5TMFA

Re-refinement of thermus thermophilus rna polymerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
total genus 44
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmfA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmfA01
4C2MK 5IYDC 2Y0SL 2JA6C 4A3EC 5IP9C 3CQZK 4A3MK 2E2HK 3HOYC 2VUMC 4QJVB 4MQ9A 5IYCC 3GTMC 4Q5SA 1K83K 3RZOK 3K7AC 4KN4A 4X6AC 2JA6K 2B63K 1IW7A 3GTQK 2JA5C 4OIRA 3S15C 4A3CK 2JA7K 3S1NK 2PA8L 1YNJA 5FJ8K 2CW0A 4G7OA 1I3QK 4A3FK 4YG2A 4ZH4A 4A3DC 3GTOC 5C44K 1I6HK 4C3HK 1TWFK 4C2MC 2YU9K 1TWGK 3S16K 4QIWD 4KN7A 3S1MK 3CQZC 4BBRK 4A3MC 4A3KC 2A68A 2E2HC 2WB1D 1TWCK 4C3JK 3M3YK 3H3VD 4YFNA 4C3IK 5C4XK 2A6EA 5M5WK 3H0GK 3I4MK 2PMZD 1HQMA 1K83C 2O5IA 3HOUK 3RZOC 5C4JK 4A93K 5IYBK 2B63C 4AYBL 3GTQC 4LJZA 4A3KK 1R9TK 4JK1A 4BBSK 5M3FK 3S17K 4A3CC 3HKZD 2JA7C 3S1NC 4Y52K 2WAQD 2NVQK 3GTGK 4KMUA 2O5JA 1XPPA 1I3QC 5D4DA 4A3FC 3S1QC 1Y1WK 2R93K 5C44C 1I6HC 4XSXA 4A3JK 4C3HC 1TWFC 3S16C 2YU9C 1TWGC 4NOIA 3HOVK 4XLNA 3S1MC 3RZDK 4BBRC 4A3LK 3S14K 1TWCC 4C3JC 3GTPK 3HOXK 3S1RK 2PPBA 2R7ZK 4G7ZA 3M3YC 3S1QK 5C4XC 4C3IC 1TWHK 3H0GC 4Y7NK 3I4MC 3HOUC 4OIOA 5C4JC 5TMFA 1Y1VK 4A93C 5IYBC 2WAQL 3PO2K 3S2DK 2R92K 1R9TC 4XSZA 4BBSC 3GTJK 3S17C 4YFKA 4Y52C 4OIQA 1SFOK 2NVQC 3GTGC 2R93C 1Y1WC 1I6VA 4BY7K 2E2IK 5C3EK 3HOWK 4A3JC 4A3IC 3HOVC 3PO3K 3FKIK 3DXJA 2E2JK 4GZYA 3RZDC 4XLPA 4A3LC 3S14C 2R7ZC 3GTPC 4A3GK 3HOXC 3S1RC 3HOZK 3GTKK 1YNNA 4QIWL 5FLMK 1TWHC 1TWAK 4LK0A 4Y7NC 5M5YK 4A3IK 4A3BK 2JA8K 1Y1VC 4OINA 2WB1L 1I50K 2NVYK 3H3VL 3S2HK 3PO2C 4OIPA 4Q4ZA 3S2DC 2R92C 2PMZL 3GTJC 1SFOC 1WCMK 5M5XK 2PA8D 3GTLK 3M4OK 4QJVA 4BY7C 2NVTC 2E2IC 5C3EC 3HOWC 3HKZL 5IP7K 5M3MK 3PO3C 4BXXK 3FKIC 4BY1K 1SMYA 2E2JC 2NVXK 1BDFA 4A3GC 3HOZC 2NVTK 3GTKC 5FLMC 4YFXA 4MEXA 1TWAC 5IYDK 4A3BC 2JA8C 4A3EK 3I4NC 5IP9K 4LK1A 1I50C 2NVYC 3S2HC 2Y0SD 3HOYK 2VUMK 4G7HA 4AYBD 4LLGA 5IYCK 3GTMK 1WCMC 2A6HA 2BE5A 3K7AK 3GTLC 3M4OC 4X6AK 3I4NK 2JA5K 5TMCA 5IP7C 1ZYRA 3S15K 3WODA 4BXXC 4BY1C 2NVXC 2A69A 3GTOK 4A3DK 4MEYA 3EQLA
chains in the Genus database with same CATH superfamily
