5TMFA

Re-refinement of thermus thermophilus rna polymerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
molecule tags Transferase
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
total genus 44
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmfA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmfA01
2A68A 4XLNA 3I4NK 4MQ9A 3EQLA 4KN4A 3HOWC 4A3CC 5C4XK 4A3IK 2JA5K 4QJVA 5IP7K 5TMCA 4C3JC 4A3GC 2JA8K 3GTLC 1I6HC 5C4JC 3HKZL 1I50K 3GTQK 2PMZD 3I4MC 1I6VA 4BBRC 2PPBA 3PO2C 2NVYC 2JA7K 1TWGK 3GTMC 4A3BC 3HOYC 4G7HA 3S16C 4C3IK 4A3JK 2E2JK 1SMYA 3S1QC 5M5XK 4LLGA 4OIPA 4C3HK 3RZOK 2R92C 5FLMC 1K83K 4Y52C 2PA8L 4QIWL 3S1RK 5IYCK 5IP9C 1R9TK 3S1NK 1TWHC 3HKZD 4AYBD 4BY1K 4KN7A 4BXXK 4XLPA 3GTKC 3FKIC 2NVTK 2CW0A 2PA8D 2E2HC 3HOUK 2NVXK 3M3YK 4Y7NK 1HQMA 4A3DC 1TWAC 3GTOC 3HOXK 4A3MK 3M4OK 4A3IC 4OIRA 3PO3C 4XSXA 2A6HA 4A3GK 5C3EK 4MEYA 4A3EC 3H0GC 2WAQL 2WB1D 3HOZC 2NVYK 2Y0SL 5M5YK 5IYDK 3HOYK 2O5IA 3I4NC 3S16K 4A3LK 3H3VL 2WAQD 4C3HC 5M5WK 4A3CK 1WCMC 1YNJA 4OIOA 5IP7C 2JA8C 1K83C 3GTQC 3H3VD 2JA7C 3S2DK 1Y1WC 2E2JC 4A3BK 3RZDC 4MEXA 3GTKK 3CQZC 3S2HC 2WB1L 3M3YC 5C44K 3GTGK 3K7AC 4OINA 3HOXC 4A3MC 5FLMK 4A3KC 3S1RC 1TWCC 3PO3K 5IYCC 3S15K 4BY7C 4X6AK 2JA6K 1TWHK 3WODA 3HOVC 3GTPC 4C2MK 4A93C 3HOZK 3S1MK 3HOUC 5IYDC 2R93C 5D4DA 4Y7NC 4Q4ZA 2NVQC 4BBSK 2PMZL 2A69A 1TWAK 3GTOK 1Y1VC 3GTJC 4LK0A 4QIWD 1TWFC 4YG2A 5C3EC 4A3FC 3S17C 2B63C 4A3EK 4QJVB 2BE5A 2E2IK 1SFOK 2YU9K 1ZYRA 4A3LC 5IYBK 4OIQA 2O5JA 2VUMC 3S2HK 2R7ZC 1WCMK 2A6EA 3GTGC 3HOWK 4A3KK 4GZYA 1TWCK 1I3QK 3S2DC 4BY7K 4C3JK 1Y1WK 3GTLK 3RZDK 1I6HK 4C2MC 3GTPK 4BBRK 3CQZK 3S1MC 4A93K 1TWGC 5C44C 3S14C 2R93K 4ZH4A 4AYBL 2NVQK 3RZOC 4YFNA 3S1QK 3K7AK 2Y0SD 5C4XC 1Y1VK 3GTJK 2JA5C 1TWFK 2R92K 3S15C 4X6AC 2JA6C 5C4JK 2B63K 5TMFA 1I50C 3HOVK 3I4MK 1YNNA 4NOIA 3PO2K 1R9TC 5IP9K 4C3IC 1SFOC 1IW7A 4JK1A 4A3JC 2YU9C 3GTMK 5IYBC 3DXJA 1BDFA 4BBSC 2NVTC 3FKIK 4LJZA 2NVXC 4KMUA 4YFXA 4A3FK 3S17K 4A3DK 4XSZA 1XPPA 3M4OC 3S1NC 4G7OA 4Y52K 1I3QC 5M3FK 5FJ8K 2E2IC 5M3MK 4BY1C 4BXXC 4G7ZA 4YFKA 3H0GK 4LK1A 2VUMK 4Q5SA 2R7ZK 2E2HK 3S14K
chains in the Genus database with same CATH superfamily
