3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
3S2DC 4A93C 1R9TK 2E2IC 5C4JK 2E2JC 4A3KK 1YNJA 3I4NK 5D4DA 3GTPK 1Y1WK 2R7ZC 5TMFA 4BBSC 2B63K 2A6EA 5IYDC 1YNNA 4JK1A 4YG2A 2BE5A 4Q4ZA 2YU9C 1WCMK 4C3HK 4Y52C 2PMZL 4X6AK 1I3QK 3RZOC 2PA8L 3HKZD 1K83K 2JA8K 3PO3C 4BBRK 4C3JC 5C4XK 3HOWK 4BY7K 3GTMK 2PPBA 4OIOA 3HOVC 3GTGC 5IP7K 3DXJA 2R92K 3HOXK 4MEXA 3S14C 4A3BC 4A3JC 4LK1A 1I6HK 3HKZL 5FLMK 3FKIK 2JA7K 3PO2K 3S16K 4A3GK 4A3CK 3S15C 4OIPA 5TMCA 4BY1K 3GTLK 3M4OK 4XLNA 2NVQC 5IP9C 1TWCK 2WB1L 5C44K 5C4JC 4MQ9A 4A3KC 3S17K 4KN7A 4A3FK 3K7AK 3S2HK 3GTOC 5IYBK 3RZDK 2R93K 4A3DK 4A3CC 2NVXK 4C3HC 3H3VD 4QIWL 2E2HK 4XSZA 1K83C 4A3EC 3HOUK 3H0GC 5C4XC 4BBRC 4BY7C 2JA5K 2VUMK 3HOZK 1IW7A 2O5IA 4OIQA 3M3YK 1ZYRA 4YFNA 4G7ZA 5M3FK 2NVTK 3GTKK 5C3EK 3S1MK 4BXXK 3H3VL 1SFOK 4A3IC 3CQZK 2JA6K 1TWHC 1I6HC 4C2MK 4GZYA 2A6HA 3FKIC 4LJZA 1TWFC 4A3MC 3S16C 4Q5SA 1XPPA 4C3IK 4G7HA 3GTJK 3HOYC 2WAQD 5M5XK 2NVYK 3S1RK 3S2DK 4A93K 1Y1VK 2CW0A 2E2IK 4AYBD 1R9TC 4G7OA 1TWGK 3S17C 2R7ZK 3I4NC 4A3LK 4LLGA 4BBSK 5IYDK 3S2HC 2R93C 5IYBC 3GTPC 1Y1WC 4Y7NK 4Y52K 2B63C 3HOWC 1WCMC 3RZOK 4QJVA 2A68A 4YFXA 4AYBL 2Y0SD 4X6AC 3PO3K 4C3JK 1I3QC 2VUMC 2JA8C 5M5YK 3HOVK 4XSXA 1BDFA 4LK0A 3GTMC 1TWAK 5IP7C 5C3EC 1SMYA 2R92C 3GTQK 1SFOC 1I50K 3CQZC 3I4MK 4KN4A 2JA6C 4A3BK 3HOXC 1HQMA 3S1QK 3S15K 3GTJC 4MEYA 4C3IC 5FLMC 2JA7C 3PO2C 4A3GC 2NVQK 2PMZD 4YFKA 3S1RC 5IP9K 5IYCK 3EQLA 2PA8D 4BY1C 1Y1VC 3GTLC 3M4OC 1TWCC 5C44C 2E2JK 1TWGC 4A3LC 3GTOK 1I6VA 4A3FC 3K7AC 2YU9K 4Y7NC 3RZDC 2O5JA 4A3DC 2WAQL 3WODA 2NVXC 5M3MK 4A3EK 3S1NK 2E2HC 3H0GK 3HOUC 2WB1D 4KMUA 2JA5C 4XLPA 4OINA 5M5WK 3HOZC 3GTGK 4OIRA 1TWAC 3M3YC 4ZH4A 2NVTC 4A3IK 3I4MC 3GTQC 1I50C 3GTKC 3S1QC 3S1MC 1TWHK 4BXXC 3S14K 1TWFK 4A3JK 4A3MK 4QJVB 4C2MC 2Y0SL 3HOYK 4NOIA 4QIWD 3S1NC 2A69A 5IYCC 5FJ8K 2NVYC
chains in the Genus database with same CATH superfamily
1F93A 2E2IC 1YNJA 3GEEA 2ZUFA 3AQOA 5JFEA 1Y1WK 4BBSC 2B63K 4Q4ZA 3LPXA 1WCMK 5EGEA 3HOWK 3RZOC 1K83K 4PABA 3IPJA 2JA8K 3PO3C 4BY7K 2PHCB 1TWHA 3GTMK 4P9SA 3LAJA 2R92K 1B4AA 3S14C 4A3BC 4LK1A 5FLMK 4A3GK 1PJ6A 3OPFA 3S15C 3ADAC 3GTLK 3M4OK 5C44K 4MQ9A 4A3KC 4BKWA 3S17K 4WFBS 4A3CC 4QIWL 4XSZA 1DCHA 4KMHA 3A8KA 4KM9A 3H0GC 4OIQA 1RU0A 2NVTK 1O25A 4G7ZA 3TFIA 5HQHA 4GZYA 1INNA 2A6HA 3S16C 