5D4DA

Crystal structure of thermus thermophilus product complex for transcription initiation with nad and ctp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
229
structure length
229
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title The mechanism of RNA 5' capping with NAD(+), NADH and desphospho-CoA.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb27 / atcc baa-163 / dsm 7039)
total genus 52
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5d4dA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5d4dA01
4QIWL 5C3EC 2A68A 2WB1D 3S1QC 3H0GK 3S2HC 3EQLA 3S14C 4A3IK 3GTPK 3PO2K 3S15C 1TWAC 2JA8C 4BXXK 4A3MC 4BY7C 4OIOA 3GTGK 3S17C 1I50K 2Y0SD 2NVQC 4OINA 4LJZA 4A93K 1I6HC 1R9TK 1ZYRA 3GTKK 1SFOC 5C44C 3M3YC 2CW0A 4BBSK 2YU9C 3RZOK 3K7AK 4C3JK 4YFXA 4YFKA 4OIRA 3H3VL 2PMZL 4LLGA 2VUMK 3HOXC 1YNNA 1TWFK 3S1NC 4Y7NK 5C4JC 4A3CC 1Y1VK 4A3GK 1I3QK 4X6AC 4BXXC 2NVYK 4C3IK 1K83C 4A3KK 3GTMK 3S2DK 5IYCK 1XPPA 3H0GC 2JA7K 4A3IC 3GTPC 3PO2C 4A3FK 1TWGK 2BE5A 2JA6K 4A3DK 4QJVB 2NVXK 3HKZD 2O5JA 2R93K 3GTGC 1I50C 4MQ9A 4Y52K 4A93C 3GTOK 3GTKC 3GTJK 3RZDK 4A3JK 5IP9K 4BBSC 4AYBD 1BDFA 5M5YK 5FJ8K 3RZOC 3K7AC 4C3JC 3HOVK 3I4MK 4C2MK 5TMFA 2VUMC 4Q5SA 2B63K 2R7ZK 2PA8D 1TWFC 3DXJA 5M3FK 4Y7NC 4OIQA 2E2IC 4A3GC 4A3BK 1Y1VC 1I3QC 2R92K 2NVYC 4C3IC 4A3KC 3GTMC 2JA5K 3S1MK 4G7HA 4C3HK 3S2DC 5IYCC 1TWCK 2JA7C 3CQZK 5C4XK 4NOIA 4KN4A 1TWGC 4KN7A 4A3FC 2JA6C 4GZYA 4A3DC 2WAQL 5IYBK 4QIWD 2A6HA 2NVXC 4Q4ZA 4XLPA 2R93C 2NVTK 3S16K 4Y52C 2WB1L 3PO3K 1I6VA 3GTOC 1WCMK 5M5XK 5M3MK 3RZDC 4A3JC 5IP9C 2E2HK 5M5WK 3HOZK 4ZH4A 4G7OA 3HOVC 1IW7A 3I4MC 1R9TC 4C2MC 2B63C 5FLMK 4YG2A 2R7ZC 2A6EA 3S1RK 2Y0SL 3GTQK 3HOUK 3HOYK 4KMUA 4A3BC 4BBRK 2R92C 2JA5C 3S1MC 3H3VD 1Y1WK 4MEYA 2PMZD 2E2JK 4C3HC 3HOWK 3FKIK 1TWCC 4G7ZA 3CQZC 4LK1A 3GTJC 5C4XC 4JK1A 1SMYA 5IYBC 4A3EC 3M4OK 4XSXA 5IP7K 5TMCA 3GTLK 4OIPA 4MEXA 2NVTC 4A3EK 3I4NK 3S16C 3WODA 3PO3C 4BY1K 1WCMC 4YFNA 1TWHK 4A3LK 5IYDK 2E2HC 3HOZC 5C3EK 3S1QK 3HKZL 3S2HK 3S14K 5FLMC 3S1RC 3GTQC 3HOUC 3S15K 3HOYC 4XSZA 1TWAK 4BBRC 4LK0A 2O5IA 2JA8K 4A3MK 1Y1WC 2E2JC 3HOWC 4AYBL 3S17K 4BY7K 3FKIC 2NVQK 1I6HK 3M4OC 1SFOK 5C44K 2PA8L 1HQMA 3M3YK 4XLNA 5IP7C 3GTLC 2E2IK 2YU9K 4QJVA 3I4NC 5D4DA 2WAQD 3HOXK 2PPBA 4BY1C 3S1NK 5C4JK 4A3CK 1TWHC 4A3LC 5IYDC 2A69A 4X6AK 1K83K 1YNJA