3JSTA 5IP7K 1O27A 4KMHA 2JA8K 3GTLC 3HKZL 2KPUA 3PO2C 3GTLA 3TFIA 2E2JK 3S1QC 5M5XK 4OIPA 4C3HK 3FOEA 1EQRA 1F9NA 4WF9S 3S1RK 3AD7C 3A8KA 3M3YK 2E2HC 4Y7NK 4A3DC 2E2HA 1EK8A 4A3IC 3S0XA 1SFOA 4A3EC 2WAQL 3A8JA 5JVGS 4G0UA 4GTEA 3I4NC 3V4GA 1WSVA 1WCMC 1YNJA 3T02A 1WQGA 3GTQC 2ZJQS 4WCES 4KM9A 3RZDC 5C44K 1WIHA 1TWHK 3WODA 5L46A 3PIPS 4A93C 3HOZK 2PMZL 1KQ4A 2R92A 3GTJC 4LK0A 5JVHS 4M1XA 1I3QA 1XXBA 5JVOA 3NUHA 2GSUA 4QJVB 2BE5A 1X31C 4A3LC 3GEHA 3N0CA 3CF5S 1VRQC 3BP3A 4KB2A 4GZYA 1TWCK 1I3QK 1DCOA 1WOOA 5TJ3A 1Y1WK 3GTLK 3DLLS 4LR2A 4A93K 2P8TA 4KASA 3AD8C 3RZOC 4YFNA 3TFJA 1IBAA 1YCLA 1VJEA 4WFBS 4X6AC 2JA6C 4GT9A 4LOWA 5C4JK 5TMFA 1YNNA 1O2FB 3LPXA 2XCQA 4WILA 1FEUA 1DCHA 4JK1A 4A3JC 4GTAA 2R7ZA 4KMUA 1IL2A 4A3FK 4A3DK 3GTJA 4AH6A 5CHPA 4Y52K 1I3QC 4BY1C 3H0GK 4LK1A 1B4BA 1ISEA 2A68A 3I4NK 3GSIA 4P5AA 1USMA 3A8IA 4A3GC 1INNA 2NVYA 2JA7A 4J3NA 4G0VA 4BBRC 1JVIA 2NVYC 1TWGK 3GTMC 4A3BC 4C3IK 4G7HA 2EBBA 1K83K 2PA8L 4KB4A 5IP9C 1VLOA 4AYBD 4KN7A 3FKIC 2CW0A 2PA8D 1TWAA 1XXCA 2NVXK 3HOUK 3OREA 3FKIA 1TWAC 4A3MK 4OIRA 4IOCS 4XSXA 1J98A 2WB1D 1WSRA 2NVYK 2Y0SL 1BS2A 3BUEA 5M5YK 2O5IA 4A3LK 1RU0A 4KMDA 1TWGA 4A3CK 3G4CA 4OIOA 5IP7C 1BGWA 1Y1WA 2JA5A 2JA7C 1G51A 3S2DK 1Y1WC 1I50A 3GTKK 3CQZC 1ZQ1C 2ZFZA 4A3MC 4X6AK 1JQWA 5IOTA 5HQHA 3GTPC 4C2MK 1V5VA 2CFAA 5D4DA 1WCMA 4Q4ZA 2NVQC 4BBSK 2A69A 3GTOK 1Y1VC 4QIWD 1UV7A 1TWFC 4A3FC 4A3EK 1WOPA 4KM8A 1SFOK 1O29A 3SZYA 5IYBK 4GTCA 4A3KK 1F7UA 4BY7K 1PJ7A 4PABA 3RZDK 1ZVUA 4BBRK 5HL7S 5C44C 4AYBL 3CQZA 2NVQK 3K7AK 4U67S 3FOFA 5C4XC 1Y1VK 2RH6A 1IS1A 4WJ3M 1O2BA 1B4AA 3PO2K 1R9TC 1C0AA 1SFOC 3GTPA 3GEIA 3TFHA 3FKIK 2NVXC 4KMAA 3FHZA 1Y1VA 1XPPA 3S1NC 4P9SA 1AB4A 3H0GA 1O26A 4BXXC 2FQOA 4YFKA 2VUMK 5CJ9A 2E2HK 4XLNA 4MQ9A 3HXAA 4DDQA 1DCPA 4A3CC 5C4XK 4A3IK 5E68A 2JA5K 4C3JC 4BLAA 1I6HC 1I50K 1I6VA 2PPBA 2JA7K 3HOYC 3S16C 2P5MA 3RZOK 3GTGA 3IPJA 2ZUEA 2R92C 5FLMC 2RGRA 3S1NK 4QIWL 3G4AA 5IYCK 3HKZD 4GTFA 4BXXK 4XLPA 1VGXA 3GTOA 1HQMA 3GTOC 2NVXA 3M4OK 1ZBSA 3MMLB 2KWAA 2A6HA 5C3EK 3LAPA 3GEEA 4MEYA 2YU9A 5EGEA 3H0GC 4KATA 3HOZC 5IYDK 4BLBA 3HOYK 3S16K 4C3HC 4GFQA 1J6XA 1EI6A 1JOEA 1XXAA 3GIRA 4A3BK 4FZBA 2L3UA 1VH2A 3M3YC 5IOQA 3VA7A 1TWCA 3K7AC 4KC6A 2JH3A 2KQ1A 1TWCC 3S15K 1WQHA 2R93A 3S1MK 3HOUC 5IYDC 2R93C 1TWAK 4KARA 2XCRB 3ERED 4GTBA 4YG2A 3S17C 1WORA 3QX3A 2E2IK 2VUMA 2W7VA 2VUMC 2A6EA 2ZJRS 3ADAC 3PIOS 3S2DC 4C3JK 2GAHC 3LAJA 1I6HK 1GE9A 4IOAS 3S1MC 3CQZK 3S14C 2R93K 3CAGA 3S1QK 3N3YA 1PJ5A 2Y0SD 4IO9S 1YX2A 3GTJK 