3GTJK 4G7HA 3FOEA 2E2IK 4AYBD 3BP8C 2NVXA 3TTGA 2E2HA 1JQWA 4BBSK 2XCRB 3SZYA 3L4KA 3RZOK 4QJVA 2A68A 1J6WA 3PO3K 2KWAA 1XZQB 3CQZA 3CAGA 4KAWX 5C3EC 1SMYA 1ZXOA 4A3BK 1I50K 3CQZC 3HOXC 3S15K 4G0UA 4C3IC 2RH6A 4AH6A 1FEUA 3S1RC 2CFAB 5IYCK 2ZJQS 3L4JA 2V6UA 4A3LC 1I6VA 2P8TA 4A3FC 2KPUA 2YU9K 1ZQ1C 5JVGS 5M3MK 1JOEA 3H0GK 1TWAA 4BLBA 3HOUC 2JA5C 5CJ9A 3HOZC 3GTGK 4OIRA 1TWAC 1EI6A 3S1QC 5L46A 1USOA 1XZPA 4QJVB 3TFJA 4C2MC 1BGWA 2GAGC 5FJ8K 2KQ1A 3AH5A 1X31C 3T01A 1O24A 5D4DA 1ZBSA 2JH3A 2R7ZC 5TMFA 1WQGA 4KDDA 1YNNA 4C3HK 1F9NA 3DXJA 3HOXK 5IOTA 1I6HK 4A3JC 3T02A 3HKZL 1O2FB 5HL7S 3BUEA 3GTPA 3TFHA 5C4JC 4KATA 1I3QA 4KN7A 4A3FK 5EGHA 2R93K 1XZPB 2FQTA 4ILDA 4GTCA 1WORA 2FQOA 1IL2A 3HOUK 2JA5K 5C4XC 4BBRC 2VUMK 3HOZK 1IW7A 2O5IA 2RGRA 3FKIA 1TWFA 3H3VL 4A3IC 2JA6K 1TWHC 4C2MK 3FKIC 4LQYA 1TWFC 1R9TA 2P5MA 2WAQD 1WOPA 2Y3PA 1Y1VK 1F7VA 2L5NA 1R9TC 4G7OA 2XCQA 1XZQA 2R7ZK 1O2AA 3I4NC 4LLGA 4PAAA 3LYWA 3S2HC 5IYBC 3QX3A 4Y7NK 3DLLS 3GDZA 2Y0SD 2D6FC 3GTKA 5M5YK 1SFOA 3VA7A 1J6VA 2CFAA 2V6TA 5DM6S 1SFOC 2ZFZA 4J3NA 4KN4A 3PIPS 1IS1A 4MEYA 3PO2C 1TWGA 4YFKA 3S1NK 2PA8D 1AB4A 1XXAA 2L3UA 1EFWA 1TWGC 3A8JA 5IOQA 4GTAA 4GTFA 3K7AC 4GFQA 4A3DC 2WAQL 2NVXC 1WQFA 2E2HC 1DCPA 5IOSA 1V5VA 3OREA 3GTQA 4KC6A 2GSOA 3M3YC 4A3IK 3I4MC 3GTQC 1TWHK 3BP3A 3S1MC 1EH1A 4GTBA 2NVYA 1TWFK 3S14K 1UV7A 2Y0SL 4NOIA 3PIOS 4WILA 3GTOA 2NVYC 3S2DC 1R9TK 4GTLA 2E2JC 4P5BA 4A3KK 3I4NK 1IBAA 5IYDC 4A3CK 4YG2A 4RMFA 1BJTA 2PA8L 4LOWA 3HKZD 4WFNS 3GIRA 4C3JC 3AQPA 4DDQA 4OIOA 3HOVC 2GSUA 4WF9S 4MEXA 3PO2K 3S16K 4WJ4A 5TMCA 4XLNA 1Y1WA 3GEHA 2B63A 4G0VA 1WCMA 3ERED 1JVIA 4KARA 3K7AK 1K83A 4A3DK 2NVXK 3H3VD 2E2HK 1VJEA 3N0CA 1K83C 4A3EC 2R92A 4BY7C 4P5AA 5E68A 1O27A 3M3YK 5M3FK 4KB2A 1IQ0A 5C3EK 3S1MK 3GTLA 3SZZA 3CQZK 4LJZA 4FM9A 1XPPA 4C3IK 3HOYC 2NVYK 3S1RK 3S2DK 1PJ7A 1ISEA 3S17C 4LR2A 4A3LK 5IYDK 3GTPC 3AD8C 3G4CA 4X6AC 4KM8A 4C3JK 2ZUEA 1I3QC 1B4BA 3HOVK 5DM7S 4XSXA 1BDFA 4IOCS 1TWAK 3GTJA 5IP7C 3HXAA 2JA7A 1DCOA 5HL8A 3S1QK 4WJ3M 2E2IA 1HQMA 1TWCA 3GTJC 2JA7C 3G4AA 2PMZD 1IE0A 3GSIA 4BY1C 1TWCC 1O26A 3N3YA 3OEPA 4G0WA 4GTDA 1BS2A 3JSTA 2GSNA 3RZDC 3CF5S 4A3EK 2GAHC 1J98A 2WB1D 1I50A 4IO9S 4XLPA 4OINA 4ZH4A 1I50C 4WCES 3GTKC 4BXXC 4GT9A 4A3JK 2W7VA 5CHPA 3HOYK 1GE9A 2A69A 5IYCC 2ZJRS 4A93C 1G51A 5C4JK 