chains in the Genus database with same CATH superfamily
4QIWL 1XZPA 3EQLA 3S14C 3GTPK 1Y1WA 4XCHA 3FKIA 4DDQA 4OIOA 4LJZA 4KARA 3T01A 4IO9S 3AD8C 4C3JK 4YFXA 1TWHA 4OIRA 2CFAB 2PMZL 1YNNA 5CHPA 4Y7NK 4A3CC 1Y1VK 4X6AC 2NVYK 3TTGA 3GTMK 1K83C 1XPPA 2Y3PA 3OEPA 3GTPC 4A3FK 2BE5A 2JA6K 4MQ9A 2ZJQS 3GSIA 4AYBD 1IE0A 4C3JC 1FEUA 1B4AA 5TMFA 2B63K 5L46A 4Y7NC 4OIQA 2E2IC 3H0GA 4LQYA 1Y1VC 1BS2A 4KMHA 2R92K 2NVYC 3GTMC 1O27A 3L4KA 4C3HK 1TWCK 3GIRA 4A3FC 1I50A 3LAPA 3GTJK 2JA6C 4QIWD 1TWAA 4XLPA 3GTKA 1JOEA 1I6VA 1WCMK 4GTEA 4WFBS 2YU9A 1C0AA 2PHCB 4KDDA 2B63C 3GTQK 4YG2A 2A6EA 5TJ3A 1GE9A 4KASA 4KMUA 4BBRK 2XCOA 2R92C 1ISEA 4MEYA 2PMZD 4C3HC 4C45A 1TWCC 3M4OK 3GTJC 4JK1A 2ZUFA 3GTLK 1IQ0A 3A8JA 1J98A 2GAGC 3ERED 2GSNA 2V6TA 1WCMC 4YFNA 5IYDK 3N0BA 3S2HK 3GTQC 1RU0A 3QX3A 4BBRC 2O5IA 2JA8K 4A3MK 4BY7K 4RMFA 3SZZA 2NVQK 1JQWA 1I6HK 1PJ5A 3M4OC 4KC6A 1SFOK 3GTLC 2NVXA 1O25A 3S1NK 3A8IA 3GTOA 5C4JK 3MMLB 5IYDC 4BXXK 3S2HC 3S0XA 5EGEA 1YX2A 1F9NA 5JVOA 2JA8C 4A3MC 4BY7C 3GTGK 2NVQC 1I6HC 1IS1A 4IOAS 1R9TK 1SFOC 1O2AA 1WORA 3VA7A 1VLOA 3OPFA 2RGRA 5JVHS 3S1NC 1TWFK 5C4JC 4BXXC 4KATA 3S2DK 2KXYA 4KB2A 3SZYA 4FM9A 4A3DK 4QJVB 2O5JA 2R93K 3GTGC 2P8TA 3AQOA 5IP9K 5M5YK 4KM8A 2XCRB 4GTAA 3I4MK 2ZJPS 2R7ZK 3T00A 1TWFC 2JA5K 3GTPA 1BJTA 3S2DC 2D6FC 2V6UA 2WAQL 4FZBA 4KN7A 4A3DC 5IYBK 4U67S 3LPXA 2JH3A 2R93C 5JVGS 5M3MK 5IP9C 5M5WK 4ZH4A 4G7OA 2E2IA 3I4MC 1Y1VA 3GTMA 2R7ZC 3HOUK 2Y0SL 2JA5C 2JA6A 3T02A 3GEEA 3DLLS 2W7VA 1WQGA 4BKWA 5HL8A 5IYBC 2RH6A 1O24A 4XSXA 5IORA 5TMCA 1WOSA 4OIPA 4MEXA 3I4NK 3Q3QA 4O2DA 4A3LK 2B63A 4P5BA 4BLBA 1VH2A 2R92A 3CAGA 3HOUC 1WIHA 1TWCA 2ZFZA 1TWAK 4BLAA 1I3QA 3PIOS 3GTJA 4G0UA 3S17K 1YCLA 3AQPA 2JA7A 5C44K 1BGWA 1HQMA 2PA8L 4ILDA 4KAWX 4WILA 4XLNA 2ZUEA 2YU9K 1WCMA 4QJVA 3I4NC 5D4DA 2WAQD 4WJ4A 1WOOA 4A3LC 3GTQA 2A69A 3G4AA 4A3IK 3BUEA 1XZQB 1DD5A 1TWAC 3S17C 4M1XA 2Y0SD 4P5AA 2CFAA 1EQRA 1J6VA 5C44C 2CW0A 2L3UA 1V5VA 3CF5S 2YU9C 1O2BA 4GTBA 3RZOK 3H3VL 2VUMK 1DCPA 4A3IC 1TWGK 4GTLA 4AH6A 2NVXK 1JVIA 1SFOA 4G0WA 4Y52K 3GTOK 4WCES 3AH5A 4A3JK 3NUHA 1BDFA 1DCOA 4GTCA 3AD7C 3RZOC 2KWAA 3HOVK 3V4GA 4Q5SA 2VUMC 2PA8D 4A3BK 2XCQA 2V6SA 1IL2A 3S1MK 4G7HA 5HQHA 3GEHA 5C4XK 3CQZK 4KN4A 1TWGC 4GZYA 3GTGA 4WJ3M 2NVXC 2A6HA 4Q4ZA 1USOA 4P9SA 2NVTK 3ADAC 3S16K 4Y52C 2WB1L 3GTOC 5M5XK 1ZBSA 2E2HK 4A3JC 1EI6A 3HOZK 1TWFA 3L4JA 3HOVC 1IW7A 1R9TC 3S1RK 3GDZA 