5TMFA

Re-refinement of thermus thermophilus rna polymerase
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 44
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmfA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmfA01
4OIPA 3S2DK 3HOUK 2PA8L 1I50K 4OIRA 4KN7A 4G7OA 1R9TK 5C4XK 2PMZD 4Q5SA 3I4NC 1WCMC 2NVYC 5D4DA 3CQZK 4BBSK 4LK0A 5FLMC 4A3CC 1Y1WK 3PO3K 4C3IK 2O5IA 4KN4A 3FKIK 2PPBA 4NOIA 4LJZA 4AYBL 3GTKK 4ZH4A 4C2MC 3K7AK 2NVQK 1Y1VK 3GTOK 1TWCC 3GTMC 2CW0A 3HOVK 1I6HC 3GTLC 3GTJK 3S2HK 5C44C 3M4OC 4Y52K 4BY7K 3RZDC 3S1MK 3M3YC 5IYCC 4A3GC 4OIOA 3HOXK 5IYDC 4X6AC 1K83C 3GTPC 2E2IK 3S1QC 1TWGC 3S16K 4MQ9A 4QIWL 4GZYA 5IP9C 2R92C 3H3VL 3S14K 2E2JC 3S16C 4YG2A 5M5WK 1K83K 3GTPK 4X6AK 4BBRC 3HOXC 4A3EK 1HQMA 2E2IC 2A69A 2YU9C 5IYCK 3M3YK 4A3GK 4OIQA 4A3JC 2A6EA 3GTJC 2JA8C 3HOVC 3H0GK 3GTMK 2R93C 4BY1K 1Y1VC 3GTOC 3K7AC 2VUMK 4C2MK 3GTGC 3GTKC 3S17C 1TWHC 3FKIC 3HOZC 2A68A 3PO2C 1Y1WC 3PO3C 4A3CK 2NVTK 4XLPA 4A3MK 2E2HC 2BE5A 2E2HK 5M3MK 4A3MC 5C4XC 4AYBD 1R9TC 3DXJA 2A6HA 1I50C 2NVTC 3HOUC 4LLGA 3S2DC 2O5JA 4G7HA 5IYBK 4QJVA 3HOZK 3PO2K 4JK1A 1TWHK 2Y0SL 3RZOK 1BDFA 1I6VA 3S17K 3GTGK 4A3IK 4BY1C 2VUMC 4C3HK 2WAQD 2R93K 4BXXC 3H0GC 2JA8K 5M5YK 5M3FK 1SFOK 4G7ZA 5IYDK 2B63C 4A3JK 3HOYC 2YU9K 4YFNA 4A3EC 4BBRK 4C3JC 1YNNA 4XLNA 2E2JK 2JA6K 3S14C 2R7ZC 3S15C 2R92K 5IP9K 3S1NK 1TWFC 2WB1D 1TWGK 3S1QK 4A3FK 5C4JC 4MEXA 1TWAC 4Y7NK 1YNJA 3S1MC 4YFXA 4A3KK 3RZDK 4BY7C 3HOWK 4XSZA 4Y52C 5TMCA 5C44K 2JA5K 3S2HC 3GTLK 3M4OK 2NVXC 2PA8D 1I6HK 1TWCK 1IW7A 4Q4ZA 3EQLA 4XSXA 2NVQC 2PMZL 2WB1L 4C3IC 2NVXK 2JA5C 3HOWC 5FLMK 4A3KC 4BBSC 5TMFA 1ZYRA 4Y7NC 3CQZC 4KMUA 1TWAK 4A3FC 3HKZD 1WCMK 2NVYK 5C4JK 3I4NK 2Y0SD 1TWFK 1SMYA 3S1NC 3S15K 2R7ZK 2JA6C 2WAQL 4A3BK 1I3QC 5IP7K 4A3DK 4C3JK 5C3EK 5M5XK 4QJVB 3I4MC 3GTQK 4A3LC 3H3VD 2JA7C 3HOYK 4A93C 4MEYA 4LK1A 2B63K 1SFOC 3S1RC 3S1RK 1XPPA 4OINA 3HKZL 4BXXK 4A93K 4C3HC 4A3IC 2JA7K 4A3LK 4YFKA 3GTQC 3I4MK 4QIWD 5FJ8K 3WODA 3RZOC 5C3EC 4A3DC 5IP7C 1I3QK 5IYBC 4A3BC
chains in the Genus database with same CATH superfamily