2YU9A 3T00A 3H0GA 3GTPK 2A6EA 4JK1A 2YU9C 1USMA 2BE5A 4Y52C 1WSVA 2PMZL 1WOOA 4X6AK 1I3QK 3GTGA 5C4XK 4BBRK 1DD5A 5JVHS 2PPBA 5IP7K 3GTGC 2EBBA 3MMLB 1F7UA 2JA7K 3FKIK 3FOFA 1WOSA 3GEIA 4OIPA 1XXCA 1O28A 4BY1K 2NVQC 1TWCK 5IP9C 2WB1L 1J6XA 4O2DA 3S2HK 3GTOC 5IYBK 3RZDK 4C3HC 4M1XA 1O29A 1L0WA 3AD9C 1ZYRA 4YFNA 3GTKK 1WQHA 4BXXK 1SFOK 1KQ4A 1I6HC 3NUHA 4GTEA 1EK8A 4A3MC 2KXYA 4U67S 4Q5SA 3AD7C 5M5XK 1VGXA 2V6SA 2CW0A 5JVOA 4A93K 4KB4A 1YX2A 2R93A 2ZJPS 5TJ3A 1TWGK 4WFAS 2R93C 1VRQC 2JA5A 1Y1WC 2VUMA 4Y52K 2B63C 4KASA 3HOWC 1WCMC 4YFXA 4AYBL 3GTMA 3Q3QA 1PJ5A 1VH2A 2VUMC 2JA8C 3S0XA 2JA6A 1EQRA 4KMDA 4LK0A 3A8IA 3GTMC 1C0AA 4BLAA 3LAPA 2R92C 3GTQK 3I4MK 2JA6C 1Y1VA 4IOAS 5FLMC 2XCOA 4A3GC 2NVQK 5IP9K 3EQLA 2R7ZA 3GTLC 1Y1VC 3M4OC 1WIHA 4XCHA 5C44C 2E2JK 4FZBA 1O2BA 1WSRA 3GTOK 4C45A 5IORA 4Y7NC 2O5JA 3WODA 4KMAA 3FHZA 4KMUA 1VLOA 5M5WK 2NVTC 3N0BA 1YCLA 4A3MK 1HI9A 3V4GA 4QIWD 3S1NC 1ZVUA 1XXBA
chains in the Genus database with same CATH topology
3S2DC 4A93C 1R9TK 2E2IC 5C4JK 2E2JC 4A3KK 1YNJA 3I4NK 5D4DA 3GTPK 1Y1WK 2R7ZC 5TMFA 4BBSC 2B63K 2A6EA 5IYDC 1YNNA 4JK1A 4YG2A 2BE5A 4Q4ZA 2YU9C 1WCMK 4C3HK 4Y52C 2PMZL 4X6AK 1I3QK 3RZOC 2PA8L 3HKZD 1K83K 2JA8K 3PO3C 4BBRK 4C3JC 5C4XK 3HOWK 4BY7K 3GTMK 2PPBA 4OIOA 3HOVC 3GTGC 5IP7K 3DXJA 2R92K 3HOXK 4MEXA 3S14C 4A3BC 4A3JC 4LK1A 1I6HK 3HKZL 5FLMK 3FKIK 2JA7K 3PO2K 3S16K 4A3GK 4A3CK 3S15C 4OIPA 5TMCA 4BY1K 3GTLK 3M4OK 4XLNA 2NVQC 5IP9C 1TWCK 2WB1L 5C44K 5C4JC 4MQ9A 4A3KC 3S17K 4KN7A 4A3FK 3K7AK 3S2HK 3GTOC 5IYBK 3RZDK 2R93K 4A3DK 4A3CC 2NVXK 4C3HC 3H3VD 4QIWL 2E2HK 4XSZA 1K83C 4A3EC 3HOUK 3H0GC 5C4XC 4BBRC 4BY7C 2JA5K 2VUMK 3HOZK 1IW7A 2O5IA 4OIQA 3M3YK 1ZYRA 4YFNA 4G7ZA 5M3FK 2NVTK 3GTKK 5C3EK 3S1MK 4BXXK 3H3VL 1SFOK 4A3IC 3CQZK 2JA6K 1TWHC 1I6HC 4C2MK 4GZYA 2A6HA 3FKIC 4LJZA 1TWFC 4A3MC 3S16C 4Q5SA 1XPPA 4C3IK 4G7HA 3GTJK 3HOYC 2WAQD 5M5XK 2NVYK 3S1RK 3S2DK 4A93K 1Y1VK 2CW0A 2E2IK 4AYBD 1R9TC 4G7OA 1TWGK 3S17C 2R7ZK 3I4NC 4A3LK 4LLGA 4BBSK 5IYDK 3S2HC 2R93C 5IYBC 3GTPC 1Y1WC 4Y7NK 4Y52K 2B63C 3HOWC 1WCMC 3RZOK 4QJVA 2A68A 4YFXA 4AYBL 2Y0SD 4X6AC 3PO3K 4C3JK 1I3QC 2VUMC 2JA8C 5M5YK 3HOVK 4XSXA 1BDFA 4LK0A 3GTMC 1TWAK 5IP7C 5C3EC 1SMYA 2R92C 3GTQK 1SFOC 1I50K 3CQZC 3I4MK 4KN4A 2JA6C 4A3BK 3HOXC 1HQMA 3S1QK 3S15K 3GTJC 4MEYA 4C3IC 