5IYDC 1J6XA 2E2HK 4O2DA 3VA7A 1WQHA 3T00A 5IYCC 3GTMC 4Q5SA 1YCLA 1K83K 3RZOK 3K7AC 4WFAS 1IE0A 2JA6K 2B63K 4AH6A 2JA5C 4OIRA 1VLOA 2XCOA 3S15C 5HL7S 4P9SA 2CW0A 4G7OA 4ZH4A 3BUEA 5C44K 1DCHA 5JVHS 1TWGK 4KN7A 1TWCK 4YFNA 4C3IK 2YU9A 2A6EA 2GSOA 1HQMA 5C4JK 4AYBL 3GTQC 4A3KK 4BBSK 4A3CC 4Y52K 3CAGA 2WAQD 3TFIA 1XPPA 5CHPA 1I3QC 2ZJQS 4A3FC 1R9TA 4A3JK 5HQHA 3DLLS 1TWFC 3HOVK 1JQWA 4NOIA 4BBRC 4A3LK 3S14K 3S1QK 3GTPK 1TWAA 1USMA 5C4XC 3FOEA 4XCHA 1BS2A 3AD9C 4WILA 4A93C 2KQ1A 1KQ4A 2Y3PA 4P5BA 1L0WA 3LAJA 3GEEA 1Y1VA 4BY7K 1O25A 2L5NA 3HOWK 3GTJA 1EK8A 4KC6A 2KXYA 4FZBA 2NVXA 3FOFA 4U67S 2KPUA 3HOXC 3S1RC 3GTKK 1TWAK 1WQFA 4A3IK 2NVYK 3L4JA 3GSIA 3SZZA 4Q4ZA 3S2DC 1IBAA 2R92C 5CJ9A 4WCES 3GTLK 2E2IC 5IP7K 2NVXK 3GEHA 5EGHA 4GTFA 4MEXA 3T02A 1F93A 1ZVUA 4A3EK 3I4NC 4GTCA 2ZUEA 4LLGA 2RH6A 2A6HA 4X6AK 1GE9A 5DM6S 2GSNA 2VUMA 2JA7A 4J3NA 4GTEA 4G0VA 4BY1C 2A69A 4KB4A 4MEYA 1C0AA 4LQYA 2JA6C 3CQZK 5IP9C 3GTOA 4WFBS 4A3MK 3H0GA 2ZUFA 4KM8A 4QJVB 5JVOA 1ISEA 4RMFA 1DCOA 1XZPB 2JA7K 1K83A 2R93A 1Y1WA 4DDQA 1X31C 3GIRA 2B63A 4A3DC 3S16K 4C2MC 1EQRA 2W7VA 4A3KC 2WB1D 4GTLA 2GAHC 3H3VD 4GTDA 1TWGA 5M5WK 3H0GK 3I4MK 2PMZD 3HOUK 4IO9S 4WF9S 3IPJA 4FM9A 1TWCA 1USOA 5TJ3A 3A8KA 3S1NC 5DM7S 1B4AA 2O5JA 1XXCA 3G4AA 3S1QC 1Y1WK 2R93K 1O2BA 1I6HC 1HI9A 4C3HC 2YU9C 1FEUA 4C45A 3BP3A 1EI6A 4KASA 3PIOS 3S1MC 2V6TA 1O28A 2R7ZK 4C3JC 5JFEA 2PPBA 4GFQA 4G7ZA 3M3YC 3V4GA 4Y7NK 4KAWX 1I50A 2FQTA 3GTPA 5IYBC 1WCMA 1R9TC 3S17C 2NVQC 3GTGC 1B4BA 1I6VA 5C3EK 1YX2A 2RGRA 4A3IC 3PO3K 3FKIK 3DXJA 2E2JK 3RZDC 4A3GK 1YNNA 5FLMK 1TWHC 3AD8C 5IOSA 1Y1VC 2WB1L 1EH1A 3TFJA 1I50K 3H3VL 3S2HK 3PO2C 3GTKA 2PMZL 3GTJC 1SFOC 1WCMK 2EBBA 2ZJRS 4KMDA 2PA8D 5M5XK 2JA5A 3M4OK 4QJVA 2NVYA 5M3MK 3OPFA 3PIPS 3GTLA 1O24A 1XZPA 3MMLB 3HOZC 5IYDK 4A3BC 2JA8C 4PABA 2V6UA 5L46A 3N3YA 3OREA 5IYCK 3GTMK 1WOPA 3GTQA 3K7AK 2GAGC 2JA5K 3S15K 1JVIA 1RU0A 4BXXC 4LOWA 3BP8C 1TWFA 3GDZA 3EQLA 4M1XA 4GT9A 2Y0SL 3GEIA 3HOYC 2VUMC 2ZFZA 4G0WA 3T01A 3CQZA 1WOSA 4KN4A 3QX3A 1XZQB 3GTQK 1WSVA 4A3CK 2PA8L 5FJ8K 4P5AA 2PHCB 1I3QK 4A3FK 4YG2A 3GTOC 3FHZA 1TWFK 1V5VA 4QIWD 1F7VA 4G0UA 4BBRK 2E2HC 5C4XK 3L4KA 2JH3A 1K83C 3RZOC 4A93K 2R92A 2B63C 1O27A 1WORA 3HKZD 3LPXA 2E2IA 1BGWA 4PAAA 5HL8A 1J6WA 5C44C 4XSXA 5EGEA 1TWGC 4KATA 5IOTA 1TWCC 3HOXK 3S1RK 4BLBA 4C3IC 4OIOA 5C4JC 2R7ZA 3S2DK 2R92K 4BBSC 1O2AA 4Y52C 2P8TA 2CFAB 1IL2A 2E2IK 3AD7C 4A3JC 4BKWA 3HOVC 1IS1A 1O2FB 4XLPA 4A3LC 3S14C 3GTPC 1WOOA 4QIWL 3FKIA 4WFNS 4OINA 3LYWA 5E68A 4BY7C 4IOCS 3HOWC 3HKZL 1XZQA 1AB4A 1DCPA 4BY1K 2NVTK 3GTKC 