4OIPA 3S2DK 1I50K 4G7OA 3FOEA 1R9TK 3IPJA 3LPXA 2YU9A 3CQZK 2GAHC 5FLMC 3HXAA 1R9TA 3NUHA 4LJZA 2NVQK 1Y1VK 2CW0A 5C44C 5IOQA 4Y52K 3LAPA 3HOXK 5IYDC 4KAWX 4WJ3M 3S14K 2P5MA 4YG2A 4KARA 3TFIA 1F93A 1IS1A 5E68A 1ZXOA 3GTJC 3GTMK 3GTQA 1J6VA 3K7AC 1EK8A 5HL7S 3AQPA 3HOZC 3PO2C 2KXYA 4U67S 2BE5A 3AH5A 5C4XC 1YX2A 1R9TC 3DXJA 1I50C 1XZQA 3PO2K 5IYBK 3OPFA 3GIRA 3T00A 2Y0SL 3QX3A 1ZQ1C 3RZOK 1I6VA 4A3IK 2R93K 2WAQD 2JA5A 3H0GC 3BP8C 1VGXA 1PJ5A 4C3JC 2L5NA 2GSNA 5IYBC 1YNNA 4XLNA 4LR2A 5CHPA 5CJ9A 4KDDA 1I3QA 3FKIA 2WB1D 5JFEA 4Y7NK 1YNJA 4YFXA 3N0CA 3ADAC 2JA5K 4KC6A 1I6HK 2R93A 1IW7A 4FM9A 3EQLA 2NVQC 1WOSA 4LOWA 1JQWA 4KB2A 2JA5C 5FLMK 4A3KC 3AQOA 3N3YA 3GEIA 3CQZC 4KMUA 3HKZD 3AD9C 3VA7A 2Y0SD 3S1NC 1EQRA 2Y3PA 3LAJA 2ZUEA 2R7ZA 4GTEA 5C3EK 1EFWA 3GTQK 3GTMA 2JA7C 2XCOA 1O26A 3S1RK 3SZYA 4WFBS 4WCES 4A3IC 1BS2A 4G0WA 3I4MK 3RZOC 4A3DC 3GTKA 1X31C 1I3QK 2PA8L 4KN7A 1WQFA 5C4XK 1J6XA 2PMZD 5IORA 4LK0A 4A3CC 1JVIA 2PPBA 4GTBA 4P5BA 2JA6A 4AYBL 3K7AK 3T01A 1TWCC 3GTMC 2RH6A 3GTJK 1O2FB 3M4OC 1PJ6A 4BY7K 4DDQA 3RZDC 4OIOA 2KWAA 3S1QC 3A8JA 1TWGC 3S16K 1O2AA 3H3VL 2L3UA 2E2JC 2V6TA 4GTLA 1TWFA 1K83K 5IYDK 4A3EK 3HOXC 2ZFZA 4A3GK 4A3JC 2GSOA 4KMHA 1BGWA 5IOTA 4BY1K 1Y1VC 4C2MK 3GTKC 3S17C 3GEEA 1TWHC 1TWCA 2NVTK 1IE0A 1YCLA 1F9NA 2V6SA 3DLLS 2E2HK 4A3MC 3V4GA 3L4KA 4GTDA 1XXAA 1TWGA 5TJ3A 1Y1VA 3HOUC 4LLGA 3S2DC 4GTFA 3OEPA 1VH2A 3GTGK 2VUMC 4C3HK 4KM9A 1USMA 5M3FK 1SFOK 4G7ZA 4M1XA 2YU9K 1O24A 4BBRK 2CFAA 1I50A 1TWHA 2R7ZC 2R92K 5IP9K 3GSIA 1TWAC 3S1MC 5DM7S 4XSZA 3GTLK 4Q4ZA 2EBBA 2PMZL 4KATA 4C3IC 2NVXK 4FZBA 2FQTA 3HOWC 1INNA 5TMFA 1ZYRA 2NVYK 2V6UA 4A3FC 3GEHA 4KB4A 3GTPA 1SMYA 1DCHA 2GAGC 2JA6C 5JVGS 5IP7K 4A3LC 3HOYK 4GTCA 5IOSA 4BKWA 4A93C 4MEYA 2B63K 2ZJRS 4OINA 2NVXA 3WODA 3SZZA 1RU0A 5EGEA 4A3BC 1XXCA 3BP3A 2FQOA 3A8IA 3I4NC 3CAGA 1WCMC 4BBSK 1J6WA 1ISEA 4C45A 1Y1WK 4C3IK 2O5IA 1DCOA 5HL8A 3GTOK 2GSUA 4WFAS 3LYWA 3HOVK 3S2HK 4IO9S 1SFOA 5IYCC 2E2IK 3GTPC 4IOCS 4P5AA 5DM6S 5IP9C 4WF9S 2ZUFA 4J3NA 4RMFA 3GTPK 4X6AK 3H0GA 1HQMA 2E2IC 1WSRA 5IYCK 3M3YK 4AH6A 5HQHA 2A6EA 2JA8C 3HOVC 2VUMK 3GTGC 4KASA 3FKIC 2A68A 3PO3C 3JSTA 1DD5A 4A3MK 1KQ4A 1TWAA 2XCRB 2E2HC 4WILA 3Q3QA 3TFHA 2A6HA 3OREA 2NVTC 4G7HA 3AD7C 4JK1A 1TWHK 4WJ4A 4KMAA 4G0VA 4BY1C 1WQGA 4BXXC 2PHCB 4KM8A 1AB4A 2JA8K 5M5YK 1WQHA 1XZQB 1V5VA 4LQYA 3CF5S 4G0UA 1G51A 4GFQA 3BUEA 2JA6K 1O28A 3S15C 3GDZA 1TWFC 1ZBSA 1TWGK 1JOEA 4A3FK 5C4JC 1O27A 3RZDK 1ZVUA 2ZJPS 4KMDA 3M4OK 5TMCA 2P8TA 4GTAA 3S2HC 3L4JA 2NVXC 1TWCK 4XSXA 3FHZA 2WB1L 5JVHS 1WCMA 4BBSC 1TWAK 1WCMK 5C4JK 