3GTQA 2R92K 1O25A 1XZQA 5DM6S 2D6FC 3HOVK 3I4MK 4C3IC 1HI9A 3GTMK 3DXJA 4BBSC 1IQ0A 4YFXA 4XSZA 2V6TA 3M4OC 4G7OA 2GAGC 2GSOA 4WFNS 4Q5SA 2R7ZK 3S14K 1F7VA 3EQLA 4KN4A 3HOWC 1EFWA 4QJVA 5TMCA 1R9TA 5C4JC 3GTQK 2PMZD 3I4MC 1BJTA 1IE0A 4A3JK 1SMYA 4LLGA 1WOSA 3T00A 2ZJPS 3L4JA 5DM7S 2V6UA 3AQOA 1TWFA 4Y52C 1XZPA 1R9TK 3GTKA 4PAAA 1TWHC 4BY1K 4WJ4A 3GTKC 2NVTK 5JFEA 4O2DA 3OEPA 1XZQB 2GSNA 4ILDA 3HOXK 4WFAS 3PO3C 4A3GK 3BP8C 4KDDA 1J6WA 3GDZA 3H3VL 2WAQD 5M5WK 1O24A 2JA8C 1K83C 4P5BA 2PHCB 3H3VD 4FM9A 4XCHA 1K83A 2E2JC 4MEXA 1O2AA 3S2HC 2WB1L 2Y3PA 3OPFA 2FQTA 3GTGK 5EGHA 4OINA 3HOXC 1J6VA 5FLMK 4A3KC 3S1RC 3PO3K 5IYCC 3LYWA 4BY7C 2JA6K 1EH1A 3HOVC 3GTMA 1PJ6A 1TWHA 3AQPA 1L0WA 4Y7NC 4BKWA 3SZZA 5IORA 3Q3QA 5C3EC 2B63C 2E2IA 2V6SA 4G0WA 4KAWX 2JA6A 2YU9K 1ZYRA 4OIQA 3L4KA 2O5JA 3S2HK 2R7ZC 1WCMK 3GTGC 3AD9C 4RMFA 3HOWK 1O28A 4C2MC 4GTLA 3GTPK 1WQFA 4GTDA 1TWGC 4ZH4A 3T01A 1XZPB 2JA5C 1TWFK 3S15C 2KXYA 5IOSA 4C45A 2B63K 1I50C 4NOIA 5IP9K 1USOA 2YU9C 1IW7A 3TTGA 5IYBC 1BDFA 1F93A 2NVTC 5HL8A 4LJZA 3N0BA 3S17K 2L5NA 4LQYA 2CFAB 5M3FK 5FJ8K 2E2IC 2B63A 1ZXOA 5M3MK 4G7ZA 3AH5A 2XCOA 2ZUFA 1DD5A
chains in the Genus database with same CATH topology
2A68A 4XLNA 3I4NK 4MQ9A 3EQLA 4KN4A 3HOWC 4A3CC 5C4XK 4A3IK 2JA5K 4QJVA 5IP7K 5TMCA 4C3JC 4A3GC 2JA8K 3GTLC 1I6HC 5C4JC 3HKZL 1I50K 3GTQK 2PMZD 3I4MC 1I6VA 4BBRC 2PPBA 3PO2C 2NVYC 2JA7K 1TWGK 3GTMC 4A3BC 3HOYC 4G7HA 3S16C 4C3IK 4A3JK 2E2JK 1SMYA 3S1QC 5M5XK 4LLGA 4OIPA 4C3HK 3RZOK 2R92C 5FLMC 1K83K 4Y52C 2PA8L 4QIWL 3S1RK 5IYCK 5IP9C 1R9TK 3S1NK 1TWHC 3HKZD 4AYBD 4BY1K 4KN7A 4BXXK 4XLPA 3GTKC 3FKIC 2NVTK 2CW0A 2PA8D 2E2HC 3HOUK 2NVXK 3M3YK 4Y7NK 1HQMA 4A3DC 1TWAC 3GTOC 3HOXK 4A3MK 3M4OK 4A3IC 4OIRA 3PO3C 4XSXA 2A6HA 4A3GK 5C3EK 4MEYA 4A3EC 3H0GC 2WAQL 2WB1D 3HOZC 2NVYK 2Y0SL 5M5YK 5IYDK 3HOYK 2O5IA 3I4NC 3S16K 4A3LK 3H3VL 2WAQD 4C3HC 5M5WK 4A3CK 1WCMC 1YNJA 4OIOA 5IP7C 2JA8C 1K83C 3GTQC 3H3VD 2JA7C 3S2DK 1Y1WC 2E2JC 4A3BK 3RZDC 4MEXA 3GTKK 3CQZC 3S2HC 2WB1L 3M3YC 5C44K 3GTGK 3K7AC 4OINA 3HOXC 4A3MC 5FLMK 4A3KC 3S1RC 1TWCC 3PO3K 5IYCC 3S15K 4BY7C 4X6AK 2JA6K 1TWHK 3WODA 3HOVC 3GTPC 4C2MK 4A93C 3HOZK 3S1MK 3HOUC 5IYDC 2R93C 5D4DA 4Y7NC 4Q4ZA 2NVQC 4BBSK 2PMZL 2A69A 1TWAK 3GTOK 1Y1VC 3GTJC 4LK0A 4QIWD 1TWFC 4YG2A 5C3EC 4A3FC 3S17C 2B63C 4A3EK 4QJVB 2BE5A 2E2IK 1SFOK 2YU9K 