1ZQ1C 1XXAA 4YFXA 5IORA 1TWAC 3N0BA 5IP9K 4LK1A 2NVYC 2Y0SD 3ERED 3CF5S 1VRQC 3GTLC 5IP7C 1ZYRA 3GTMA 3AQOA 1WIHA 2NVXC 4A3DK 3LAPA 2D6FC 4KARA 4C2MK 4WJ4A 4A3EC 3AH5A 1JOEA 4MQ9A 5JVGS 1PJ6A 4X6AC 1IW7A 1IQ0A 3GTGA 1BJTA 3S1NK 1YNJA 2L3UA 3A8JA 1I6HK 4C3HK 3S0XA 1WQGA 2CFAA 2YU9K 1I3QA 3S1MK 3CQZC 1ZXOA 4A3MC 4C3JK 2A68A 1TWHA 1G51A 3M3YK 3HXAA 3G4CA 2O5IA 1INNA 3Q3QA 5IYBK 1SFOA 4LJZA 1R9TK 4JK1A 1PJ7A 3TFHA 5M3FK 3S17K 2JA7C 5IOQA 2NVQK 3GTGK 4KMUA 1F9NA 1F7UA 5D4DA 3NUHA 3S16C 4LR2A 3AQPA 4XLNA 3RZDK 4GTAA 1ZBSA 1TWHK 3H0GC 3I4MC 3HOUC 2ZJPS 5TMFA 1Y1VK 2XCQA 2WAQL 3PO2K 4KB2A 4XSZA 3GTJK 1O26A 4YFKA 4OIQA 4ILDA 1SFOK 3SZYA 1J98A 2R93C 1Y1WC 1WSRA 3ADAC 4KM9A 1UV7A 4GZYA 2R7ZC 4KMHA 3HOZK 2XCRB 4BLAA 5M5YK 4LK0A 4Y7NC 4A3BK 2JA8K 1PJ5A 4GTBA 4OIPA 3TTGA 2KWAA 2NVTC 5C3EC 1EFWA 1DD5A 3PO3C 4BXXK 3FKIC 4WJ3M 2P5MA 1SMYA 2E2JC 1BDFA 2V6SA 4A3GC 1O29A 5FLMC 1J6VA 1VGXA 3N0CA 2E2HA 1I50C 3S2HC 3A8IA 3HOYK 2FQOA 2VUMK 4G7HA 4AYBD 1VH2A 2JA6A 1WCMC 2BE5A 3M4OC 3I4NK 1XXBA 5TMCA 4KMAA 3OEPA 3JSTA 3WODA 4KDDA 1VJEA 2GSUA 3GTOK 4IOAS
chains in the Genus database with same CATH topology
4C2MK 5IYDC 2Y0SL 2JA6C 4A3EC 5IP9C 3CQZK 4A3MK 2E2HK 3HOYC 2VUMC 4QJVB 4MQ9A 5IYCC 3GTMC 4Q5SA 1K83K 3RZOK 3K7AC 4KN4A 4X6AC 2JA6K 2B63K 1IW7A 3GTQK 2JA5C 4OIRA 3S15C 4A3CK 2JA7K 3S1NK 2PA8L 1YNJA 5FJ8K 2CW0A 4G7OA 1I3QK 4A3FK 4YG2A 4ZH4A 4A3DC 3GTOC 5C44K 1I6HK 4C3HK 1TWFK 4C2MC 2YU9K 1TWGK 3S16K 4QIWD 4KN7A 3S1MK 3CQZC 4BBRK 4A3MC 4A3KC 2A68A 2E2HC 2WB1D 1TWCK 4C3JK 3M3YK 3H3VD 4YFNA 4C3IK 5C4XK 2A6EA 5M5WK 3H0GK 3I4MK 2PMZD 1HQMA 1K83C 2O5IA 3HOUK 3RZOC 5C4JK 4A93K 5IYBK 2B63C 4AYBL 3GTQC 4LJZA 4A3KK 1R9TK 4JK1A 4BBSK 5M3FK 3S17K 4A3CC 3HKZD 2JA7C 3S1NC 4Y52K 2WAQD 2NVQK 3GTGK 4KMUA 2O5JA 1XPPA 1I3QC 5D4DA 4A3FC 3S1QC 1Y1WK 2R93K 5C44C 1I6HC 4XSXA 4A3JK 4C3HC 1TWFC 3S16C 2YU9C 1TWGC 4NOIA 3HOVK 4XLNA 3S1MC 3RZDK 4BBRC 4A3LK 3S14K 1TWCC 4C3JC 3GTPK 3HOXK 3S1RK 2PPBA 2R7ZK 4G7ZA 3M3YC 3S1QK 5C4XC 4C3IC 1TWHK 3H0GC 4Y7NK 3I4MC 3HOUC 4OIOA 5C4JC 5TMFA 1Y1VK 4A93C 5IYBC 2WAQL 3PO2K 3S2DK 2R92K 1R9TC 4XSZA 4BBSC 3GTJK 3S17C 4YFKA 4Y52C 4OIQA 1SFOK 2NVQC 3GTGC 2R93C 1Y1WC 1I6VA 4BY7K 2E2IK 5C3EK 3HOWK 4A3JC 4A3IC 3HOVC 3PO3K 3FKIK 3DXJA 2E2JK 4GZYA 3RZDC 4XLPA 4A3LC 3S14C 2R7ZC 3GTPC 4A3GK 3HOXC 3S1RC 3HOZK 3GTKK 1YNNA 