3HOYK 4A3BC 2ZJRS 4WF9S 3S1MC 3H3VD 1Y1WK 1K83A 2E2JK 3FKIK 4WFNS 1VGXA 5C4XC 3CQZC 4LK1A 2R93A 1SMYA 5IP7K 4J3NA 2NVTC 1XZQA 3S16C 3WODA 1O26A 2GSUA 5IOSA 1TWHK 2E2HC 2R7ZA 1O29A 3HOZC 3TFHA 5C3EK 3S1QK 3HKZL 3S1RC 2JA5A 1WSRA 3JSTA 3S15K 3HOYC 4XSZA 1UV7A 1XXAA 4LK0A 2KQ1A 2NVYA 1Y1WC 2KPUA 2E2JC 3FKIC 3M3YK 3AD9C 1HI9A 5IP7C 1VJEA 2EBBA 2E2IK 3HOXK 2PPBA 3N0CA 4KMAA 1DCHA 1TWHC 5IOQA 1YNJA 5C3EC 2A68A 2WB1D 3S1QC 1J6XA 3A8KA 3H0GK 1WQFA 1F7UA 1EFWA 3PO2K 1PJ6A 3S15C 1EK8A 4PABA 4GFQA 1INNA 1I50K 1ZQ1C 4OINA 4A93K 5IOTA 3GTKK 1ZYRA 2FQTA 3M3YC 4BBSK 4KB4A 3K7AK 4YFKA 5HL7S 4LLGA 3HOXC 4A3GK 1I3QK 3HXAA 4C3IK 4A3KK 1O28A 5IYCK 3H0GC 1XXBA 2JA7K 1WOPA 3PO2C 1L0WA 5JFEA 4GTFA 1ZVUA 1IBAA 1X31C 5DM6S 3HKZD 1XXCA 1I50C 4A93C 1B4BA 3GTKC 3RZDK 1XZPB 4BBSC 3OREA 3GTLA 5FJ8K 3K7AC 4C2MK 3DXJA 5M3FK 1ZXOA 3LYWA 3FHZA 4A3GC 1I3QC 4C3IC 1G51A 4A3KC 1EH1A 5IYCC 1AB4A 4GTDA 2JA7C 4NOIA 4A3EK 4IOCS 4PAAA 1J6WA 3BP8C 3BP3A 3PO3K 2P5MA 4LOWA 4LR2A 2VUMA 3RZDC 3LAJA 4C2MC 5FLMK 4GT9A 1KQ4A 2FQOA 1TWGA 3HOWK 1WQHA 3GEIA 4G7ZA 2GAHC 2GSOA 5DM7S 4A3EC 2L5NA 3TFJA 3PO3C 4BY1K 4KM9A 1F93A 1R9TA 4G0VA 3PIPS 5CJ9A 4KMDA 3G4CA 3S14K 5FLMC 3TFIA 3FOFA 1WSVA 4WFAS 3CQZA 3N3YA 3HOWC 4AYBL 1USMA 1F7VA 5E68A 3IPJA 1PJ7A 5EGHA 2E2HA 4BY1C 4A3CK 4X6AK 1VRQC 1K83K 1O2FB 3FOEA
chains in the Genus database with same CATH topology
4QIWL 5C3EC 2A68A 2WB1D 3S1QC 3H0GK 3S2HC 3EQLA 3S14C 4A3IK 3GTPK 3PO2K 3S15C 1TWAC 2JA8C 4BXXK 4A3MC 4BY7C 4OIOA 3GTGK 3S17C 1I50K 2Y0SD 2NVQC 4OINA 4LJZA 4A93K 1I6HC 1R9TK 1ZYRA 3GTKK 1SFOC 5C44C 3M3YC 2CW0A 4BBSK 2YU9C 3RZOK 3K7AK 4C3JK 4YFXA 4YFKA 4OIRA 3H3VL 2PMZL 4LLGA 2VUMK 3HOXC 1YNNA 1TWFK 3S1NC 4Y7NK 5C4JC 4A3CC 1Y1VK 4A3GK 1I3QK 4X6AC 4BXXC 2NVYK 4C3IK 1K83C 4A3KK 3GTMK 3S2DK 5IYCK 1XPPA 3H0GC 2JA7K 4A3IC 3GTPC 3PO2C 4A3FK 1TWGK 2BE5A 2JA6K 4A3DK 4QJVB 2NVXK 3HKZD 2O5JA 2R93K 3GTGC 1I50C 4MQ9A 4Y52K 4A93C 3GTOK 3GTKC 3GTJK 3RZDK 4A3JK 5IP9K 4BBSC 4AYBD 1BDFA 5M5YK 5FJ8K 3RZOC 3K7AC 4C3JC 3HOVK 3I4MK 4C2MK 5TMFA 2VUMC 4Q5SA 2B63K 2R7ZK 2PA8D 1TWFC 3DXJA 5M3FK 4Y7NC 4OIQA 2E2IC 4A3GC 4A3BK 1Y1VC 1I3QC 2R92K 2NVYC 4C3IC 4A3KC 3GTMC 2JA5K 3S1MK 4G7HA 4C3HK 3S2DC 5IYCC 1TWCK 2JA7C 3CQZK 5C4XK 4NOIA 4KN4A 1TWGC 4KN7A 4A3FC 2JA6C 4GZYA 4A3DC 2WAQL 5IYBK 4QIWD 2A6HA 2NVXC 4Q4ZA 4XLPA 2R93C 2NVTK 3S16K 4Y52C 2WB1L 3PO3K 1I6VA 3GTOC 