1ZYRA 4A3LC 5IYBK 4OIQA 2O5JA 2VUMC 3S2HK 2R7ZC 1WCMK 2A6EA 3GTGC 3HOWK 4A3KK 4GZYA 1TWCK 1I3QK 3S2DC 4BY7K 4C3JK 1Y1WK 3GTLK 3RZDK 1I6HK 4C2MC 3GTPK 4BBRK 3CQZK 3S1MC 4A93K 1TWGC 5C44C 3S14C 2R93K 4ZH4A 4AYBL 2NVQK 3RZOC 4YFNA 3S1QK 3K7AK 2Y0SD 5C4XC 1Y1VK 3GTJK 2JA5C 1TWFK 2R92K 3S15C 4X6AC 2JA6C 5C4JK 2B63K 5TMFA 1I50C 3HOVK 3I4MK 1YNNA 4NOIA 3PO2K 1R9TC 5IP9K 4C3IC 1SFOC 1IW7A 4JK1A 4A3JC 2YU9C 3GTMK 5IYBC 3DXJA 1BDFA 4BBSC 2NVTC 3FKIK 4LJZA 2NVXC 4KMUA 4YFXA 4A3FK 3S17K 4A3DK 4XSZA 1XPPA 3M4OC 3S1NC 4G7OA 4Y52K 1I3QC 5M3FK 5FJ8K 2E2IC 5M3MK 4BY1C 4BXXC 4G7ZA 4YFKA 3H0GK 4LK1A 2VUMK 4Q5SA 2R7ZK 2E2HK 3S14K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A68 A;  4XLN A;  3I4N K;  4MQ9 A;  3EQL A;  4KN4 A;  3HOW C;  4A3C C;  5C4X K;  4A3I K;  2JA5 K;  4QJV A;  5IP7 K;  5TMC A;  4C3J C;  4A3G C;  2JA8 K;  3GTL C;  1I6H C;  5C4J C;  3HKZ L;  1I50 K;  3GTQ K;  2PMZ D;  3I4M C;  1I6V A;  4BBR C;  2PPB A;  3PO2 C;  2NVY C;  2JA7 K;  1TWG K;  3GTM C;  4A3B C;  3HOY C;  4G7H A;  3S16 C;  4C3I K;  4A3J K;  2E2J K;  1SMY A;  3S1Q C;  5M5X K;  4LLG A;  4OIP A;  4C3H K;  3RZO K;  2R92 C;  5FLM C;  1K83 K;  4Y52 C;  2PA8 L;  4QIW L;  3S1R K;  5IYC K;  5IP9 C;  1R9T K;  3S1N K;  1TWH C;  3HKZ D;  4AYB D;  4BY1 K;  4KN7 A;  4BXX K;  4XLP A;  3GTK C;  3FKI C;  2NVT K;  2CW0 A;  2PA8 D;  2E2H C;  3HOU K;  2NVX K;  3M3Y K;  4Y7N K;  1HQM A;  4A3D C;  1TWA C;  3GTO C;  3HOX K;  4A3M K;  3M4O K;  4A3I C;  4OIR A;  3PO3 C;  4XSX A;  2A6H A;  4A3G K;  5C3E K;  4MEY A;  4A3E C;  3H0G C;  2WAQ L;  2WB1 D;  3HOZ C;  2NVY K;  2Y0S L;  5M5Y K;  5IYD K;  3HOY K;  2O5I A;  3I4N C;  3S16 K;  4A3L K;  3H3V L;  2WAQ D;  4C3H C;  5M5W K;  4A3C K;  1WCM C;  1YNJ A;  4OIO A;  5IP7 C;  2JA8 C;  1K83 C;  3GTQ C;  3H3V D;  2JA7 C;  3S2D K;  1Y1W C;  2E2J C;  4A3B K;  3RZD C;  4MEX A;  3GTK K;  3CQZ C;  3S2H C;  2WB1 L;  3M3Y C;  5C44 K;  3GTG K;  3K7A C;  4OIN A;  3HOX C;  4A3M C;  5FLM K;  4A3K C;  3S1R C;  1TWC C;  3PO3 K;  5IYC C;  3S15 K;  4BY7 C;  4X6A K;  2JA6 K;  1TWH K;  3WOD A;  3HOV C;  3GTP C;  4C2M K;  4A93 C;  3HOZ K;  3S1M K;  3HOU C;  5IYD C;  2R93 C;  5D4D A;  4Y7N C;  4Q4Z A;  2NVQ C;  4BBS K;  2PMZ L;  2A69 A;  1TWA K;  3GTO K;  1Y1V C;  3GTJ C;  4LK0 A;  4QIW D;  1TWF C;  4YG2 A;  5C3E C;  4A3F C;  3S17 C;  2B63 