5FLMC 2JA7C 3PO2C 4A3GC 2NVQK 2PMZD 4YFKA 3S1RC 5IP9K 5IYCK 3EQLA 2PA8D 4BY1C 1Y1VC 3GTLC 3M4OC 1TWCC 5C44C 2E2JK 1TWGC 4A3LC 3GTOK 1I6VA 4A3FC 3K7AC 2YU9K 4Y7NC 3RZDC 2O5JA 4A3DC 2WAQL 3WODA 2NVXC 5M3MK 4A3EK 3S1NK 2E2HC 3H0GK 3HOUC 2WB1D 4KMUA 2JA5C 4XLPA 4OINA 5M5WK 3HOZC 3GTGK 4OIRA 1TWAC 3M3YC 4ZH4A 2NVTC 4A3IK 3I4MC 3GTQC 1I50C 3GTKC 3S1QC 3S1MC 1TWHK 4BXXC 3S14K 1TWFK 4A3JK 4A3MK 4QJVB 4C2MC 2Y0SL 3HOYK 4NOIA 4QIWD 3S1NC 2A69A 5IYCC 5FJ8K 2NVYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2D C;  4A93 C;  1R9T K;  2E2I C;  5C4J K;  2E2J C;  4A3K K;  1YNJ A;  3I4N K;  5D4D A;  3GTP K;  1Y1W K;  2R7Z C;  5TMF A;  4BBS C;  2B63 K;  2A6E A;  5IYD C;  1YNN A;  4JK1 A;  4YG2 A;  2BE5 A;  4Q4Z A;  2YU9 C;  1WCM K;  4C3H K;  4Y52 C;  2PMZ L;  4X6A K;  1I3Q K;  3RZO C;  2PA8 L;  3HKZ D;  1K83 K;  2JA8 K;  3PO3 C;  4BBR K;  4C3J C;  5C4X K;  3HOW K;  4BY7 K;  3GTM K;  2PPB A;  4OIO A;  3HOV C;  3GTG C;  5IP7 K;  3DXJ A;  2R92 K;  3HOX K;  4MEX A;  3S14 C;  4A3B C;  4A3J C;  4LK1 A;  1I6H K;  3HKZ L;  5FLM K;  3FKI K;  2JA7 K;  3PO2 K;  3S16 K;  4A3G K;  4A3C K;  3S15 C;  4OIP A;  5TMC A;  4BY1 K;  3GTL K;  3M4O K;  4XLN A;  2NVQ C;  5IP9 C;  1TWC K;  2WB1 L;  5C44 K;  5C4J C;  4MQ9 A;  4A3K C;  3S17 K;  4KN7 A;  4A3F K;  3K7A K;  3S2H K;  3GTO C;  5IYB K;  3RZD K;  2R93 K;  4A3D K;  4A3C C;  2NVX K;  4C3H C;  3H3V D;  4QIW L;  2E2H K;  4XSZ A;  1K83 C;  4A3E C;  3HOU K;  3H0G C;  5C4X C;  4BBR C;  4BY7 C;  2JA5 K;  2VUM K;  3HOZ K;  1IW7 A;  2O5I A;  4OIQ A;  3M3Y K;  1ZYR A;  4YFN A;  4G7Z A;  5M3F K;  2NVT K;  3GTK K;  5C3E K;  3S1M K;  4BXX K;  3H3V L;  1SFO K;  4A3I C;  3CQZ K;  2JA6 K;  1TWH C;  1I6H C;  4C2M K;  4GZY A;  2A6H A;  3FKI C;  4LJZ A;  1TWF C;  4A3M C;  3S16 C;  4Q5S A;  1XPP A;  4C3I K;  4G7H A;  3GTJ K;  3HOY C;  2WAQ D;  5M5X K;  2NVY K;  3S1R K;  3S2D K;  4A93 K;  1Y1V K;  2CW0 A;  2E2I K;  4AYB D;  1R9T C;  4G7O A;  1TWG K;  3S17 C;  2R7Z K;  3I4N C;  4A3L K;  4LLG A;  4BBS K;  5IYD K;  3S2H C;  2R93 C;  5IYB C;  3GTP C;  1Y1W C;  4Y7N K;  4Y52 K;  2B63 C;  3HOW C;  1WCM C;  3RZO K;  4QJV A;  2A68 A;  4YFX A;  4AYB L;  2Y0S D;  4X6A C;  3PO3 K;  4C3J K;  1I3Q C;  2VUM C;  2JA8 C;  5M5Y K;  3HOV K;  4XSX A;  1BDF A;  4LK0 A;  3GTM C;  1TWA K;  