1WCMK 5M5XK 5M3MK 3RZDC 4A3JC 5IP9C 2E2HK 5M5WK 3HOZK 4ZH4A 4G7OA 3HOVC 1IW7A 3I4MC 1R9TC 4C2MC 2B63C 5FLMK 4YG2A 2R7ZC 2A6EA 3S1RK 2Y0SL 3GTQK 3HOUK 3HOYK 4KMUA 4A3BC 4BBRK 2R92C 2JA5C 3S1MC 3H3VD 1Y1WK 4MEYA 2PMZD 2E2JK 4C3HC 3HOWK 3FKIK 1TWCC 4G7ZA 3CQZC 4LK1A 3GTJC 5C4XC 4JK1A 1SMYA 5IYBC 4A3EC 3M4OK 4XSXA 5IP7K 5TMCA 3GTLK 4OIPA 4MEXA 2NVTC 4A3EK 3I4NK 3S16C 3WODA 3PO3C 4BY1K 1WCMC 4YFNA 1TWHK 4A3LK 5IYDK 2E2HC 3HOZC 5C3EK 3S1QK 3HKZL 3S2HK 3S14K 5FLMC 3S1RC 3GTQC 3HOUC 3S15K 3HOYC 4XSZA 1TWAK 4BBRC 4LK0A 2O5IA 2JA8K 4A3MK 1Y1WC 2E2JC 3HOWC 4AYBL 3S17K 4BY7K 3FKIC 2NVQK 1I6HK 3M4OC 1SFOK 5C44K 2PA8L 1HQMA 3M3YK 4XLNA 5IP7C 3GTLC 2E2IK 2YU9K 4QJVA 3I4NC 5D4DA 2WAQD 3HOXK 2PPBA 4BY1C 3S1NK 5C4JK 4A3CK 1TWHC 4A3LC 5IYDC 2A69A 4X6AK 1K83K 1YNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW L;  5C3E C;  2A68 A;  2WB1 D;  3S1Q C;  3H0G K;  3S2H C;  3EQL A;  3S14 C;  4A3I K;  3GTP K;  3PO2 K;  3S15 C;  1TWA C;  2JA8 C;  4BXX K;  4A3M C;  4BY7 C;  4OIO A;  3GTG K;  3S17 C;  1I50 K;  2Y0S D;  2NVQ C;  4OIN A;  4LJZ A;  4A93 K;  1I6H C;  1R9T K;  1ZYR A;  3GTK K;  1SFO C;  5C44 C;  3M3Y C;  2CW0 A;  4BBS K;  2YU9 C;  3RZO K;  3K7A K;  4C3J K;  4YFX A;  4YFK A;  4OIR A;  3H3V L;  2PMZ L;  4LLG A;  2VUM K;  3HOX C;  1YNN A;  1TWF K;  3S1N C;  4Y7N K;  5C4J C;  4A3C C;  1Y1V K;  4A3G K;  1I3Q K;  4X6A C;  4BXX C;  2NVY K;  4C3I K;  1K83 C;  4A3K K;  3GTM K;  3S2D K;  5IYC K;  1XPP A;  3H0G C;  2JA7 K;  4A3I C;  3GTP C;  3PO2 C;  4A3F K;  1TWG K;  2BE5 A;  2JA6 K;  4A3D K;  4QJV B;  2NVX K;  3HKZ D;  2O5J A;  2R93 K;  3GTG C;  1I50 C;  4MQ9 A;  4Y52 K;  4A93 C;  3GTO K;  3GTK C;  3GTJ K;  3RZD K;  4A3J K;  5IP9 K;  4BBS C;  4AYB D;  1BDF A;  5M5Y K;  5FJ8 K;  3RZO C;  3K7A C;  4C3J C;  3HOV K;  3I4M K;  4C2M K;  5TMF A;  2VUM C;  4Q5S A;  2B63 K;  2R7Z K;  2PA8 D;  1TWF C;  3DXJ A;  5M3F K;  4Y7N C;  4OIQ A;  2E2I C;  4A3G C;  4A3B K;  1Y1V C;  1I3Q C;  2R92 K;  2NVY C;  4C3I C;  4A3K C;  3GTM C;  2JA5 K;  3S1M K;  4G7H A;  4C3H K;  3S2D C;  5IYC C;  1TWC K;  2JA7 C;  3CQZ K;  5C4X K;  4NOI A;  4KN4 A;  1TWG C;  4KN7 A;  4A3F C;  2JA6 C;  4GZY A;  4A3D C;  2WAQ L;  5IYB K;  4QIW D;  2A6H A;  2NVX C;  4Q4Z A;  4XLP A;  2R93 C;  2NVT K;  3S16 K;  4Y52 C;  2WB1 L;  3PO3 K;  1I6V A;  3GTO C;  1WCM K;  5M5X K;  5M3M K;  3RZD C;  4A3J