C;  4A3E K;  4QJV B;  2BE5 A;  2E2I K;  1SFO K;  2YU9 K;  1ZYR A;  4A3L C;  5IYB K;  4OIQ A;  2O5J A;  2VUM C;  3S2H K;  2R7Z C;  1WCM K;  2A6E A;  3GTG C;  3HOW K;  4A3K K;  4GZY A;  1TWC K;  1I3Q K;  3S2D C;  4BY7 K;  4C3J K;  1Y1W K;  3GTL K;  3RZD K;  1I6H K;  4C2M C;  3GTP K;  4BBR K;  3CQZ K;  3S1M C;  4A93 K;  1TWG C;  5C44 C;  3S14 C;  2R93 K;  4ZH4 A;  4AYB L;  2NVQ K;  3RZO C;  4YFN A;  3S1Q K;  3K7A K;  2Y0S D;  5C4X C;  1Y1V K;  3GTJ K;  2JA5 C;  1TWF K;  2R92 K;  3S15 C;  4X6A C;  2JA6 C;  5C4J K;  2B63 K;  5TMF A;  1I50 C;  3HOV K;  3I4M K;  1YNN A;  4NOI A;  3PO2 K;  1R9T C;  5IP9 K;  4C3I C;  1SFO C;  1IW7 A;  4JK1 A;  4A3J C;  2YU9 C;  3GTM K;  5IYB C;  3DXJ A;  1BDF A;  4BBS C;  2NVT C;  3FKI K;  4LJZ A;  2NVX C;  4KMU A;  4YFX A;  4A3F K;  3S17 K;  4A3D K;  4XSZ A;  1XPP A;  3M4O C;  3S1N C;  4G7O A;  4Y52 K;  1I3Q C;  5M3F K;  5FJ8 K;  2E2I C;  5M3M K;  4BY1 C;  4BXX C;  4G7Z A;  4YFK A;  3H0G K;  4LK1 A;  2VUM K;  4Q5S A;  2R7Z K;  2E2H K;  3S14 K; 
#chains in the Genus database with same CATH topology
 3JST A;  5IP7 K;  1O27 A;  4KMH A;  2JA8 K;  3GTL C;  3HKZ L;  2KPU A;  3PO2 C;  3GTL A;  3TFI A;  2E2J K;  3S1Q C;  5M5X K;  4OIP A;  4C3H K;  3FOE A;  1EQR A;  1F9N A;  4WF9 S;  3S1R K;  3AD7 C;  3A8K A;  3M3Y K;  2E2H C;  4Y7N K;  4A3D C;  2E2H A;  1EK8 A;  4A3I C;  3S0X A;  1SFO A;  4A3E C;  2WAQ L;  3A8J A;  5JVG S;  4G0U A;  4GTE A;  3I4N C;  3V4G A;  1WSV A;  1WCM C;  1YNJ A;  3T02 A;  1WQG A;  3GTQ C;  2ZJQ S;  4WCE S;  4KM9 A;  3RZD C;  5C44 K;  1WIH A;  1TWH K;  3WOD A;  5L46 A;  3PIP S;  4A93 C;  3HOZ K;  2PMZ L;  1KQ4 A;  2R92 A;  3GTJ C;  4LK0 A;  5JVH S;  4M1X A;  1I3Q A;  1XXB A;  5JVO A;  3NUH A;  2GSU A;  4QJV B;  2BE5 A;  1X31 C;  4A3L C;  3GEH A;  3N0C A;  3CF5 S;  1VRQ C;  3BP3 A;  4KB2 A;  4GZY A;  1TWC K;  1I3Q K;  1DCO A;  1WOO A;  5TJ3 A;  1Y1W K;  3GTL K;  3DLL S;  4LR2 A;  4A93 K;  2P8T A;  4KAS A;  3AD8 C;  3RZO C;  4YFN A;  3TFJ A;  1IBA A;  1YCL A;  1VJE A;  4WFB S;  4X6A C;  2JA6 C;  4GT9 A;  4LOW A;  5C4J K;  5TMF A;  1YNN A;  1O2F B;  3LPX A;  2XCQ A;  4WIL A;  1FEU A;  1DCH A;  4JK1 A;  4A3J C;  4GTA A;  2R7Z A;  4KMU A;  1IL2 A;  4A3F K;  4A3D K;  3GTJ A;  4AH6 A;  5CHP A;  4Y52 K;  1I3Q C;  4BY1 C;  3H0G K;  4LK1 A;  1B4B A;  1ISE A;  2A68 A;  