4QIWL 5FLMK 1TWHC 1TWAK 4LK0A 4Y7NC 5M5YK 4A3IK 4A3BK 2JA8K 1Y1VC 4OINA 2WB1L 1I50K 2NVYK 3H3VL 3S2HK 3PO2C 4OIPA 4Q4ZA 3S2DC 2R92C 2PMZL 3GTJC 1SFOC 1WCMK 5M5XK 2PA8D 3GTLK 3M4OK 4QJVA 4BY7C 2NVTC 2E2IC 5C3EC 3HOWC 3HKZL 5IP7K 5M3MK 3PO3C 4BXXK 3FKIC 4BY1K 1SMYA 2E2JC 2NVXK 1BDFA 4A3GC 3HOZC 2NVTK 3GTKC 5FLMC 4YFXA 4MEXA 1TWAC 5IYDK 4A3BC 2JA8C 4A3EK 3I4NC 5IP9K 4LK1A 1I50C 2NVYC 3S2HC 2Y0SD 3HOYK 2VUMK 4G7HA 4AYBD 4LLGA 5IYCK 3GTMK 1WCMC 2A6HA 2BE5A 3K7AK 3GTLC 3M4OC 4X6AK 3I4NK 2JA5K 5TMCA 5IP7C 1ZYRA 3S15K 3WODA 4BXXC 4BY1C 2NVXC 2A69A 3GTOK 4A3DK 4MEYA 3EQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C2M K;  5IYD C;  2Y0S L;  2JA6 C;  4A3E C;  5IP9 C;  3CQZ K;  4A3M K;  2E2H K;  3HOY C;  2VUM C;  4QJV B;  4MQ9 A;  5IYC C;  3GTM C;  4Q5S A;  1K83 K;  3RZO K;  3K7A C;  4KN4 A;  4X6A C;  2JA6 K;  2B63 K;  1IW7 A;  3GTQ K;  2JA5 C;  4OIR A;  3S15 C;  4A3C K;  2JA7 K;  3S1N K;  2PA8 L;  1YNJ A;  5FJ8 K;  2CW0 A;  4G7O A;  1I3Q K;  4A3F K;  4YG2 A;  4ZH4 A;  4A3D C;  3GTO C;  5C44 K;  1I6H K;  4C3H K;  1TWF K;  4C2M C;  2YU9 K;  1TWG K;  3S16 K;  4QIW D;  4KN7 A;  3S1M K;  3CQZ C;  4BBR K;  4A3M C;  4A3K C;  2A68 A;  2E2H C;  2WB1 D;  1TWC K;  4C3J K;  3M3Y K;  3H3V D;  4YFN A;  4C3I K;  5C4X K;  2A6E A;  5M5W K;  3H0G K;  3I4M K;  2PMZ D;  1HQM A;  1K83 C;  2O5I A;  3HOU K;  3RZO C;  5C4J K;  4A93 K;  5IYB K;  2B63 C;  4AYB L;  3GTQ C;  4LJZ A;  4A3K K;  1R9T K;  4JK1 A;  4BBS K;  5M3F K;  3S17 K;  4A3C C;  3HKZ D;  2JA7 C;  3S1N C;  4Y52 K;  2WAQ D;  2NVQ K;  3GTG K;  4KMU A;  2O5J A;  1XPP A;  1I3Q C;  5D4D A;  4A3F C;  3S1Q C;  1Y1W K;  2R93 K;  5C44 C;  1I6H C;  4XSX A;  4A3J K;  4C3H C;  1TWF C;  3S16 C;  2YU9 C;  1TWG C;  4NOI A;  3HOV K;  4XLN A;  3S1M C;  3RZD K;  4BBR C;  4A3L K;  3S14 K;  1TWC C;  4C3J C;  3GTP K;  3HOX K;  3S1R K;  2PPB A;  2R7Z K;  4G7Z A;  3M3Y C;  3S1Q K;  5C4X C;  4C3I C;  1TWH K;  3H0G C;  4Y7N K;  3I4M C;  3HOU C;  4OIO A;  5C4J C;  5TMF A;  1Y1V K;  4A93 C;  5IYB C;  2WAQ L;  3PO2 K;  3S2D K;  2R92 K;  1R9T C;  4XSZ A;  4BBS C;  3GTJ K;  3S17 C;  4YFK A;  4Y52 C;  4OIQ A;  1SFO K;  2NVQ C;  3GTG C;  2R93 C;  1Y1W C;  1I6V A;  4BY7 K;  2E2I K;  5C3E K;  3HOW K;  4A3J C;  4A3I C;  3HOV C;  3PO3 K;  3FKI K;  3DXJ A;  2E2J K;  4GZY A;  3RZD C;  4XLP