1XZPA 3I4NK 4P9SA 1K83A 1TWFK 3S15K 1B4BA 2R7ZK 1WSVA 2WAQL 4A3BK 3FOFA 4A3DK 3T02A 3I4MC 3H3VD 1SFOC 2CFAB 3HKZL 4BXXK 4A93K 3GTJA 4C3HC 4A3LK 4YFKA 3GTQC 4QIWD 3TTGA 5C3EC 5IP7C 3AD8C 3HOUK 4OIRA 4Q5SA 3TFJA 2E2IA 2NVYC 5D4DA 3PO3K 3FKIK 4KN4A 4PABA 4PAAA 4NOIA 3GTKK 1PJ7A 4ZH4A 4C2MC 5EGHA 3A8KA 1Y1WA 3S0XA 1I6HC 3GTLC 3ERED 2W7VA 3S1MK 3M3YC 1UV7A 4A3GC 4X6AC 1K83C 4BLBA 1F7VA 4MQ9A 4WFNS 4GZYA 1XZPB 4QIWL 2R92C 3S16C 1GE9A 5M5WK 2VUMA 4BBRC 2A69A 2YU9C 4OIQA 3H0GK 2R93C 4IOAS 5JVOA 3GTOC 1C0AA 1BJTA 1DCPA 2XCQA 4XCHA 1Y1WC 1FEUA 4A3CK 4XLPA 3G4CA 1O29A 2KQ1A 2ZJQS 5M3MK 4AYBD 1XXBA 3GTOA 2O5JA 4QJVA 1F7UA 3HOZK 1BDFA 3S17K 1WIHA 3GTLA 2B63C 4A3JK 3HOYC 4YFNA 1J98A 4BLAA 3N0BA 4A3EC 1VLOA 2R92A 2E2JK 3S14C 3G4AA 3S1NK 1WORA 5L46A 3S1QK 4MEXA 2RGRA 1WOOA 1IL2A 3CQZA 3MMLB 4A3KK 2B63A 4BY7C 3HOWK 4Y52C 1VJEA 1WOPA 5C44K 1O2BA 2PA8D 3GTGA 1VRQC 1EH1A 2JA7A 3PIPS 2NVYA 2E2HA 4GT9A 4Y7NC 2D6FC 1I3QC 1IBAA 1EI6A 1O25A 2KPUA 1IQ0A 4C3JK 5M5XK 3PIOS 4QJVB 1HI9A 1L0WA 4LK1A 3S1RC 1XPPA 2JA7K 2JH3A 4ILDA 4O2DA 5FJ8K 1B4AA 1USOA
chains in the Genus database with same CATH topology
4OIPA 3S2DK 3HOUK 2PA8L 1I50K 4OIRA 4KN7A 4G7OA 1R9TK 5C4XK 2PMZD 4Q5SA 3I4NC 1WCMC 2NVYC 5D4DA 3CQZK 4BBSK 4LK0A 5FLMC 4A3CC 1Y1WK 3PO3K 4C3IK 2O5IA 4KN4A 3FKIK 2PPBA 4NOIA 4LJZA 4AYBL 3GTKK 4ZH4A 4C2MC 3K7AK 2NVQK 1Y1VK 3GTOK 1TWCC 3GTMC 2CW0A 3HOVK 1I6HC 3GTLC 3GTJK 3S2HK 5C44C 3M4OC 4Y52K 4BY7K 3RZDC 3S1MK 3M3YC 5IYCC 4A3GC 4OIOA 3HOXK 5IYDC 4X6AC 1K83C 3GTPC 2E2IK 3S1QC 1TWGC 3S16K 4MQ9A 4QIWL 4GZYA 5IP9C 2R92C 3H3VL 3S14K 2E2JC 3S16C 4YG2A 5M5WK 1K83K 3GTPK 4X6AK 4BBRC 3HOXC 4A3EK 1HQMA 2E2IC 2A69A 2YU9C 5IYCK 3M3YK 4A3GK 4OIQA 4A3JC 2A6EA 3GTJC 2JA8C 3HOVC 3H0GK 3GTMK 2R93C 4BY1K 1Y1VC 3GTOC 3K7AC 2VUMK 4C2MK 3GTGC 3GTKC 3S17C 1TWHC 3FKIC 3HOZC 2A68A 3PO2C 1Y1WC 3PO3C 4A3CK 2NVTK 4XLPA 4A3MK 2E2HC 2BE5A 2E2HK 5M3MK 4A3MC 5C4XC 4AYBD 1R9TC 3DXJA 2A6HA 1I50C 2NVTC 3HOUC 4LLGA 3S2DC 2O5JA 4G7HA 5IYBK 4QJVA 3HOZK 3PO2K 4JK1A 1TWHK 2Y0SL 3RZOK 1BDFA 1I6VA 3S17K 3GTGK 4A3IK 4BY1C 2VUMC 4C3HK 2WAQD 2R93K 4BXXC 3H0GC 2JA8K 5M5YK 5M3FK 1SFOK 4G7ZA 5IYDK 2B63C 4A3JK 3HOYC 2YU9K 4YFNA 4A3EC 4BBRK 4C3JC 1YNNA 4XLNA 2E2JK 2JA6K 3S14C 2R7ZC 3S15C 2R92K 5IP9K 3S1NK 1TWFC 2WB1D 1TWGK 3S1QK 4A3FK 5C4JC 4MEXA 1TWAC 4Y7NK 1YNJA 3S1MC 