3I4N K;  3GSI A;  4P5A A;  1USM A;  3A8I A;  4A3G C;  1INN A;  2NVY A;  2JA7 A;  4J3N A;  4G0V A;  4BBR C;  1JVI A;  2NVY C;  1TWG K;  3GTM C;  4A3B C;  4C3I K;  4G7H A;  2EBB A;  1K83 K;  2PA8 L;  4KB4 A;  5IP9 C;  1VLO A;  4AYB D;  4KN7 A;  3FKI C;  2CW0 A;  2PA8 D;  1TWA A;  1XXC A;  2NVX K;  3HOU K;  3ORE A;  3FKI A;  1TWA C;  4A3M K;  4OIR A;  4IOC S;  4XSX A;  1J98 A;  2WB1 D;  1WSR A;  2NVY K;  2Y0S L;  1BS2 A;  3BUE A;  5M5Y K;  2O5I A;  4A3L K;  1RU0 A;  4KMD A;  1TWG A;  4A3C K;  3G4C A;  4OIO A;  5IP7 C;  1BGW A;  1Y1W A;  2JA5 A;  2JA7 C;  1G51 A;  3S2D K;  1Y1W C;  1I50 A;  3GTK K;  3CQZ C;  1ZQ1 C;  2ZFZ A;  4A3M C;  4X6A K;  1JQW A;  5IOT A;  5HQH A;  3GTP C;  4C2M K;  1V5V A;  2CFA A;  5D4D A;  1WCM A;  4Q4Z A;  2NVQ C;  4BBS K;  2A69 A;  3GTO K;  1Y1V C;  4QIW D;  1UV7 A;  1TWF C;  4A3F C;  4A3E K;  1WOP A;  4KM8 A;  1SFO K;  1O29 A;  3SZY A;  5IYB K;  4GTC A;  4A3K K;  1F7U A;  4BY7 K;  1PJ7 A;  4PAB A;  3RZD K;  1ZVU A;  4BBR K;  5HL7 S;  5C44 C;  4AYB L;  3CQZ A;  2NVQ K;  3K7A K;  4U67 S;  3FOF A;  5C4X C;  1Y1V K;  2RH6 A;  1IS1 A;  4WJ3 M;  1O2B A;  1B4A A;  3PO2 K;  1R9T C;  1C0A A;  1SFO C;  3GTP A;  3GEI A;  3TFH A;  3FKI K;  2NVX C;  4KMA A;  3FHZ A;  1Y1V A;  1XPP A;  3S1N C;  4P9S A;  1AB4 A;  3H0G A;  1O26 A;  4BXX C;  2FQO A;  4YFK A;  2VUM K;  5CJ9 A;  2E2H K;  4XLN A;  4MQ9 A;  3HXA A;  4DDQ A;  1DCP A;  4A3C C;  5C4X K;  4A3I K;  5E68 A;  2JA5 K;  4C3J C;  4BLA A;  1I6H C;  1I50 K;  1I6V A;  2PPB A;  2JA7 K;  3HOY C;  3S16 C;  2P5M A;  3RZO K;  3GTG A;  3IPJ A;  2ZUE A;  2R92 C;  5FLM C;  2RGR A;  3S1N K;  4QIW L;  3G4A A;  5IYC K;  3HKZ D;  4GTF A;  4BXX K;  4XLP A;  1VGX A;  3GTO A;  1HQM A;  3GTO C;  2NVX A;  3M4O K;  1ZBS A;  3MML B;  2KWA A;  2A6H A;  5C3E K;  3LAP A;  3GEE A;  4MEY A;  2YU9 A;  5EGE A;  3H0G C;  4KAT A;  3HOZ C;  5IYD K;  4BLB A;  3HOY K;  3S16 K;  4C3H C;  4GFQ A;  1J6X A;  1EI6 A;  1JOE A;  1XXA A;  3GIR A;  4A3B K;  4FZB A;  2L3U A;  1VH2 A;  3M3Y C;  5IOQ A;  3VA7 A;  1TWC A;  3K7A C;  4KC6 A;  2JH3 A;  2KQ1 A;  1TWC C;  3S15 K;  1WQH A;  2R93 A;  3S1M K;  3HOU C;  5IYD C;  2R93 C;  1TWA K;  4KAR A;  2XCR B;  3ERE D;  4GTB A;  4YG2 A;  3S17 C;  1WOR A;  3QX3 A;  2E2I K;  2VUM A;  2W7V A;  2VUM C;  2A6E A;  2ZJR S;  3ADA C;  3PIO S;  3S2D C;  