y1W C;  4A3G K;  3GTL C;  4MEY A;  2WAQ L;  5IP7 C;  3S17 K;  4OIP A;  4A3I K;  3M4O C;  4C3J C;  4XLN A;  4AYB D;  4LK0 A;  3HKZ L;  4A3G C;  2Y0S L;  5C3E K;  1YNN A;  2O5J A;  4A3E K;  3S1M K;  3S17 C;  5M3M K;  4LK1 A;  4A3I C;  4A3L K;  4BY7 K;  4A3E C;  3S1M C;  5C3E C;  1BDF A;  1TWG K;  4A3L C;  4XSX A;  4BY7 C;  1TWF K;  1I6V A;  2CW0 A; 
#chains in the Genus database with same CATH topology
 3CQZ A;  2RH6 A;  4GFQ A;  5JVG S;  5C4J C;  3CQZ C;  1X31 C;  1VH2 A;  4A3K C;  3H3V L;  4PAA A;  4A93 K;  2NVT C;  5EGE A;  1K83 A;  2NVY K;  2E2H K;  2JA6 K;  3S14 K;  4C3H C;  4FM9 A;  3CAG A;  4KMA A;  1XZQ B;  1ZVU A;  1K83 C;  4GZY A;  2E2I K;  4KAW X;  3HOX K;  1B4A A;  4WFA S;  3GTM A;  1EK8 A;  1EH1 A;  2Y3P A;  3GTP A;  1I6H C;  4X6A K;  2XCQ A;  5IYB C;  1DD5 A;  3GTM C;  3GTP C;  1TWC K;  1WIH A;  1WQH A;  5C4J K;  4BY1 C;  5FLM K;  1WCM K;  2KWA A;  3LAP A;  4C3I C;  2VUM A;  1SFO K;  2JA7 A;  5M5Y K;  1PJ5 A;  4OIO A;  2VUM C;  3HOU C;  2JA7 C;  1WOO A;  3WOD A;  4G0W A;  1F7U A;  1O2A A;  4A3B C;  4BXX K;  3K7A K;  2P5M A;  1I50 A;  3S1R K;  4A3J K;  4GTF A;  4KB2 A;  5C4X K;  4WFB S;  1I50 C;  3HOY K;  1R9T A;  5M5W K;  2A68 A;  4RMF A;  2XCO A;  1AB4 A;  3GSI A;  2WB1 D;  1R9T C;  3GEE A;  2D6F C;  2ZJQ S;  1USO A;  4KMD A;  3S1N C;  3N3Y A;  3Q3Q A;  4GTD A;  3RZO K;  4JK1 A;  5IYD C;  1WQG A;  3EQL A;  1WOS A;  3PO2 K;  5C44 C;  2B63 A;  3GDZ A;  3NUH A;  3GTL A;  5DM7 S;  1IQ0 A;  5IP7 K;  2B63 C;  4C2M C;  4U67 S;  3GTL C;  3S17 K;  4OIP A;  4XLN A;  4AYB D;  5HQH A;  1DCP A;  1ZBS A;  3T02 A;  3AD9 C;  4WF9 S;  3DLL S;  1J6X A;  4FZB A;  4A3L C;  4KAR A;  1TWF K;  1I6V A;  3GEH A;  3HOV K;  3GTO K;  5JVH S;  3GTG K;  3H0G K;  3S2D K;  1O2B A;  4WIL A;  2L3U A;  2YU9 K;  2RGR A;  1G51 A;  2W7V A;  4KM8 A;  3FKI K;  1F7V A;  4O2D A;  2E2H A;  4Q4Z A;  2JA6 A;  2NVY A;  3FOE A;  1ZYR A;  4G7H A;  1O28 A;  5CHP A;  4A93 C;  4GTL A;  2E2H C;  2JA6 C;  3S14 C;  2NVY C;  4Q5S A;  2E2I A;  2ZUE A;  2PA8 D;  3TFH A;  4OIQ A;  4G7O A;  1DCO A;  1O26 A;  1VJE A;  1IE0 A;  2E2I C;  3HOX C;  2ZJP S;  2R93 K;  1GE9 A;  3I4M K;  1TWC A;  