4YFXA 4A3KK 3RZDK 4BY7C 3HOWK 4XSZA 4Y52C 5TMCA 5C44K 2JA5K 3S2HC 3GTLK 3M4OK 2NVXC 2PA8D 1I6HK 1TWCK 1IW7A 4Q4ZA 3EQLA 4XSXA 2NVQC 2PMZL 2WB1L 4C3IC 2NVXK 2JA5C 3HOWC 5FLMK 4A3KC 4BBSC 5TMFA 1ZYRA 4Y7NC 3CQZC 4KMUA 1TWAK 4A3FC 3HKZD 1WCMK 2NVYK 5C4JK 3I4NK 2Y0SD 1TWFK 1SMYA 3S1NC 3S15K 2R7ZK 2JA6C 2WAQL 4A3BK 1I3QC 5IP7K 4A3DK 4C3JK 5C3EK 5M5XK 4QJVB 3I4MC 3GTQK 4A3LC 3H3VD 2JA7C 3HOYK 4A93C 4MEYA 4LK1A 2B63K 1SFOC 3S1RC 3S1RK 1XPPA 4OINA 3HKZL 4BXXK 4A93K 4C3HC 4A3IC 2JA7K 4A3LK 4YFKA 3GTQC 3I4MK 4QIWD 5FJ8K 3WODA 3RZOC 5C3EC 4A3DC 5IP7C 1I3QK 5IYBC 4A3BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIP A;  3S2D K;  3HOU K;  2PA8 L;  1I50 K;  4OIR A;  4KN7 A;  4G7O A;  1R9T K;  5C4X K;  2PMZ D;  4Q5S A;  3I4N C;  1WCM C;  2NVY C;  5D4D A;  3CQZ K;  4BBS K;  4LK0 A;  5FLM C;  4A3C C;  1Y1W K;  3PO3 K;  4C3I K;  2O5I A;  4KN4 A;  3FKI K;  2PPB A;  4NOI A;  4LJZ A;  4AYB L;  3GTK K;  4ZH4 A;  4C2M C;  3K7A K;  2NVQ K;  1Y1V K;  3GTO K;  1TWC C;  3GTM C;  2CW0 A;  3HOV K;  1I6H C;  3GTL C;  3GTJ K;  3S2H K;  5C44 C;  3M4O C;  4Y52 K;  4BY7 K;  3RZD C;  3S1M K;  3M3Y C;  5IYC C;  4A3G C;  4OIO A;  3HOX K;  5IYD C;  4X6A C;  1K83 C;  3GTP C;  2E2I K;  3S1Q C;  1TWG C;  3S16 K;  4MQ9 A;  4QIW L;  4GZY A;  5IP9 C;  2R92 C;  3H3V L;  3S14 K;  2E2J C;  3S16 C;  4YG2 A;  5M5W K;  1K83 K;  3GTP K;  4X6A K;  4BBR C;  3HOX C;  4A3E K;  1HQM A;  2E2I C;  2A69 A;  2YU9 C;  5IYC K;  3M3Y K;  4A3G K;  4OIQ A;  4A3J C;  2A6E A;  3GTJ C;  2JA8 C;  3HOV C;  3H0G K;  3GTM K;  2R93 C;  4BY1 K;  1Y1V C;  3GTO C;  3K7A C;  2VUM K;  4C2M K;  3GTG C;  3GTK C;  3S17 C;  1TWH C;  3FKI C;  3HOZ C;  2A68 A;  3PO2 C;  1Y1W C;  3PO3 C;  4A3C K;  2NVT K;  4XLP A;  4A3M K;  2E2H C;  2BE5 A;  2E2H K;  5M3M K;  4A3M C;  5C4X C;  4AYB D;  1R9T C;  3DXJ A;  2A6H A;  1I50 C;  2NVT C;  3HOU C;  4LLG A;  3S2D C;  2O5J A;  4G7H A;  5IYB K;  4QJV A;  3HOZ K;  3PO2 K;  4JK1 A;  1TWH K;  2Y0S L;  3RZO K;  1BDF A;  1I6V A;  3S17 K;  3GTG K;  4A3I K;  4BY1 C;  2VUM C;  4C3H K;  2WAQ D;  2R93 K;  4BXX C;  3H0G C;  2JA8 K;  5M5Y K;  5M3F K;  1SFO K;  4G7Z A;  5IYD K;  2B63 C;  4A3J K;  3HOY C;  2YU9 K;  4YFN A;  4A3E C;  4BBR K;  4C3J C;  1YNN A;  4XLN A;  2E2J K;  2JA6 K;  3S14 C;  2R7Z C;  3S15 C;  2R92 K;  5IP9 K;  3S1N K;  