C;  5IP9 C;  2E2H K;  5M5W K;  3HOZ K;  4ZH4 A;  4G7O A;  3HOV C;  1IW7 A;  3I4M C;  1R9T C;  4C2M C;  2B63 C;  5FLM K;  4YG2 A;  2R7Z C;  2A6E A;  3S1R K;  2Y0S L;  3GTQ K;  3HOU K;  3HOY K;  4KMU A;  4A3B C;  4BBR K;  2R92 C;  2JA5 C;  3S1M C;  3H3V D;  1Y1W K;  4MEY A;  2PMZ D;  2E2J K;  4C3H C;  3HOW K;  3FKI K;  1TWC C;  4G7Z A;  3CQZ C;  4LK1 A;  3GTJ C;  5C4X C;  4JK1 A;  1SMY A;  5IYB C;  4A3E C;  3M4O K;  4XSX A;  5IP7 K;  5TMC A;  3GTL K;  4OIP A;  4MEX A;  2NVT C;  4A3E K;  3I4N K;  3S16 C;  3WOD A;  3PO3 C;  4BY1 K;  1WCM C;  4YFN A;  1TWH K;  4A3L K;  5IYD K;  2E2H C;  3HOZ C;  5C3E K;  3S1Q K;  3HKZ L;  3S2H K;  3S14 K;  5FLM C;  3S1R C;  3GTQ C;  3HOU C;  3S15 K;  3HOY C;  4XSZ A;  1TWA K;  4BBR C;  4LK0 A;  2O5I A;  2JA8 K;  4A3M K;  1Y1W C;  2E2J C;  3HOW C;  4AYB L;  3S17 K;  4BY7 K;  3FKI C;  2NVQ K;  1I6H K;  3M4O C;  1SFO K;  5C44 K;  2PA8 L;  1HQM A;  3M3Y K;  4XLN A;  5IP7 C;  3GTL C;  2E2I K;  2YU9 K;  4QJV A;  3I4N C;  5D4D A;  2WAQ D;  3HOX K;  2PPB A;  4BY1 C;  3S1N K;  5C4J K;  4A3C K;  1TWH C;  4A3L C;  5IYD C;  2A69 A;  4X6A K;  1K83 K;  1YNJ A; 
#chains in the Genus database with same CATH topology
 4QIW L;  1XZP A;  3EQL A;  3S14 C;  3GTP K;  1Y1W A;  4XCH A;  3FKI A;  4DDQ A;  4OIO A;  4LJZ A;  4KAR A;  3T01 A;  4IO9 S;  3AD8 C;  4C3J K;  4YFX A;  1TWH A;  4OIR A;  2CFA B;  2PMZ L;  1YNN A;  5CHP A;  4Y7N K;  4A3C C;  1Y1V K;  4X6A C;  2NVY K;  3TTG A;  3GTM K;  1K83 C;  1XPP A;  2Y3P A;  3OEP A;  3GTP C;  4A3F K;  2BE5 A;  2JA6 K;  4MQ9 A;  2ZJQ S;  3GSI A;  4AYB D;  1IE0 A;  4C3J C;  1FEU A;  1B4A A;  5TMF A;  2B63 K;  5L46 A;  4Y7N C;  4OIQ A;  2E2I C;  3H0G A;  4LQY A;  1Y1V C;  1BS2 A;  4KMH A;  2R92 K;  2NVY C;  3GTM C;  1O27 A;  3L4K A;  4C3H K;  1TWC K;  3GIR A;  4A3F C;  1I50 A;  3LAP A;  3GTJ K;  2JA6 C;  4QIW D;  1TWA A;  4XLP A;  3GTK A;  1JOE A;  1I6V A;  1WCM K;  4GTE A;  4WFB S;  2YU9 A;  1C0A A;  2PHC B;  4KDD A;  2B63 C;  3GTQ K;  4YG2 A;  2A6E A;  5TJ3 A;  1GE9 A;  4KAS A;  4KMU A;  4BBR K;  2XCO A;  2R92 C;  1ISE A;  4MEY A;  2PMZ D;  4C3H C;  4C45 A;  1TWC C;  3M4O K;  3GTJ C;  4JK1 A;  2ZUF A;  3GTL K;  1IQ0 A;  3A8J A;  1J98 A;  2GAG C;  3ERE D;  2GSN A;  2V6T A;  1WCM C;  4YFN A;  5IYD K;  3N0B A;  3S2H K;  3GTQ C;  1RU0 A;  3QX3 A;  4BBR C;  2O5I A;  2JA8 K;  4A3M K;  