A;  4A3L C;  3S14 C;  2R7Z C;  3GTP C;  4A3G K;  3HOX C;  3S1R C;  3HOZ K;  3GTK K;  1YNN A;  4QIW L;  5FLM K;  1TWH C;  1TWA K;  4LK0 A;  4Y7N C;  5M5Y K;  4A3I K;  4A3B K;  2JA8 K;  1Y1V C;  4OIN A;  2WB1 L;  1I50 K;  2NVY K;  3H3V L;  3S2H K;  3PO2 C;  4OIP A;  4Q4Z A;  3S2D C;  2R92 C;  2PMZ L;  3GTJ C;  1SFO C;  1WCM K;  5M5X K;  2PA8 D;  3GTL K;  3M4O K;  4QJV A;  4BY7 C;  2NVT C;  2E2I C;  5C3E C;  3HOW C;  3HKZ L;  5IP7 K;  5M3M K;  3PO3 C;  4BXX K;  3FKI C;  4BY1 K;  1SMY A;  2E2J C;  2NVX K;  1BDF A;  4A3G C;  3HOZ C;  2NVT K;  3GTK C;  5FLM C;  4YFX A;  4MEX A;  1TWA C;  5IYD K;  4A3B C;  2JA8 C;  4A3E K;  3I4N C;  5IP9 K;  4LK1 A;  1I50 C;  2NVY C;  3S2H C;  2Y0S D;  3HOY K;  2VUM K;  4G7H A;  4AYB D;  4LLG A;  5IYC K;  3GTM K;  1WCM C;  2A6H A;  2BE5 A;  3K7A K;  3GTL C;  3M4O C;  4X6A K;  3I4N K;  2JA5 K;  5TMC A;  5IP7 C;  1ZYR A;  3S15 K;  3WOD A;  4BXX C;  4BY1 C;  2NVX C;  2A69 A;  3GTO K;  4A3D K;  4MEY A;  3EQL A; 
#chains in the Genus database with same CATH topology
 5IYD C;  1J6X A;  2E2H K;  4O2D A;  3VA7 A;  1WQH A;  3T00 A;  5IYC C;  3GTM C;  4Q5S A;  1YCL A;  1K83 K;  3RZO K;  3K7A C;  4WFA S;  1IE0 A;  2JA6 K;  2B63 K;  4AH6 A;  2JA5 C;  4OIR A;  1VLO A;  2XCO A;  3S15 C;  5HL7 S;  4P9S A;  2CW0 A;  4G7O A;  4ZH4 A;  3BUE A;  5C44 K;  1DCH A;  5JVH S;  1TWG K;  4KN7 A;  1TWC K;  4YFN A;  4C3I K;  2YU9 A;  2A6E A;  2GSO A;  1HQM A;  5C4J K;  4AYB L;  3GTQ C;  4A3K K;  4BBS K;  4A3C C;  4Y52 K;  3CAG A;  2WAQ D;  3TFI A;  1XPP A;  5CHP A;  1I3Q C;  2ZJQ S;  4A3F C;  1R9T A;  4A3J K;  5HQH A;  3DLL S;  1TWF C;  3HOV K;  1JQW A;  4NOI A;  4BBR C;  4A3L K;  3S14 K;  3S1Q K;  3GTP K;  1TWA A;  1USM A;  5C4X C;  3FOE A;  4XCH A;  1BS2 A;  3AD9 C;  4WIL A;  4A93 C;  2KQ1 A;  1KQ4 A;  2Y3P A;  4P5B A;  1L0W A;  3LAJ A;  3GEE A;  1Y1V A;  4BY7 K;  1O25 A;  2L5N A;  3HOW K;  3GTJ A;  1EK8 A;  4KC6 A;  2KXY A;  4FZB A;  2NVX A;  3FOF A;  4U67 S;  2KPU A;  3HOX C;  3S1R C;  3GTK K;  1TWA K;  1WQF A;  4A3I K;  2NVY K;  3L4J A;  3GSI A;  3SZZ A;  4Q4Z A;  3S2D C;  1IBA A;  2R92 C;  5CJ9 A;  4WCE S;  3GTL K;  2E2I C;  5IP7 K;  2NVX K;  3GEH A;  5EGH A;  4GTF A;  4MEX A;  3T02 A;  1F93 A;  1ZVU A;  4A3E K;  3I4N C;  4GTC A;  2ZUE A;  4LLG A;  2RH6 A;  2A6H A;  4X6A K;  1GE9 A;  5DM6 