1TWF C;  2WB1 D;  1TWG K;  3S1Q K;  4A3F K;  5C4J C;  4MEX A;  1TWA C;  4Y7N K;  1YNJ A;  3S1M C;  4YFX A;  4A3K K;  3RZD K;  4BY7 C;  3HOW K;  4XSZ A;  4Y52 C;  5TMC A;  5C44 K;  2JA5 K;  3S2H C;  3GTL K;  3M4O K;  2NVX C;  2PA8 D;  1I6H K;  1TWC K;  1IW7 A;  4Q4Z A;  3EQL A;  4XSX A;  2NVQ C;  2PMZ L;  2WB1 L;  4C3I C;  2NVX K;  2JA5 C;  3HOW C;  5FLM K;  4A3K C;  4BBS C;  5TMF A;  1ZYR A;  4Y7N C;  3CQZ C;  4KMU A;  1TWA K;  4A3F C;  3HKZ D;  1WCM K;  2NVY K;  5C4J K;  3I4N K;  2Y0S D;  1TWF K;  1SMY A;  3S1N C;  3S15 K;  2R7Z K;  2JA6 C;  2WAQ L;  4A3B K;  1I3Q C;  5IP7 K;  4A3D K;  4C3J K;  5C3E K;  5M5X K;  4QJV B;  3I4M C;  3GTQ K;  4A3L C;  3H3V D;  2JA7 C;  3HOY K;  4A93 C;  4MEY A;  4LK1 A;  2B63 K;  1SFO C;  3S1R C;  3S1R K;  1XPP A;  4OIN A;  3HKZ L;  4BXX K;  4A93 K;  4C3H C;  4A3I C;  2JA7 K;  4A3L K;  4YFK A;  3GTQ C;  3I4M K;  4QIW D;  5FJ8 K;  3WOD A;  3RZO C;  5C3E C;  4A3D C;  5IP7 C;  1I3Q K;  5IYB C;  4A3B C; 
#chains in the Genus database with same CATH topology
 4OIP A;  3S2D K;  1I50 K;  4G7O A;  3FOE A;  1R9T K;  3IPJ A;  3LPX A;  2YU9 A;  3CQZ K;  2GAH C;  5FLM C;  3HXA A;  1R9T A;  3NUH A;  4LJZ A;  2NVQ K;  1Y1V K;  2CW0 A;  5C44 C;  5IOQ A;  4Y52 K;  3LAP A;  3HOX K;  5IYD C;  4KAW X;  4WJ3 M;  3S14 K;  2P5M A;  4YG2 A;  4KAR A;  3TFI A;  1F93 A;  1IS1 A;  5E68 A;  1ZXO A;  3GTJ C;  3GTM K;  3GTQ A;  1J6V A;  3K7A C;  1EK8 A;  5HL7 S;  3AQP A;  3HOZ C;  3PO2 C;  2KXY A;  4U67 S;  2BE5 A;  3AH5 A;  5C4X C;  1YX2 A;  1R9T C;  3DXJ A;  1I50 C;  1XZQ A;  3PO2 K;  5IYB K;  3OPF A;  3GIR A;  3T00 A;  2Y0S L;  3QX3 A;  1ZQ1 C;  3RZO K;  1I6V A;  4A3I K;  2R93 K;  2WAQ D;  2JA5 A;  3H0G C;  3BP8 C;  1VGX A;  1PJ5 A;  4C3J C;  2L5N A;  2GSN A;  5IYB C;  1YNN A;  4XLN A;  4LR2 A;  5CHP A;  5CJ9 A;  4KDD A;  1I3Q A;  3FKI A;  2WB1 D;  5JFE A;  4Y7N K;  1YNJ A;  4YFX A;  3N0C A;  3ADA C;  2JA5 K;  4KC6 A;  1I6H K;  2R93 A;  1IW7 A;  4FM9 A;  3EQL A;  2NVQ C;  1WOS A;  4LOW A;  1JQW A;  4KB2 A;  2JA5 C;  5FLM K;  4A3K C;  3AQO A;  3N3Y A;  3GEI A;  3CQZ C;  4KMU A;  3HKZ D;  3AD9 C;  3VA7 A;  2Y0S D;  3S1N C;  1EQR A;  2Y3P A;  3LAJ A;  2ZUE A;  2R7Z A;  4GTE A;  5C3E K;  1EFW A;  3GTQ K;  3GTM A;  2JA7 C;  2XCO A;  1O26 A;  3S1R K;  3SZY A;  4WFB S;  4WCE S;  4A3I C;  1BS2 A;  