4C3J K;  2GAH C;  3LAJ A;  1I6H K;  1GE9 A;  4IOA S;  3S1M C;  3CQZ K;  3S14 C;  2R93 K;  3CAG A;  3S1Q K;  3N3Y A;  1PJ5 A;  2Y0S D;  4IO9 S;  1YX2 A;  3GTJ K;  3GTQ A;  2R92 K;  1O25 A;  1XZQ A;  5DM6 S;  2D6F C;  3HOV K;  3I4M K;  4C3I C;  1HI9 A;  3GTM K;  3DXJ A;  4BBS C;  1IQ0 A;  4YFX A;  4XSZ A;  2V6T A;  3M4O C;  4G7O A;  2GAG C;  2GSO A;  4WFN S;  4Q5S A;  2R7Z K;  3S14 K;  1F7V A;  3EQL A;  4KN4 A;  3HOW C;  1EFW A;  4QJV A;  5TMC A;  1R9T A;  5C4J C;  3GTQ K;  2PMZ D;  3I4M C;  1BJT A;  1IE0 A;  4A3J K;  1SMY A;  4LLG A;  1WOS A;  3T00 A;  2ZJP S;  3L4J A;  5DM7 S;  2V6U A;  3AQO A;  1TWF A;  4Y52 C;  1XZP A;  1R9T K;  3GTK A;  4PAA A;  1TWH C;  4BY1 K;  4WJ4 A;  3GTK C;  2NVT K;  5JFE A;  4O2D A;  3OEP A;  1XZQ B;  2GSN A;  4ILD A;  3HOX K;  4WFA S;  3PO3 C;  4A3G K;  3BP8 C;  4KDD A;  1J6W A;  3GDZ A;  3H3V L;  2WAQ D;  5M5W K;  1O24 A;  2JA8 C;  1K83 C;  4P5B A;  2PHC B;  3H3V D;  4FM9 A;  4XCH A;  1K83 A;  2E2J C;  4MEX A;  1O2A A;  3S2H C;  2WB1 L;  2Y3P A;  3OPF A;  2FQT A;  3GTG K;  5EGH A;  4OIN A;  3HOX C;  1J6V A;  5FLM K;  4A3K C;  3S1R C;  3PO3 K;  5IYC C;  3LYW A;  4BY7 C;  2JA6 K;  1EH1 A;  3HOV C;  3GTM A;  1PJ6 A;  1TWH A;  3AQP A;  1L0W A;  4Y7N C;  4BKW A;  3SZZ A;  5IOR A;  3Q3Q A;  5C3E C;  2B63 C;  2E2I A;  2V6S A;  4G0W A;  4KAW X;  2JA6 A;  2YU9 K;  1ZYR A;  4OIQ A;  3L4K A;  2O5J A;  3S2H K;  2R7Z C;  1WCM K;  3GTG C;  3AD9 C;  4RMF A;  3HOW K;  1O28 A;  4C2M C;  4GTL A;  3GTP K;  1WQF A;  4GTD A;  1TWG C;  4ZH4 A;  3T01 A;  1XZP B;  2JA5 C;  1TWF K;  3S15 C;  2KXY A;  5IOS A;  4C45 A;  2B63 K;  1I50 C;  4NOI A;  5IP9 K;  1USO A;  2YU9 C;  1IW7 A;  3TTG A;  5IYB C;  1BDF A;  1F93 A;  2NVT C;  5HL8 A;  4LJZ A;  3N0B A;  3S17 K;  2L5N A;  4LQY A;  2CFA B;  5M3F K;  5FJ8 K;  2E2I C;  2B63 A;  1ZXO A;  5M3M K;  4G7Z A;  3AH5 A;  2XCO A;  2ZUF A;  1DD5 A; 
#chains in the Genus database with same CATH homology
 2A68 A;  4XLN A;  3I4N K;  4MQ9 A;  3EQL A;  4KN4 A;  3HOW C;  4A3C C;  5C4X K;  4A3I K;  2JA5 K;  4QJV A;  5IP7 K;  5TMC A;  4C3J C;  4A3G C;  2JA8 K;  3GTL C;  1I6H C;  5C4J C;  3HKZ L;  1I50 K;  3GTQ K;  2PMZ D;  3I4M C;  1I6V A;  4BBR C;  2PPB A;  3PO2 C;  2NVY C;  2JA7 K;  1TWG K;  3GTM C;  4A3B C;  3HOY C;  4G7H A;  3S16 C;  4C3I K;  4A3J K;  2E2J K;  1SMY A;  