5IP7 C;  5C3E C;  1SMY A;  2R92 C;  3GTQ K;  1SFO C;  1I50 K;  3CQZ C;  3I4M K;  4KN4 A;  2JA6 C;  4A3B K;  3HOX C;  1HQM A;  3S1Q K;  3S15 K;  3GTJ C;  4MEY A;  4C3I C;  5FLM C;  2JA7 C;  3PO2 C;  4A3G C;  2NVQ K;  2PMZ D;  4YFK A;  3S1R C;  5IP9 K;  5IYC K;  3EQL A;  2PA8 D;  4BY1 C;  1Y1V C;  3GTL C;  3M4O C;  1TWC C;  5C44 C;  2E2J K;  1TWG C;  4A3L C;  3GTO K;  1I6V A;  4A3F C;  3K7A C;  2YU9 K;  4Y7N C;  3RZD C;  2O5J A;  4A3D C;  2WAQ L;  3WOD A;  2NVX C;  5M3M K;  4A3E K;  3S1N K;  2E2H C;  3H0G K;  3HOU C;  2WB1 D;  4KMU A;  2JA5 C;  4XLP A;  4OIN A;  5M5W K;  3HOZ C;  3GTG K;  4OIR A;  1TWA C;  3M3Y C;  4ZH4 A;  2NVT C;  4A3I K;  3I4M C;  3GTQ C;  1I50 C;  3GTK C;  3S1Q C;  3S1M C;  1TWH K;  4BXX C;  3S14 K;  1TWF K;  4A3J K;  4A3M K;  4QJV B;  4C2M C;  2Y0S L;  3HOY K;  4NOI A;  4QIW D;  3S1N C;  2A69 A;  5IYC C;  5FJ8 K;  2NVY C; 
#chains in the Genus database with same CATH topology
 1F93 A;  2E2I C;  1YNJ A;  3GEE A;  2ZUF A;  3AQO A;  5JFE A;  1Y1W K;  4BBS C;  2B63 K;  4Q4Z A;  3LPX A;  1WCM K;  5EGE A;  3HOW K;  3RZO C;  1K83 K;  4PAB A;  3IPJ A;  2JA8 K;  3PO3 C;  4BY7 K;  2PHC B;  1TWH A;  3GTM K;  4P9S A;  3LAJ A;  2R92 K;  1B4A A;  3S14 C;  4A3B C;  4LK1 A;  5FLM K;  4A3G K;  1PJ6 A;  3OPF A;  3S15 C;  3ADA C;  3GTL K;  3M4O K;  5C44 K;  4MQ9 A;  4A3K C;  4BKW A;  3S17 K;  4WFB S;  4A3C C;  4QIW L;  4XSZ A;  1DCH A;  4KMH A;  3A8K A;  4KM9 A;  3H0G C;  4OIQ A;  1RU0 A;  2NVT K;  1O25 A;  4G7Z A;  3TFI A;  5HQH A;  4GZY A;  1INN A;  2A6H A;  3S16 C;  3GTJ K;  4G7H A;  3FOE A;  2E2I K;  4AYB D;  3BP8 C;  2NVX A;  3TTG A;  2E2H A;  1JQW A;  4BBS K;  2XCR B;  3SZY A;  3L4K A;  3RZO K;  4QJV A;  2A68 A;  1J6W A;  3PO3 K;  2KWA A;  1XZQ B;  3CQZ A;  3CAG A;  4KAW X;  5C3E C;  1SMY A;  1ZXO A;  4A3B K;  1I50 K;  3CQZ C;  3HOX C;  3S15 K;  4G0U A;  4C3I C;  2RH6 A;  4AH6 A;  1FEU A;  3S1R C;  2CFA B;  5IYC K;  2ZJQ S;  3L4J A;  2V6U A;  4A3L C;  1I6V A;  2P8T A;  4A3F C;  2KPU A;  2YU9 K;  1ZQ1 C;  5JVG S;  5M3M K;  1JOE A;  3H0G K;  1TWA A;  4BLB A;  3HOU C;  2JA5 C;  5CJ9 A;  3HOZ C;  3GTG K;  4OIR A;  1TWA C;  1EI6 A;  3S1Q C;  5L46 A;  1USO A;  1XZP A;  4QJV B;  3TFJ A;  4C2M C;  1BGW A;  2GAG C;  5FJ8 K;  2KQ1 A;  3AH5 A;  1X31 C;  3T01 A;  1O24 A;  