4G0W A;  3I4M K;  3RZO C;  4A3D C;  3GTK A;  1X31 C;  1I3Q K;  2PA8 L;  4KN7 A;  1WQF A;  5C4X K;  1J6X A;  2PMZ D;  5IOR A;  4LK0 A;  4A3C C;  1JVI A;  2PPB A;  4GTB A;  4P5B A;  2JA6 A;  4AYB L;  3K7A K;  3T01 A;  1TWC C;  3GTM C;  2RH6 A;  3GTJ K;  1O2F B;  3M4O C;  1PJ6 A;  4BY7 K;  4DDQ A;  3RZD C;  4OIO A;  2KWA A;  3S1Q C;  3A8J A;  1TWG C;  3S16 K;  1O2A A;  3H3V L;  2L3U A;  2E2J C;  2V6T A;  4GTL A;  1TWF A;  1K83 K;  5IYD K;  4A3E K;  3HOX C;  2ZFZ A;  4A3G K;  4A3J C;  2GSO A;  4KMH A;  1BGW A;  5IOT A;  4BY1 K;  1Y1V C;  4C2M K;  3GTK C;  3S17 C;  3GEE A;  1TWH C;  1TWC A;  2NVT K;  1IE0 A;  1YCL A;  1F9N A;  2V6S A;  3DLL S;  2E2H K;  4A3M C;  3V4G A;  3L4K A;  4GTD A;  1XXA A;  1TWG A;  5TJ3 A;  1Y1V A;  3HOU C;  4LLG A;  3S2D C;  4GTF A;  3OEP A;  1VH2 A;  3GTG K;  2VUM C;  4C3H K;  4KM9 A;  1USM A;  5M3F K;  1SFO K;  4G7Z A;  4M1X A;  2YU9 K;  1O24 A;  4BBR K;  2CFA A;  1I50 A;  1TWH A;  2R7Z C;  2R92 K;  5IP9 K;  3GSI A;  1TWA C;  3S1M C;  5DM7 S;  4XSZ A;  3GTL K;  4Q4Z A;  2EBB A;  2PMZ L;  4KAT A;  4C3I C;  2NVX K;  4FZB A;  2FQT A;  3HOW C;  1INN A;  5TMF A;  1ZYR A;  2NVY K;  2V6U A;  4A3F C;  3GEH A;  4KB4 A;  3GTP A;  1SMY A;  1DCH A;  2GAG C;  2JA6 C;  5JVG S;  5IP7 K;  4A3L C;  3HOY K;  4GTC A;  5IOS A;  4BKW A;  4A93 C;  4MEY A;  2B63 K;  2ZJR S;  4OIN A;  2NVX A;  3WOD A;  3SZZ A;  1RU0 A;  5EGE A;  4A3B C;  1XXC A;  3BP3 A;  2FQO A;  3A8I A;  3I4N C;  3CAG A;  1WCM C;  4BBS K;  1J6W A;  1ISE A;  4C45 A;  1Y1W K;  4C3I K;  2O5I A;  1DCO A;  5HL8 A;  3GTO K;  2GSU A;  4WFA S;  3LYW A;  3HOV K;  3S2H K;  4IO9 S;  1SFO A;  5IYC C;  2E2I K;  3GTP C;  4IOC S;  4P5A A;  5DM6 S;  5IP9 C;  4WF9 S;  2ZUF A;  4J3N A;  4RMF A;  3GTP K;  4X6A K;  3H0G A;  1HQM A;  2E2I C;  1WSR A;  5IYC K;  3M3Y K;  4AH6 A;  5HQH A;  2A6E A;  2JA8 C;  3HOV C;  2VUM K;  3GTG C;  4KAS A;  3FKI C;  2A68 A;  3PO3 C;  3JST A;  1DD5 A;  4A3M K;  1KQ4 A;  1TWA A;  2XCR B;  2E2H C;  4WIL A;  3Q3Q A;  3TFH A;  2A6H A;  3ORE A;  2NVT C;  4G7H A;  3AD7 C;  4JK1 A;  1TWH K;  4WJ4 A;  4KMA A;  4G0V A;  4BY1 C;  1WQG A;  4BXX C;  2PHC B;  4KM8 A;  1AB4 A;  2JA8 K;  5M5Y K;  1WQH A;  1XZQ B;  1V5V A;  4LQY A;  3CF5 S;  4G0U A;  1G51 A;  4GFQ A;  3BUE A;  2JA6 K;  1O28 A;  3S15 C;  3GDZ A;  1TWF C;  1ZBS