S;  2GSN A;  2VUM A;  2JA7 A;  4J3N A;  4GTE A;  4G0V A;  4BY1 C;  2A69 A;  4KB4 A;  4MEY A;  1C0A A;  4LQY A;  2JA6 C;  3CQZ K;  5IP9 C;  3GTO A;  4WFB S;  4A3M K;  3H0G A;  2ZUF A;  4KM8 A;  4QJV B;  5JVO A;  1ISE A;  4RMF A;  1DCO A;  1XZP B;  2JA7 K;  1K83 A;  2R93 A;  1Y1W A;  4DDQ A;  1X31 C;  3GIR A;  2B63 A;  4A3D C;  3S16 K;  4C2M C;  1EQR A;  2W7V A;  4A3K C;  2WB1 D;  4GTL A;  2GAH C;  3H3V D;  4GTD A;  1TWG A;  5M5W K;  3H0G K;  3I4M K;  2PMZ D;  3HOU K;  4IO9 S;  4WF9 S;  3IPJ A;  4FM9 A;  1TWC A;  1USO A;  5TJ3 A;  3A8K A;  3S1N C;  5DM7 S;  1B4A A;  2O5J A;  1XXC A;  3G4A A;  3S1Q C;  1Y1W K;  2R93 K;  1O2B A;  1I6H C;  1HI9 A;  4C3H C;  2YU9 C;  1FEU A;  4C45 A;  3BP3 A;  1EI6 A;  4KAS A;  3PIO S;  3S1M C;  2V6T A;  1O28 A;  2R7Z K;  4C3J C;  5JFE A;  2PPB A;  4GFQ A;  4G7Z A;  3M3Y C;  3V4G A;  4Y7N K;  4KAW X;  1I50 A;  2FQT A;  3GTP A;  5IYB C;  1WCM A;  1R9T C;  3S17 C;  2NVQ C;  3GTG C;  1B4B A;  1I6V A;  5C3E K;  1YX2 A;  2RGR A;  4A3I C;  3PO3 K;  3FKI K;  3DXJ A;  2E2J K;  3RZD C;  4A3G K;  1YNN A;  5FLM K;  1TWH C;  3AD8 C;  5IOS A;  1Y1V C;  2WB1 L;  1EH1 A;  3TFJ A;  1I50 K;  3H3V L;  3S2H K;  3PO2 C;  3GTK A;  2PMZ L;  3GTJ C;  1SFO C;  1WCM K;  2EBB A;  2ZJR S;  4KMD A;  2PA8 D;  5M5X K;  2JA5 A;  3M4O K;  4QJV A;  2NVY A;  5M3M K;  3OPF A;  3PIP S;  3GTL A;  1O24 A;  1XZP A;  3MML B;  3HOZ C;  5IYD K;  4A3B C;  2JA8 C;  4PAB A;  2V6U A;  5L46 A;  3N3Y A;  3ORE A;  5IYC K;  3GTM K;  1WOP A;  3GTQ A;  3K7A K;  2GAG C;  2JA5 K;  3S15 K;  1JVI A;  1RU0 A;  4BXX C;  4LOW A;  3BP8 C;  1TWF A;  3GDZ A;  3EQL A;  4M1X A;  4GT9 A;  2Y0S L;  3GEI A;  3HOY C;  2VUM C;  2ZFZ A;  4G0W A;  3T01 A;  3CQZ A;  1WOS A;  4KN4 A;  3QX3 A;  1XZQ B;  3GTQ K;  1WSV A;  4A3C K;  2PA8 L;  5FJ8 K;  4P5A A;  2PHC B;  1I3Q K;  4A3F K;  4YG2 A;  3GTO C;  3FHZ A;  1TWF K;  1V5V A;  4QIW D;  1F7V A;  4G0U A;  4BBR K;  2E2H C;  5C4X K;  3L4K A;  2JH3 A;  1K83 C;  3RZO C;  4A93 K;  2R92 A;  2B63 C;  1O27 A;  1WOR A;  3HKZ D;  3LPX A;  2E2I A;  1BGW A;  4PAA A;  5HL8 A;  1J6W A;  5C44 C;  4XSX A;  5EGE A;  1TWG C;  4KAT A;  5IOT A;  1TWC C;  3HOX K;  3S1R K;  4BLB A;  4C3I C;  4OIO A;  5C4J C;  2R7Z A;  3S2D K;  2R92 K;  4BBS C;  1O2A A;  4Y52 C;  2P8T A;  2CFA B;  1IL2 A;  2E2I K;  3AD7 C;  