4BY7 K;  4RMF A;  3SZZ A;  2NVQ K;  1JQW A;  1I6H K;  1PJ5 A;  3M4O C;  4KC6 A;  1SFO K;  3GTL C;  2NVX A;  1O25 A;  3S1N K;  3A8I A;  3GTO A;  5C4J K;  3MML B;  5IYD C;  4BXX K;  3S2H C;  3S0X A;  5EGE A;  1YX2 A;  1F9N A;  5JVO A;  2JA8 C;  4A3M C;  4BY7 C;  3GTG K;  2NVQ C;  1I6H C;  1IS1 A;  4IOA S;  1R9T K;  1SFO C;  1O2A A;  1WOR A;  3VA7 A;  1VLO A;  3OPF A;  2RGR A;  5JVH S;  3S1N C;  1TWF K;  5C4J C;  4BXX C;  4KAT A;  3S2D K;  2KXY A;  4KB2 A;  3SZY A;  4FM9 A;  4A3D K;  4QJV B;  2O5J A;  2R93 K;  3GTG C;  2P8T A;  3AQO A;  5IP9 K;  5M5Y K;  4KM8 A;  2XCR B;  4GTA A;  3I4M K;  2ZJP S;  2R7Z K;  3T00 A;  1TWF C;  2JA5 K;  3GTP A;  1BJT A;  3S2D C;  2D6F C;  2V6U A;  2WAQ L;  4FZB A;  4KN7 A;  4A3D C;  5IYB K;  4U67 S;  3LPX A;  2JH3 A;  2R93 C;  5JVG S;  5M3M K;  5IP9 C;  5M5W K;  4ZH4 A;  4G7O A;  2E2I A;  3I4M C;  1Y1V A;  3GTM A;  2R7Z C;  3HOU K;  2Y0S L;  2JA5 C;  2JA6 A;  3T02 A;  3GEE A;  3DLL S;  2W7V A;  1WQG A;  4BKW A;  5HL8 A;  5IYB C;  2RH6 A;  1O24 A;  4XSX A;  5IOR A;  5TMC A;  1WOS A;  4OIP A;  4MEX A;  3I4N K;  3Q3Q A;  4O2D A;  4A3L K;  2B63 A;  4P5B A;  4BLB A;  1VH2 A;  2R92 A;  3CAG A;  3HOU C;  1WIH A;  1TWC A;  2ZFZ A;  1TWA K;  4BLA A;  1I3Q A;  3PIO S;  3GTJ A;  4G0U A;  3S17 K;  1YCL A;  3AQP A;  2JA7 A;  5C44 K;  1BGW A;  1HQM A;  2PA8 L;  4ILD A;  4KAW X;  4WIL A;  4XLN A;  2ZUE A;  2YU9 K;  1WCM A;  4QJV A;  3I4N C;  5D4D A;  2WAQ D;  4WJ4 A;  1WOO A;  4A3L C;  3GTQ A;  2A69 A;  3G4A A;  4A3I K;  3BUE A;  1XZQ B;  1DD5 A;  1TWA C;  3S17 C;  4M1X A;  2Y0S D;  4P5A A;  2CFA A;  1EQR A;  1J6V A;  5C44 C;  2CW0 A;  2L3U A;  1V5V A;  3CF5 S;  2YU9 C;  1O2B A;  4GTB A;  3RZO K;  3H3V L;  2VUM K;  1DCP A;  4A3I C;  1TWG K;  4GTL A;  4AH6 A;  2NVX K;  1JVI A;  1SFO A;  4G0W A;  4Y52 K;  3GTO K;  4WCE S;  3AH5 A;  4A3J K;  3NUH A;  1BDF A;  1DCO A;  4GTC A;  3AD7 C;  3RZO C;  2KWA A;  3HOV K;  3V4G A;  4Q5S A;  2VUM C;  2PA8 D;  4A3B K;  2XCQ A;  2V6S A;  1IL2 A;  3S1M K;  4G7H A;  5HQH A;  3GEH A;  5C4X K;  3CQZ K;  4KN4 A;  1TWG C;  4GZY A;  3GTG A;  4WJ3 M;  2NVX C;  2A6H A;  4Q4Z A;  1USO A;  4P9S A;  2NVT K;  3ADA C;  3S16 K;  4Y52 C;  2WB1 L;  3GTO C;  5M5X K;  1ZBS A;  2E2H K;  4A3J C;  1EI6 A;  3HOZ K;  1TWF A;  3L4J A;  3HOV C;  1IW7 A;  1R9T C;  3S1R K;  3GDZ A;  3HOY K;  4A3B C;  2ZJR S;  