3S1Q C;  5M5X K;  4LLG A;  4OIP A;  4C3H K;  3RZO K;  2R92 C;  5FLM C;  1K83 K;  4Y52 C;  2PA8 L;  4QIW L;  3S1R K;  5IYC K;  5IP9 C;  1R9T K;  3S1N K;  1TWH C;  3HKZ D;  4AYB D;  4BY1 K;  4KN7 A;  4BXX K;  4XLP A;  3GTK C;  3FKI C;  2NVT K;  2CW0 A;  2PA8 D;  2E2H C;  3HOU K;  2NVX K;  3M3Y K;  4Y7N K;  1HQM A;  4A3D C;  1TWA C;  3GTO C;  3HOX K;  4A3M K;  3M4O K;  4A3I C;  4OIR A;  3PO3 C;  4XSX A;  2A6H A;  4A3G K;  5C3E K;  4MEY A;  4A3E C;  3H0G C;  2WAQ L;  2WB1 D;  3HOZ C;  2NVY K;  2Y0S L;  5M5Y K;  5IYD K;  3HOY K;  2O5I A;  3I4N C;  3S16 K;  4A3L K;  3H3V L;  2WAQ D;  4C3H C;  5M5W K;  4A3C K;  1WCM C;  1YNJ A;  4OIO A;  5IP7 C;  2JA8 C;  1K83 C;  3GTQ C;  3H3V D;  2JA7 C;  3S2D K;  1Y1W C;  2E2J C;  4A3B K;  3RZD C;  4MEX A;  3GTK K;  3CQZ C;  3S2H C;  2WB1 L;  3M3Y C;  5C44 K;  3GTG K;  3K7A C;  4OIN A;  3HOX C;  4A3M C;  5FLM K;  4A3K C;  3S1R C;  1TWC C;  3PO3 K;  5IYC C;  3S15 K;  4BY7 C;  4X6A K;  2JA6 K;  1TWH K;  3WOD A;  3HOV C;  3GTP C;  4C2M K;  4A93 C;  3HOZ K;  3S1M K;  3HOU C;  5IYD C;  2R93 C;  5D4D A;  4Y7N C;  4Q4Z A;  2NVQ C;  4BBS K;  2PMZ L;  2A69 A;  1TWA K;  3GTO K;  1Y1V C;  3GTJ C;  4LK0 A;  4QIW D;  1TWF C;  4YG2 A;  5C3E C;  4A3F C;  3S17 C;  2B63 C;  4A3E K;  4QJV B;  2BE5 A;  2E2I K;  1SFO K;  2YU9 K;  1ZYR A;  4A3L C;  5IYB K;  4OIQ A;  2O5J A;  2VUM C;  3S2H K;  2R7Z C;  1WCM K;  2A6E A;  3GTG C;  3HOW K;  4A3K K;  4GZY A;  1TWC K;  1I3Q K;  3S2D C;  4BY7 K;  4C3J K;  1Y1W K;  3GTL K;  3RZD K;  1I6H K;  4C2M C;  3GTP K;  4BBR K;  3CQZ K;  3S1M C;  4A93 K;  1TWG C;  5C44 C;  3S14 C;  2R93 K;  4ZH4 A;  4AYB L;  2NVQ K;  3RZO C;  4YFN A;  3S1Q K;  3K7A K;  2Y0S D;  5C4X C;  1Y1V K;  3GTJ K;  2JA5 C;  1TWF K;  2R92 K;  3S15 C;  4X6A C;  2JA6 C;  5C4J K;  2B63 K;  5TMF A;  1I50 C;  3HOV K;  3I4M K;  1YNN A;  4NOI A;  3PO2 K;  1R9T C;  5IP9 K;  4C3I C;  1SFO C;  1IW7 A;  4JK1 A;  4A3J C;  2YU9 C;  3GTM K;  5IYB C;  3DXJ A;  1BDF A;  4BBS C;  2NVT C;  3FKI K;  4LJZ A;  2NVX C;  4KMU A;  4YFX A;  4A3F K;  3S17 K;  4A3D K;  4XSZ A;  1XPP A;  3M4O C;  3S1N C;  4G7O A;  4Y52 K;  1I3Q C;  5M3F K;  5FJ8 K;  2E2I C;  5M3M K;  4BY1 C;  4BXX C;  4G7Z A;  4YFK A;  3H0G K;  4LK1 A;  2VUM K;  4Q5S A;  2R7Z K;  2E2H K;  3S14 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...