4A3J C;  4BKW A;  3HOV C;  1IS1 A;  1O2F B;  4XLP A;  4A3L C;  3S14 C;  3GTP C;  1WOO A;  4QIW L;  3FKI A;  4WFN S;  4OIN A;  3LYW A;  5E68 A;  4BY7 C;  4IOC S;  3HOW C;  3HKZ L;  1XZQ A;  1AB4 A;  1DCP A;  4BY1 K;  2NVT K;  3GTK C;  1ZQ1 C;  1XXA A;  4YFX A;  5IOR A;  1TWA C;  3N0B A;  5IP9 K;  4LK1 A;  2NVY C;  2Y0S D;  3ERE D;  3CF5 S;  1VRQ C;  3GTL C;  5IP7 C;  1ZYR A;  3GTM A;  3AQO A;  1WIH A;  2NVX C;  4A3D K;  3LAP A;  2D6F C;  4KAR A;  4C2M K;  4WJ4 A;  4A3E C;  3AH5 A;  1JOE A;  4MQ9 A;  5JVG S;  1PJ6 A;  4X6A C;  1IW7 A;  1IQ0 A;  3GTG A;  1BJT A;  3S1N K;  1YNJ A;  2L3U A;  3A8J A;  1I6H K;  4C3H K;  3S0X A;  1WQG A;  2CFA A;  2YU9 K;  1I3Q A;  3S1M K;  3CQZ C;  1ZXO A;  4A3M C;  4C3J K;  2A68 A;  1TWH A;  1G51 A;  3M3Y K;  3HXA A;  3G4C A;  2O5I A;  1INN A;  3Q3Q A;  5IYB K;  1SFO A;  4LJZ A;  1R9T K;  4JK1 A;  1PJ7 A;  3TFH A;  5M3F K;  3S17 K;  2JA7 C;  5IOQ A;  2NVQ K;  3GTG K;  4KMU A;  1F9N A;  1F7U A;  5D4D A;  3NUH A;  3S16 C;  4LR2 A;  3AQP A;  4XLN A;  3RZD K;  4GTA A;  1ZBS A;  1TWH K;  3H0G C;  3I4M C;  3HOU C;  2ZJP S;  5TMF A;  1Y1V K;  2XCQ A;  2WAQ L;  3PO2 K;  4KB2 A;  4XSZ A;  3GTJ K;  1O26 A;  4YFK A;  4OIQ A;  4ILD A;  1SFO K;  3SZY A;  1J98 A;  2R93 C;  1Y1W C;  1WSR A;  3ADA C;  4KM9 A;  1UV7 A;  4GZY A;  2R7Z C;  4KMH A;  3HOZ K;  2XCR B;  4BLA A;  5M5Y K;  4LK0 A;  4Y7N C;  4A3B K;  2JA8 K;  1PJ5 A;  4GTB A;  4OIP A;  3TTG A;  2KWA A;  2NVT C;  5C3E C;  1EFW A;  1DD5 A;  3PO3 C;  4BXX K;  3FKI C;  4WJ3 M;  2P5M A;  1SMY A;  2E2J C;  1BDF A;  2V6S A;  4A3G C;  1O29 A;  5FLM C;  1J6V A;  1VGX A;  3N0C A;  2E2H A;  1I50 C;  3S2H C;  3A8I A;  3HOY K;  2FQO A;  2VUM K;  4G7H A;  4AYB D;  1VH2 A;  2JA6 A;  1WCM C;  2BE5 A;  3M4O C;  3I4N K;  1XXB A;  5TMC A;  4KMA A;  3OEP A;  3JST A;  3WOD A;  4KDD A;  1VJE A;  2GSU A;  3GTO K;  4IOA S; 
#chains in the Genus database with same CATH homology
 4C2M K;  5IYD C;  2Y0S L;  2JA6 C;  4A3E C;  5IP9 C;  3CQZ K;  4A3M K;  2E2H K;  3HOY C;  2VUM C;  4QJV B;  4MQ9 A;  5IYC C;  3GTM C;  4Q5S A;  1K83 K;  3RZO K;  3K7A C;  4KN4 A;  4X6A C;  2JA6 K;  2B63 K;  1IW7 A;  3GTQ K;  2JA5 C;  4OIR A;  3S15 C;  4A3C K;  2JA7 K;  3S1N K;  2PA8 L;  1YNJ A;  5FJ8 K;  2CW0 A;  4G7O A;  1I3Q K;  4A3F K;  4YG2 A;  4ZH4 A;  4A3D C;  3GTO C;  