4WF9 S;  3S1M C;  3H3V D;  1Y1W K;  1K83 A;  2E2J K;  3FKI K;  4WFN S;  1VGX A;  5C4X C;  3CQZ C;  4LK1 A;  2R93 A;  1SMY A;  5IP7 K;  4J3N A;  2NVT C;  1XZQ A;  3S16 C;  3WOD A;  1O26 A;  2GSU A;  5IOS A;  1TWH K;  2E2H C;  2R7Z A;  1O29 A;  3HOZ C;  3TFH A;  5C3E K;  3S1Q K;  3HKZ L;  3S1R C;  2JA5 A;  1WSR A;  3JST A;  3S15 K;  3HOY C;  4XSZ A;  1UV7 A;  1XXA A;  4LK0 A;  2KQ1 A;  2NVY A;  1Y1W C;  2KPU A;  2E2J C;  3FKI C;  3M3Y K;  3AD9 C;  1HI9 A;  5IP7 C;  1VJE A;  2EBB A;  2E2I K;  3HOX K;  2PPB A;  3N0C A;  4KMA A;  1DCH A;  1TWH C;  5IOQ A;  1YNJ A;  5C3E C;  2A68 A;  2WB1 D;  3S1Q C;  1J6X A;  3A8K A;  3H0G K;  1WQF A;  1F7U A;  1EFW A;  3PO2 K;  1PJ6 A;  3S15 C;  1EK8 A;  4PAB A;  4GFQ A;  1INN A;  1I50 K;  1ZQ1 C;  4OIN A;  4A93 K;  5IOT A;  3GTK K;  1ZYR A;  2FQT A;  3M3Y C;  4BBS K;  4KB4 A;  3K7A K;  4YFK A;  5HL7 S;  4LLG A;  3HOX C;  4A3G K;  1I3Q K;  3HXA A;  4C3I K;  4A3K K;  1O28 A;  5IYC K;  3H0G C;  1XXB A;  2JA7 K;  1WOP A;  3PO2 C;  1L0W A;  5JFE A;  4GTF A;  1ZVU A;  1IBA A;  1X31 C;  5DM6 S;  3HKZ D;  1XXC A;  1I50 C;  4A93 C;  1B4B A;  3GTK C;  3RZD K;  1XZP B;  4BBS C;  3ORE A;  3GTL A;  5FJ8 K;  3K7A C;  4C2M K;  3DXJ A;  5M3F K;  1ZXO A;  3LYW A;  3FHZ A;  4A3G C;  1I3Q C;  4C3I C;  1G51 A;  4A3K C;  1EH1 A;  5IYC C;  1AB4 A;  4GTD A;  2JA7 C;  4NOI A;  4A3E K;  4IOC S;  4PAA A;  1J6W A;  3BP8 C;  3BP3 A;  3PO3 K;  2P5M A;  4LOW A;  4LR2 A;  2VUM A;  3RZD C;  3LAJ A;  4C2M C;  5FLM K;  4GT9 A;  1KQ4 A;  2FQO A;  1TWG A;  3HOW K;  1WQH A;  3GEI A;  4G7Z A;  2GAH C;  2GSO A;  5DM7 S;  4A3E C;  2L5N A;  3TFJ A;  3PO3 C;  4BY1 K;  4KM9 A;  1F93 A;  1R9T A;  4G0V A;  3PIP S;  5CJ9 A;  4KMD A;  3G4C A;  3S14 K;  5FLM C;  3TFI A;  3FOF A;  1WSV A;  4WFA S;  3CQZ A;  3N3Y A;  3HOW C;  4AYB L;  1USM A;  1F7V A;  5E68 A;  3IPJ A;  1PJ7 A;  5EGH A;  2E2H A;  4BY1 C;  4A3C K;  4X6A K;  1VRQ C;  1K83 K;  1O2F B;  3FOE A; 
#chains in the Genus database with same CATH homology
 4QIW L;  5C3E C;  2A68 A;  2WB1 D;  3S1Q C;  3H0G K;  3S2H C;  3EQL A;  3S14 C;  4A3I K;  3GTP K;  3PO2 K;  3S15 C;  1TWA C;  2JA8 C;  4BXX K;  4A3M C;  4BY7 C;  4OIO A;  3GTG K;  3S17 C;  1I50 K;  2Y0S D;  2NVQ C;  4OIN A;  4LJZ A;  4A93 K;  1I6H C;  1R9T K;  1ZYR A;  3GTK K;  1SFO C;  5C44 C;  3M3Y C;  2CW0 A;  4BBS K;  2YU9 C;  3RZO