5D4D A;  1ZBS A;  2JH3 A;  2R7Z C;  5TMF A;  1WQG A;  4KDD A;  1YNN A;  4C3H K;  1F9N A;  3DXJ A;  3HOX K;  5IOT A;  1I6H K;  4A3J C;  3T02 A;  3HKZ L;  1O2F B;  5HL7 S;  3BUE A;  3GTP A;  3TFH A;  5C4J C;  4KAT A;  1I3Q A;  4KN7 A;  4A3F K;  5EGH A;  2R93 K;  1XZP B;  2FQT A;  4ILD A;  4GTC A;  1WOR A;  2FQO A;  1IL2 A;  3HOU K;  2JA5 K;  5C4X C;  4BBR C;  2VUM K;  3HOZ K;  1IW7 A;  2O5I A;  2RGR A;  3FKI A;  1TWF A;  3H3V L;  4A3I C;  2JA6 K;  1TWH C;  4C2M K;  3FKI C;  4LQY A;  1TWF C;  1R9T A;  2P5M A;  2WAQ D;  1WOP A;  2Y3P A;  1Y1V K;  1F7V A;  2L5N A;  1R9T C;  4G7O A;  2XCQ A;  1XZQ A;  2R7Z K;  1O2A A;  3I4N C;  4LLG A;  4PAA A;  3LYW A;  3S2H C;  5IYB C;  3QX3 A;  4Y7N K;  3DLL S;  3GDZ A;  2Y0S D;  2D6F C;  3GTK A;  5M5Y K;  1SFO A;  3VA7 A;  1J6V A;  2CFA A;  2V6T A;  5DM6 S;  1SFO C;  2ZFZ A;  4J3N A;  4KN4 A;  3PIP S;  1IS1 A;  4MEY A;  3PO2 C;  1TWG A;  4YFK A;  3S1N K;  2PA8 D;  1AB4 A;  1XXA A;  2L3U A;  1EFW A;  1TWG C;  3A8J A;  5IOQ A;  4GTA A;  4GTF A;  3K7A C;  4GFQ A;  4A3D C;  2WAQ L;  2NVX C;  1WQF A;  2E2H C;  1DCP A;  5IOS A;  1V5V A;  3ORE A;  3GTQ A;  4KC6 A;  2GSO A;  3M3Y C;  4A3I K;  3I4M C;  3GTQ C;  1TWH K;  3BP3 A;  3S1M C;  1EH1 A;  4GTB A;  2NVY A;  1TWF K;  3S14 K;  1UV7 A;  2Y0S L;  4NOI A;  3PIO S;  4WIL A;  3GTO A;  2NVY C;  3S2D C;  1R9T K;  4GTL A;  2E2J C;  4P5B A;  4A3K K;  3I4N K;  1IBA A;  5IYD C;  4A3C K;  4YG2 A;  4RMF A;  1BJT A;  2PA8 L;  4LOW A;  3HKZ D;  4WFN S;  3GIR A;  4C3J C;  3AQP A;  4DDQ A;  4OIO A;  3HOV C;  2GSU A;  4WF9 S;  4MEX A;  3PO2 K;  3S16 K;  4WJ4 A;  5TMC A;  4XLN A;  1Y1W A;  3GEH A;  2B63 A;  4G0V A;  1WCM A;  3ERE D;  1JVI A;  4KAR A;  3K7A K;  1K83 A;  4A3D K;  2NVX K;  3H3V D;  2E2H K;  1VJE A;  3N0C A;  1K83 C;  4A3E C;  2R92 A;  4BY7 C;  4P5A A;  5E68 A;  1O27 A;  3M3Y K;  5M3F K;  4KB2 A;  1IQ0 A;  5C3E K;  3S1M K;  3GTL A;  3SZZ A;  3CQZ K;  4LJZ A;  4FM9 A;  1XPP A;  4C3I K;  3HOY C;  2NVY K;  3S1R K;  3S2D K;  1PJ7 A;  1ISE A;  3S17 C;  4LR2 A;  4A3L K;  5IYD K;  3GTP C;  3AD8 C;  3G4C A;  4X6A C;  4KM8 A;  4C3J K;  2ZUE A;  1I3Q C;  1B4B A;  3HOV K;  5DM7 S;  4XSX A;  1BDF A;  4IOC S;  1TWA K;  3GTJ A;  5IP7 C;  3HXA A;  2JA7 A;  1DCO A;  5HL8 A;  3S1Q K;  4WJ3 M;  2E2I A;  1HQM A;  1TWC