2KXY A;  2Y0S D;  4KMU A;  1YX2 A;  4X6A C;  3HOZ K;  5IOQ A;  1XXC A;  1WCM A;  4BBS K;  1TWC C;  4G7Z A;  4WJ3 M;  5CJ9 A;  4OIN A;  2V6U A;  4BLA A;  1SFO A;  5FLM C;  1WCM C;  5IOS A;  1ZXO A;  3PO3 K;  2A6E A;  5IP9 K;  4GT9 A;  1SFO C;  4YFX A;  1TWA K;  4BBR K;  2R7Z K;  2R92 K;  4QJV A;  2JA8 K;  4Y52 K;  4IO9 S;  3S15 K;  4BXX C;  3K7A C;  3N0B A;  3SZZ A;  3QX3 A;  3S16 K;  3S1R C;  3RZD K;  2PA8 L;  4A3J C;  1XZP A;  5C4X C;  3LAJ A;  3TFI A;  3FHZ A;  3A8K A;  3HOY C;  4A3M K;  2ZJR S;  3L4K A;  1O2F B;  3BP3 A;  4LQY A;  4AH6 A;  3PIO S;  4GTC A;  5TMF A;  4LR2 A;  1JQW A;  4PAB A;  4BLB A;  2NVQ K;  1Y1V K;  3GTQ K;  3I4N K;  2ZUF A;  2A69 A;  2E2J K;  4NOI A;  5L46 A;  4QJV B;  3RZO C;  4BKW A;  1Y1W K;  3PO2 C;  3GEI A;  5E68 A;  5JFE A;  2GSN A;  1XZP B;  5JVO A;  4A3G K;  4MEY A;  5EGH A;  5IP7 C;  3TFJ A;  4KAS A;  3S1M K;  5C3E K;  1YNN A;  3S17 C;  1BS2 A;  4BY7 K;  1IL2 A;  4C45 A;  1EFW A;  1TWF A;  3LYW A;  1J6V A;  1TWG K;  4XSX A;  3GTO A;  4J3N A;  3GTG A;  3H0G A;  3LPX A;  4WJ4 A;  1YCL A;  2YU9 A;  3S1Q K;  1TWF C;  3CF5 S;  3HOV C;  3GTO C;  2KQ1 A;  3H0G C;  3GTG C;  3S2D C;  1F93 A;  3FKI A;  4A3C K;  3GIR A;  2YU9 C;  4IOA S;  3AD7 C;  3MML B;  1XXB A;  1RU0 A;  3FKI C;  3HXA A;  5HL7 S;  4IOC S;  1HI9 A;  4YG2 A;  2PPB A;  3T00 A;  4A3D K;  3G4A A;  2R93 A;  2GSU A;  1XXA A;  2WAQ D;  4MEX A;  1BJT A;  4YFN A;  2GAG C;  4YFK A;  1YNJ A;  2R93 C;  1O27 A;  3A8J A;  2WB1 L;  3I4M C;  3AQP A;  3HOZ C;  1ZQ1 C;  4BBS C;  3V4G A;  2PHC B;  4GTE A;  2NVX K;  1TWA A;  3PO3 C;  2R7Z A;  5IP9 C;  2R92 A;  3G4C A;  1TWA C;  1SMY A;  3IPJ A;  4BBR C;  4Y7N K;  2BE5 A;  3GTJ K;  2R7Z C;  2R92 C;  1IW7 A;  1WSR A;  2O5I A;  1TWH K;  4Y52 C;  2JA8 C;  3GTK K;  3AQO A;  1I3Q K;  4ILD A;  4AYB L;  3S15 C;  3S16 C;  3RZD C;  4A3F K;  4XSZ A;  3M3Y K;  1O25 A;  5TMC A;  3TTG A;  1L0W A;  4KDD A;  4A3M C;  5IOT A;  5IYC K;  4OIR A;  3HOW K;  2PMZ D;  3BUE A;  1JVI A;  2JA5 K;  3GTQ A;  1Y1V A;  3ERE D;  1USM A;  1XPP A;  5M5X K;  3S2H K;  2NVQ C;  1Y1V C;  3GTQ C;  3I4N C;  2JH3 A;  1Y1W A;  2E2J C;  3M4O K;  4C3J K;  1Y1W C;  3VA7 