K;  3K7A K;  4C3J K;  4YFX A;  4YFK A;  4OIR A;  3H3V L;  2PMZ L;  4LLG A;  2VUM K;  3HOX C;  1YNN A;  1TWF K;  3S1N C;  4Y7N K;  5C4J C;  4A3C C;  1Y1V K;  4A3G K;  1I3Q K;  4X6A C;  4BXX C;  2NVY K;  4C3I K;  1K83 C;  4A3K K;  3GTM K;  3S2D K;  5IYC K;  1XPP A;  3H0G C;  2JA7 K;  4A3I C;  3GTP C;  3PO2 C;  4A3F K;  1TWG K;  2BE5 A;  2JA6 K;  4A3D K;  4QJV B;  2NVX K;  3HKZ D;  2O5J A;  2R93 K;  3GTG C;  1I50 C;  4MQ9 A;  4Y52 K;  4A93 C;  3GTO K;  3GTK C;  3GTJ K;  3RZD K;  4A3J K;  5IP9 K;  4BBS C;  4AYB D;  1BDF A;  5M5Y K;  5FJ8 K;  3RZO C;  3K7A C;  4C3J C;  3HOV K;  3I4M K;  4C2M K;  5TMF A;  2VUM C;  4Q5S A;  2B63 K;  2R7Z K;  2PA8 D;  1TWF C;  3DXJ A;  5M3F K;  4Y7N C;  4OIQ A;  2E2I C;  4A3G C;  4A3B K;  1Y1V C;  1I3Q C;  2R92 K;  2NVY C;  4C3I C;  4A3K C;  3GTM C;  2JA5 K;  3S1M K;  4G7H A;  4C3H K;  3S2D C;  5IYC C;  1TWC K;  2JA7 C;  3CQZ K;  5C4X K;  4NOI A;  4KN4 A;  1TWG C;  4KN7 A;  4A3F C;  2JA6 C;  4GZY A;  4A3D C;  2WAQ L;  5IYB K;  4QIW D;  2A6H A;  2NVX C;  4Q4Z A;  4XLP A;  2R93 C;  2NVT K;  3S16 K;  4Y52 C;  2WB1 L;  3PO3 K;  1I6V A;  3GTO C;  1WCM K;  5M5X K;  5M3M K;  3RZD C;  4A3J C;  5IP9 C;  2E2H K;  5M5W K;  3HOZ K;  4ZH4 A;  4G7O A;  3HOV C;  1IW7 A;  3I4M C;  1R9T C;  4C2M C;  2B63 C;  5FLM K;  4YG2 A;  2R7Z C;  2A6E A;  3S1R K;  2Y0S L;  3GTQ K;  3HOU K;  3HOY K;  4KMU A;  4A3B C;  4BBR K;  2R92 C;  2JA5 C;  3S1M C;  3H3V D;  1Y1W K;  4MEY A;  2PMZ D;  2E2J K;  4C3H C;  3HOW K;  3FKI K;  1TWC C;  4G7Z A;  3CQZ C;  4LK1 A;  3GTJ C;  5C4X C;  4JK1 A;  1SMY A;  5IYB C;  4A3E C;  3M4O K;  4XSX A;  5IP7 K;  5TMC A;  3GTL K;  4OIP A;  4MEX A;  2NVT C;  4A3E K;  3I4N K;  3S16 C;  3WOD A;  3PO3 C;  4BY1 K;  1WCM C;  4YFN A;  1TWH K;  4A3L K;  5IYD K;  2E2H C;  3HOZ C;  5C3E K;  3S1Q K;  3HKZ L;  3S2H K;  3S14 K;  5FLM C;  3S1R C;  3GTQ C;  3HOU C;  3S15 K;  3HOY C;  4XSZ A;  1TWA K;  4BBR C;  4LK0 A;  2O5I A;  2JA8 K;  4A3M K;  1Y1W C;  2E2J C;  3HOW C;  4AYB L;  3S17 K;  4BY7 K;  3FKI C;  2NVQ K;  1I6H K;  3M4O C;  1SFO K;  5C44 K;  2PA8 L;  1HQM A;  3M3Y K;  4XLN A;  5IP7 C;  3GTL C;  2E2I K;  2YU9 K;  4QJV A;  3I4N C;  5D4D A;  2WAQ D;  3HOX K;  2PPB A;  4BY1 C;  3S1N K;  5C4J K;  4A3C K;  1TWH C;  4A3L C;  5IYD C;  2A69 A;  4X6A K;  1K83 K;  1YNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...