A;  3GTJ C;  2JA7 C;  3G4A A;  2PMZ D;  1IE0 A;  3GSI A;  4BY1 C;  1TWC C;  1O26 A;  3N3Y A;  3OEP A;  4G0W A;  4GTD A;  1BS2 A;  3JST A;  2GSN A;  3RZD C;  3CF5 S;  4A3E K;  2GAH C;  1J98 A;  2WB1 D;  1I50 A;  4IO9 S;  4XLP A;  4OIN A;  4ZH4 A;  1I50 C;  4WCE S;  3GTK C;  4BXX C;  4GT9 A;  4A3J K;  2W7V A;  5CHP A;  3HOY K;  1GE9 A;  2A69 A;  5IYC C;  2ZJR S;  4A93 C;  1G51 A;  5C4J K;  2YU9 A;  3T00 A;  3H0G A;  3GTP K;  2A6E A;  4JK1 A;  2YU9 C;  1USM A;  2BE5 A;  4Y52 C;  1WSV A;  2PMZ L;  1WOO A;  4X6A K;  1I3Q K;  3GTG A;  5C4X K;  4BBR K;  1DD5 A;  5JVH S;  2PPB A;  5IP7 K;  3GTG C;  2EBB A;  3MML B;  1F7U A;  2JA7 K;  3FKI K;  3FOF A;  1WOS A;  3GEI A;  4OIP A;  1XXC A;  1O28 A;  4BY1 K;  2NVQ C;  1TWC K;  5IP9 C;  2WB1 L;  1J6X A;  4O2D A;  3S2H K;  3GTO C;  5IYB K;  3RZD K;  4C3H C;  4M1X A;  1O29 A;  1L0W A;  3AD9 C;  1ZYR A;  4YFN A;  3GTK K;  1WQH A;  4BXX K;  1SFO K;  1KQ4 A;  1I6H C;  3NUH A;  4GTE A;  1EK8 A;  4A3M C;  2KXY A;  4U67 S;  4Q5S A;  3AD7 C;  5M5X K;  1VGX A;  2V6S A;  2CW0 A;  5JVO A;  4A93 K;  4KB4 A;  1YX2 A;  2R93 A;  2ZJP S;  5TJ3 A;  1TWG K;  4WFA S;  2R93 C;  1VRQ C;  2JA5 A;  1Y1W C;  2VUM A;  4Y52 K;  2B63 C;  4KAS A;  3HOW C;  1WCM C;  4YFX A;  4AYB L;  3GTM A;  3Q3Q A;  1PJ5 A;  1VH2 A;  2VUM C;  2JA8 C;  3S0X A;  2JA6 A;  1EQR A;  4KMD A;  4LK0 A;  3A8I A;  3GTM C;  1C0A A;  4BLA A;  3LAP A;  2R92 C;  3GTQ K;  3I4M K;  2JA6 C;  1Y1V A;  4IOA S;  5FLM C;  2XCO A;  4A3G C;  2NVQ K;  5IP9 K;  3EQL A;  2R7Z A;  3GTL C;  1Y1V C;  3M4O C;  1WIH A;  4XCH A;  5C44 C;  2E2J K;  4FZB A;  1O2B A;  1WSR A;  3GTO K;  4C45 A;  5IOR A;  4Y7N C;  2O5J A;  3WOD A;  4KMA A;  3FHZ A;  4KMU A;  1VLO A;  5M5W K;  2NVT C;  3N0B A;  1YCL A;  4A3M K;  1HI9 A;  3V4G A;  4QIW D;  3S1N C;  1ZVU A;  1XXB A; 
#chains in the Genus database with same CATH homology
 3S2D C;  4A93 C;  1R9T K;  2E2I C;  5C4J K;  2E2J C;  4A3K K;  1YNJ A;  3I4N K;  5D4D A;  3GTP K;  1Y1W K;  2R7Z C;  5TMF A;  4BBS C;  2B63 K;  2A6E A;  5IYD C;  1YNN A;  4JK1 A;  4YG2 A;  2BE5 A;  4Q4Z A;  2YU9 C;  1WCM K;  4C3H K;  4Y52 C;  2PMZ L;  4X6A K;  1I3Q K;  3RZO C;  2PA8 L;  3HKZ D;  1K83 K;  2JA8 K;  3PO3 C;  4BBR K;  4C3J C;  5C4X K;  3HOW K;  4BY7 K;  3GTM K;  2PPB A;  4OIO A;  3HOV