A;  1TWG K;  1JOE A;  4A3F K;  5C4J C;  1O27 A;  3RZD K;  1ZVU A;  2ZJP S;  4KMD A;  3M4O K;  5TMC A;  2P8T A;  4GTA A;  3S2H C;  3L4J A;  2NVX C;  1TWC K;  4XSX A;  3FHZ A;  2WB1 L;  5JVH S;  1WCM A;  4BBS C;  1TWA K;  1WCM K;  5C4J K;  1XZP A;  3I4N K;  4P9S A;  1K83 A;  1TWF K;  3S15 K;  1B4B A;  2R7Z K;  1WSV A;  2WAQ L;  4A3B K;  3FOF A;  4A3D K;  3T02 A;  3I4M C;  3H3V D;  1SFO C;  2CFA B;  3HKZ L;  4BXX K;  4A93 K;  3GTJ A;  4C3H C;  4A3L K;  4YFK A;  3GTQ C;  4QIW D;  3TTG A;  5C3E C;  5IP7 C;  3AD8 C;  3HOU K;  4OIR A;  4Q5S A;  3TFJ A;  2E2I A;  2NVY C;  5D4D A;  3PO3 K;  3FKI K;  4KN4 A;  4PAB A;  4PAA A;  4NOI A;  3GTK K;  1PJ7 A;  4ZH4 A;  4C2M C;  5EGH A;  3A8K A;  1Y1W A;  3S0X A;  1I6H C;  3GTL C;  3ERE D;  2W7V A;  3S1M K;  3M3Y C;  1UV7 A;  4A3G C;  4X6A C;  1K83 C;  4BLB A;  1F7V A;  4MQ9 A;  4WFN S;  4GZY A;  1XZP B;  4QIW L;  2R92 C;  3S16 C;  1GE9 A;  5M5W K;  2VUM A;  4BBR C;  2A69 A;  2YU9 C;  4OIQ A;  3H0G K;  2R93 C;  4IOA S;  5JVO A;  3GTO C;  1C0A A;  1BJT A;  1DCP A;  2XCQ A;  4XCH A;  1Y1W C;  1FEU A;  4A3C K;  4XLP A;  3G4C A;  1O29 A;  2KQ1 A;  2ZJQ S;  5M3M K;  4AYB D;  1XXB A;  3GTO A;  2O5J A;  4QJV A;  1F7U A;  3HOZ K;  1BDF A;  3S17 K;  1WIH A;  3GTL A;  2B63 C;  4A3J K;  3HOY C;  4YFN A;  1J98 A;  4BLA A;  3N0B A;  4A3E C;  1VLO A;  2R92 A;  2E2J K;  3S14 C;  3G4A A;  3S1N K;  1WOR A;  5L46 A;  3S1Q K;  4MEX A;  2RGR A;  1WOO A;  1IL2 A;  3CQZ A;  3MML B;  4A3K K;  2B63 A;  4BY7 C;  3HOW K;  4Y52 C;  1VJE A;  1WOP A;  5C44 K;  1O2B A;  2PA8 D;  3GTG A;  1VRQ C;  1EH1 A;  2JA7 A;  3PIP S;  2NVY A;  2E2H A;  4GT9 A;  4Y7N C;  2D6F C;  1I3Q C;  1IBA A;  1EI6 A;  1O25 A;  2KPU A;  1IQ0 A;  4C3J K;  5M5X K;  3PIO S;  4QJV B;  1HI9 A;  1L0W A;  4LK1 A;  3S1R C;  1XPP A;  2JA7 K;  2JH3 A;  4ILD A;  4O2D A;  5FJ8 K;  1B4A A;  1USO A; 
#chains in the Genus database with same CATH homology
 4OIP A;  3S2D K;  3HOU K;  2PA8 L;  1I50 K;  4OIR A;  4KN7 A;  4G7O A;  1R9T K;  5C4X K;  2PMZ D;  4Q5S A;  3I4N C;  1WCM C;  2NVY C;  5D4D A;  3CQZ K;  4BBS K;  4LK0 A;  5FLM C;  4A3C C;  1Y1W K;  3PO3 K;  4C3I K;  2O5I A;  4KN4 A;  3FKI K;  2PPB A;  4NOI A;  4LJZ A;  4AYB L;  3GTK K;  4ZH4 A;  4C2M C;  3K7A K;  2NVQ K;  1Y1V K;  3GTO K;  1TWC C;  3GTM C;  2CW0 A;  3HOV K;  