5C44 K;  1I6H K;  4C3H K;  1TWF K;  4C2M C;  2YU9 K;  1TWG K;  3S16 K;  4QIW D;  4KN7 A;  3S1M K;  3CQZ C;  4BBR K;  4A3M C;  4A3K C;  2A68 A;  2E2H C;  2WB1 D;  1TWC K;  4C3J K;  3M3Y K;  3H3V D;  4YFN A;  4C3I K;  5C4X K;  2A6E A;  5M5W K;  3H0G K;  3I4M K;  2PMZ D;  1HQM A;  1K83 C;  2O5I A;  3HOU K;  3RZO C;  5C4J K;  4A93 K;  5IYB K;  2B63 C;  4AYB L;  3GTQ C;  4LJZ A;  4A3K K;  1R9T K;  4JK1 A;  4BBS K;  5M3F K;  3S17 K;  4A3C C;  3HKZ D;  2JA7 C;  3S1N C;  4Y52 K;  2WAQ D;  2NVQ K;  3GTG K;  4KMU A;  2O5J A;  1XPP A;  1I3Q C;  5D4D A;  4A3F C;  3S1Q C;  1Y1W K;  2R93 K;  5C44 C;  1I6H C;  4XSX A;  4A3J K;  4C3H C;  1TWF C;  3S16 C;  2YU9 C;  1TWG C;  4NOI A;  3HOV K;  4XLN A;  3S1M C;  3RZD K;  4BBR C;  4A3L K;  3S14 K;  1TWC C;  4C3J C;  3GTP K;  3HOX K;  3S1R K;  2PPB A;  2R7Z K;  4G7Z A;  3M3Y C;  3S1Q K;  5C4X C;  4C3I C;  1TWH K;  3H0G C;  4Y7N K;  3I4M C;  3HOU C;  4OIO A;  5C4J C;  5TMF A;  1Y1V K;  4A93 C;  5IYB C;  2WAQ L;  3PO2 K;  3S2D K;  2R92 K;  1R9T C;  4XSZ A;  4BBS C;  3GTJ K;  3S17 C;  4YFK A;  4Y52 C;  4OIQ A;  1SFO K;  2NVQ C;  3GTG C;  2R93 C;  1Y1W C;  1I6V A;  4BY7 K;  2E2I K;  5C3E K;  3HOW K;  4A3J C;  4A3I C;  3HOV C;  3PO3 K;  3FKI K;  3DXJ A;  2E2J K;  4GZY A;  3RZD C;  4XLP A;  4A3L C;  3S14 C;  2R7Z C;  3GTP C;  4A3G K;  3HOX C;  3S1R C;  3HOZ K;  3GTK K;  1YNN A;  4QIW L;  5FLM K;  1TWH C;  1TWA K;  4LK0 A;  4Y7N C;  5M5Y K;  4A3I K;  4A3B K;  2JA8 K;  1Y1V C;  4OIN A;  2WB1 L;  1I50 K;  2NVY K;  3H3V L;  3S2H K;  3PO2 C;  4OIP A;  4Q4Z A;  3S2D C;  2R92 C;  2PMZ L;  3GTJ C;  1SFO C;  1WCM K;  5M5X K;  2PA8 D;  3GTL K;  3M4O K;  4QJV A;  4BY7 C;  2NVT C;  2E2I C;  5C3E C;  3HOW C;  3HKZ L;  5IP7 K;  5M3M K;  3PO3 C;  4BXX K;  3FKI C;  4BY1 K;  1SMY A;  2E2J C;  2NVX K;  1BDF A;  4A3G C;  3HOZ C;  2NVT K;  3GTK C;  5FLM C;  4YFX A;  4MEX A;  1TWA C;  5IYD K;  4A3B C;  2JA8 C;  4A3E K;  3I4N C;  5IP9 K;  4LK1 A;  1I50 C;  2NVY C;  3S2H C;  2Y0S D;  3HOY K;  2VUM K;  4G7H A;  4AYB D;  4LLG A;  5IYC K;  3GTM K;  1WCM C;  2A6H A;  2BE5 A;  3K7A K;  3GTL C;  3M4O C;  4X6A K;  3I4N K;  2JA5 K;  5TMC A;  5IP7 C;  1ZYR A;  3S15 K;  3WOD A;  4BXX C;  4BY1 C;  2NVX C;  2A69 A;  3GTO K;  4A3D K;  4MEY A;  3EQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...