C;  3GTG C;  5IP7 K;  3DXJ A;  2R92 K;  3HOX K;  4MEX A;  3S14 C;  4A3B C;  4A3J C;  4LK1 A;  1I6H K;  3HKZ L;  5FLM K;  3FKI K;  2JA7 K;  3PO2 K;  3S16 K;  4A3G K;  4A3C K;  3S15 C;  4OIP A;  5TMC A;  4BY1 K;  3GTL K;  3M4O K;  4XLN A;  2NVQ C;  5IP9 C;  1TWC K;  2WB1 L;  5C44 K;  5C4J C;  4MQ9 A;  4A3K C;  3S17 K;  4KN7 A;  4A3F K;  3K7A K;  3S2H K;  3GTO C;  5IYB K;  3RZD K;  2R93 K;  4A3D K;  4A3C C;  2NVX K;  4C3H C;  3H3V D;  4QIW L;  2E2H K;  4XSZ A;  1K83 C;  4A3E C;  3HOU K;  3H0G C;  5C4X C;  4BBR C;  4BY7 C;  2JA5 K;  2VUM K;  3HOZ K;  1IW7 A;  2O5I A;  4OIQ A;  3M3Y K;  1ZYR A;  4YFN A;  4G7Z A;  5M3F K;  2NVT K;  3GTK K;  5C3E K;  3S1M K;  4BXX K;  3H3V L;  1SFO K;  4A3I C;  3CQZ K;  2JA6 K;  1TWH C;  1I6H C;  4C2M K;  4GZY A;  2A6H A;  3FKI C;  4LJZ A;  1TWF C;  4A3M C;  3S16 C;  4Q5S A;  1XPP A;  4C3I K;  4G7H A;  3GTJ K;  3HOY C;  2WAQ D;  5M5X K;  2NVY K;  3S1R K;  3S2D K;  4A93 K;  1Y1V K;  2CW0 A;  2E2I K;  4AYB D;  1R9T C;  4G7O A;  1TWG K;  3S17 C;  2R7Z K;  3I4N C;  4A3L K;  4LLG A;  4BBS K;  5IYD K;  3S2H C;  2R93 C;  5IYB C;  3GTP C;  1Y1W C;  4Y7N K;  4Y52 K;  2B63 C;  3HOW C;  1WCM C;  3RZO K;  4QJV A;  2A68 A;  4YFX A;  4AYB L;  2Y0S D;  4X6A C;  3PO3 K;  4C3J K;  1I3Q C;  2VUM C;  2JA8 C;  5M5Y K;  3HOV K;  4XSX A;  1BDF A;  4LK0 A;  3GTM C;  1TWA K;  5IP7 C;  5C3E C;  1SMY A;  2R92 C;  3GTQ K;  1SFO C;  1I50 K;  3CQZ C;  3I4M K;  4KN4 A;  2JA6 C;  4A3B K;  3HOX C;  1HQM A;  3S1Q K;  3S15 K;  3GTJ C;  4MEY A;  4C3I C;  5FLM C;  2JA7 C;  3PO2 C;  4A3G C;  2NVQ K;  2PMZ D;  4YFK A;  3S1R C;  5IP9 K;  5IYC K;  3EQL A;  2PA8 D;  4BY1 C;  1Y1V C;  3GTL C;  3M4O C;  1TWC C;  5C44 C;  2E2J K;  1TWG C;  4A3L C;  3GTO K;  1I6V A;  4A3F C;  3K7A C;  2YU9 K;  4Y7N C;  3RZD C;  2O5J A;  4A3D C;  2WAQ L;  3WOD A;  2NVX C;  5M3M K;  4A3E K;  3S1N K;  2E2H C;  3H0G K;  3HOU C;  2WB1 D;  4KMU A;  2JA5 C;  4XLP A;  4OIN A;  5M5W K;  3HOZ C;  3GTG K;  4OIR A;  1TWA C;  3M3Y C;  4ZH4 A;  2NVT C;  4A3I K;  3I4M C;  3GTQ C;  1I50 C;  3GTK C;  3S1Q C;  3S1M C;  1TWH K;  4BXX C;  3S14 K;  1TWF K;  4A3J K;  4A3M K;  4QJV B;  4C2M C;  2Y0S L;  3HOY K;  4NOI A;  4QIW D;  3S1N C;  2A69 A;  5IYC C;  5FJ8 K;  2NVY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...