1I6H C;  3GTL C;  3GTJ K;  3S2H K;  5C44 C;  3M4O C;  4Y52 K;  4BY7 K;  3RZD C;  3S1M K;  3M3Y C;  5IYC C;  4A3G C;  4OIO A;  3HOX K;  5IYD C;  4X6A C;  1K83 C;  3GTP C;  2E2I K;  3S1Q C;  1TWG C;  3S16 K;  4MQ9 A;  4QIW L;  4GZY A;  5IP9 C;  2R92 C;  3H3V L;  3S14 K;  2E2J C;  3S16 C;  4YG2 A;  5M5W K;  1K83 K;  3GTP K;  4X6A K;  4BBR C;  3HOX C;  4A3E K;  1HQM A;  2E2I C;  2A69 A;  2YU9 C;  5IYC K;  3M3Y K;  4A3G K;  4OIQ A;  4A3J C;  2A6E A;  3GTJ C;  2JA8 C;  3HOV C;  3H0G K;  3GTM K;  2R93 C;  4BY1 K;  1Y1V C;  3GTO C;  3K7A C;  2VUM K;  4C2M K;  3GTG C;  3GTK C;  3S17 C;  1TWH C;  3FKI C;  3HOZ C;  2A68 A;  3PO2 C;  1Y1W C;  3PO3 C;  4A3C K;  2NVT K;  4XLP A;  4A3M K;  2E2H C;  2BE5 A;  2E2H K;  5M3M K;  4A3M C;  5C4X C;  4AYB D;  1R9T C;  3DXJ A;  2A6H A;  1I50 C;  2NVT C;  3HOU C;  4LLG A;  3S2D C;  2O5J A;  4G7H A;  5IYB K;  4QJV A;  3HOZ K;  3PO2 K;  4JK1 A;  1TWH K;  2Y0S L;  3RZO K;  1BDF A;  1I6V A;  3S17 K;  3GTG K;  4A3I K;  4BY1 C;  2VUM C;  4C3H K;  2WAQ D;  2R93 K;  4BXX C;  3H0G C;  2JA8 K;  5M5Y K;  5M3F K;  1SFO K;  4G7Z A;  5IYD K;  2B63 C;  4A3J K;  3HOY C;  2YU9 K;  4YFN A;  4A3E C;  4BBR K;  4C3J C;  1YNN A;  4XLN A;  2E2J K;  2JA6 K;  3S14 C;  2R7Z C;  3S15 C;  2R92 K;  5IP9 K;  3S1N K;  1TWF C;  2WB1 D;  1TWG K;  3S1Q K;  4A3F K;  5C4J C;  4MEX A;  1TWA C;  4Y7N K;  1YNJ A;  3S1M C;  4YFX A;  4A3K K;  3RZD K;  4BY7 C;  3HOW K;  4XSZ A;  4Y52 C;  5TMC A;  5C44 K;  2JA5 K;  3S2H C;  3GTL K;  3M4O K;  2NVX C;  2PA8 D;  1I6H K;  1TWC K;  1IW7 A;  4Q4Z A;  3EQL A;  4XSX A;  2NVQ C;  2PMZ L;  2WB1 L;  4C3I C;  2NVX K;  2JA5 C;  3HOW C;  5FLM K;  4A3K C;  4BBS C;  5TMF A;  1ZYR A;  4Y7N C;  3CQZ C;  4KMU A;  1TWA K;  4A3F C;  3HKZ D;  1WCM K;  2NVY K;  5C4J K;  3I4N K;  2Y0S D;  1TWF K;  1SMY A;  3S1N C;  3S15 K;  2R7Z K;  2JA6 C;  2WAQ L;  4A3B K;  1I3Q C;  5IP7 K;  4A3D K;  4C3J K;  5C3E K;  5M5X K;  4QJV B;  3I4M C;  3GTQ K;  4A3L C;  3H3V D;  2JA7 C;  3HOY K;  4A93 C;  4MEY A;  4LK1 A;  2B63 K;  1SFO C;  3S1R C;  3S1R K;  1XPP A;  4OIN A;  3HKZ L;  4BXX K;  4A93 K;  4C3H C;  4A3I C;  2JA7 K;  4A3L K;  4YFK A;  3GTQ C;  3I4M K;  4QIW D;  5FJ8 K;  3WOD A;  3RZO C;  5C3E C;  4A3D C;  5IP7 C;  1I3Q K;  5IYB C;  4A3B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...