A;  4M1X A;  1INN A;  1JOE A;  4A3I K;  4A3E K;  4LK0 A;  4P5B A;  4A3G C;  2Y0S L;  2O5J A;  3S1M C;  5C3E C;  3S0X A;  1TWG A;  1WOR A;  4BY7 C;  1DCH A;  4WCE S;  2CW0 A;  1TWG C;  3CQZ K;  1EQR A;  4A3K K;  4XLP A;  2CFA A;  3S1Q C;  1WOP A;  2NVT K;  4WFN S;  5M3F K;  2PMZ L;  3AD8 C;  4C3H K;  4A3C C;  1J6W A;  1PJ6 A;  3BP8 C;  1K83 K;  3A8I A;  4P9S A;  4G0U A;  5DM6 S;  2FQT A;  1I6H K;  5D4D A;  3OEP A;  5IYB K;  2V6S A;  3GTM K;  4KB4 A;  3GTP K;  4KN7 A;  4A3D C;  4BY1 K;  2FQO A;  1EI6 A;  3N0C A;  4MQ9 A;  1KQ4 A;  1J98 A;  2ZFZ A;  4C3I K;  1VRQ C;  1O24 A;  2CFA B;  2NVX A;  2VUM K;  3HOU K;  1FEU A;  2JA7 K;  2A6H A;  3DXJ A;  4A3B K;  2NVX C;  2L5N A;  1ISE A;  4QIW D;  4LOW A;  4KC6 A;  3ADA C;  3GTJ A;  3T01 A;  3FOF A;  2P8T A;  4GTB A;  3L4J A;  1TWH A;  3AH5 A;  4KM9 A;  3GTK A;  4Y7N C;  1I50 K;  3HKZ D;  1I3Q A;  3GTJ C;  4P5A A;  4KN4 A;  1BGW A;  1TWH C;  4LJZ A;  3GTK C;  1HQM A;  4KMH A;  1I3Q C;  2V6T A;  3ORE A;  3JST A;  1R9T K;  2EBB A;  1F9N A;  4A3F C;  3M3Y C;  3S1N K;  1WSV A;  1C0A A;  3SZY A;  1IBA A;  4ZH4 A;  4XCH A;  1UV7 A;  3H3V D;  2JA5 A;  5IYC C;  5IYD K;  3HOW C;  5IOR A;  1V5V A;  5C44 K;  1VLO A;  2JA5 C;  5TJ3 A;  4LLG A;  5FJ8 K;  1PJ7 A;  2B63 K;  4C2M K;  3GTL K;  4QIW L;  3S2H C;  1O29 A;  1IS1 A;  2XCR B;  1VGX A;  1XZQ A;  4G0V A;  2WAQ L;  4GTA A;  3M4O C;  4C3J C;  2GAH C;  3HKZ L;  1B4B A;  4KAT A;  1WQF A;  3OPF A;  5M3M K;  3PIP S;  4LK1 A;  4A3I C;  4A3L K;  4A3E C;  5HL8 A;  1BDF A;  2KPU A;  4DDQ A;  2GSO A; 
#chains in the Genus database with same CATH homology
 3GTO K;  1TWG C;  3GTG K;  3H0G K;  3S2D K;  3CQZ K;  3S1Q K;  1TWF C;  3HOV C;  3GTO C;  2YU9 K;  4A3K K;  4XLP A;  3GTG C;  3H0G C;  5C4J C;  3CQZ C;  3S1Q C;  3S2D C;  4A3C K;  2NVT K;  5M3F K;  2PMZ L;  2YU9 C;  4A3K C;  3FKI K;  3H3V L;  4C3H K;  4Q4Z A;  4A3C C;  4A93 K;  2NVT C;  1ZYR A;  2E2H K;  4G7H A;  2NVY K;  2JA6 K;  3S14 K;  3FKI C;  4C3H C;  1K83 K;  4A93 C;  3S15 K;  2E2H C;  2JA6 C;  3S14 C;  2NVY C;  4Q5S A;  2PA8 D;  1K83 C;  4GZY A;  2E2I K;  3HOX K;  4YG2 A;  4OIQ A;  2PPB A;  4G7O A;  1I6H K;  4A3D K;  5D4D A;  5IYB K;  2E2I C;  3HOX C;  2WAQ D;  3GTM K;  4MEX A;  3GTP K;  2R93 K;  1I6H C;  4X6A K;  4YFN A;  4KN7 A;  4YFK A;  3I4M K;  4A3D C;  4BY1 K;  5IYB C;  2Y0S D;  4KMU A;  3GTM C;  3GTP C;  1YNJ A;  2R93 C;  4X6A C;  4MQ9 A;  1TWC K;  2WB1 L;  5C4J K;  3HOZ K;  3I4M C;  4BY1 C;  4C3I K;  4BBS K;  1TWC C;  5FLM K;  4G7Z A;  3HOZ C;  1WCM K;  4OIN A;  4C3I C;  4BBS C;  5FLM C;  1WCM C;  1SFO K;  2VUM K;  3PO3 K;  2A6E A;  3HOU K;  5IP9 K;  5M5Y K;  2JA7 K;  3HOV K;  2NVX K;  2A6H A;  1SFO C;  4YFX A;  4OIO A;  2VUM C;  3PO3 C;  1TWA K;  3HOU C;  3DXJ A;  5IP9 C;  2JA7 C;  3WOD A;  2NVX C;  4BBR K;  4A3B K;  2R7Z K;  4QIW D;  2R92 K;  1TWA C;  1SMY A;  4A3B C;  4BBR C;  4Y7N K;  2BE5 A;  4BXX K;  3K7A K;  4QJV A;  3GTJ K;  2R7Z C;  2JA8 K;  4Y52 K;  2R92 C;  1IW7 A;  3S1R K;  2O5I A;  4Y7N C;  4BXX C;  3HKZ D;  3K7A C;  1I50 K;  3GTJ C;  1TWH K;  4A3J K;  4Y52 C;  2JA8 C;  5C4X K;  3GTK K;  3S1R C;  1I3Q K;  4AYB L;  4KN4 A;  2PA8 L;  3RZD K;  3S16 K;  1TWH C;  1I50 C;  4LJZ A;  4A3J C;  3S15 C;  3GTK C;  1HQM A;  5C4X C;  3S16 C;  1I3Q C;  3RZD C;  3HOY K;  5M5W K;  4A3F K;  4XSZ A;  1R9T K;  2A68 A;  3M3Y K;  5TMC A;  3HOY C;  4A3M K;  2WB1 D;  4A3F C;  1R9T C;  3M3Y C;  3S1N K;  4A3M C;  5IYC K;  4OIR A;  3HOW K;  2PMZ D;  4ZH4 A;  5TMF A;  3S1N C;  3H3V D;  5IYC C;  2JA5 K;  5IYD K;  3HOW C;  2NVQ K;  1Y1V K;  5C44 K;  3GTQ K;  3I4N K;  3RZO K;  4JK1 A;  5IYD C;  2JA5 C;  2A69 A;  3EQL A;  4NOI A;  1XPP A;  5M5X K;  2E2J K;  4QJV B;  4LLG A;  3PO2 K;  2NVQ C;  1Y1V C;  5C44 C;  3GTQ C;  3RZO C;  3I4N C;  5FJ8 K;  3S2H K;  2B63 K;  2E2J C;  4C2M K;  1Y1W K;  3PO2 C;  4QIW L;  3S2H C;  3GTL K;  5IP7 K;  3M4O K;  4C3J K;  2B63 C;  4C2M C;  1Y1W C;  4A3G K;  3GTL C;  4MEY A;  2WAQ L;  5IP7 C;  3S17 K;  4OIP A;  4A3I K;  3M4O C;  4C3J C;  4XLN A;  4AYB D;  4LK0 A;  3HKZ L;  4A3G C;  2Y0S L;  5C3E K;  1YNN A;  2O5J A;  4A3E K;  3S1M K;  3S17 C;  5M3M K;  4LK1 A;  4A3I C;  4A3L K;  4BY7 K;  4A3E C;  3S1M C;  5C3E C;  1BDF A;  1TWG K;  4A3L C;  4XSX A;  4BY7 C;  1TWF K;  1I6V A;  2CW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...