3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
4JK1A 3I4MC 5C44C 3S16K 1I50K 4BBRC 1TWCK 4KN4A 4XLNA 2R7ZC 4C2MK 1YNNA 3HOUC 1SMYA 2PA8L 3S15K 4A3DC 1K83K 5M3FK 5C44K 1BDFA 2JA7C 2NVQK 3S2DC 3PO2K 4G7ZA 4QJVA 2WAQL 5FJ8K 1Y1WK 3GTGK 5IYCK 4A93C 1K83C 2NVQC 3S2HK 4MEYA 2PPBA 4C3IK 2O5IA 5M5YK 2YU9K 3S17K 4BXXC 4A93K 3PO3C 4A3EK 1Y1WC 4MEXA 3GTMC 2O5JA 5M3MK 5IYDC 2VUMK 2R93K 2A68A 3H3VD 2NVTC 2Y0SL 4A3IK 3S17C 5IP9K 3S1NK 1I6VA 2WB1D 2R7ZK 3S15C 4BY1C 4YFNA 2NVYK 4KMUA 2PMZL 4A3LK 3HOVK 3M3YK 2B63K 1WCMC 4LK1A 5C4JK 4X6AC 1I3QK 4C3JK 5IP7C 4YFKA 3S1MC 2BE5A 2NVYC 1TWFC 3WODA 4BY7C 5FLMK 4YFXA 1I3QC 4C3JC 3GTKC 3HOXC 3HOZC 3S16C 2B63C 1SFOC 5IYBK 4A3JC 4OIRA 3PO2C 2VUMC 4A3GK 1TWHC 2R92C 4A3BC 2Y0SD 3H3VL 3CQZK 4QIWL 4QIWD 1TWGC 4A3MC 3HKZL 3GTLC 4A3KK 1I50C 3HOVC 3FKIC 5M5XK 4OIOA 3PO3K 2NVXK 3M3YC 1HQMA 4OIQA 3S14C 4A3KC 2JA7K 2JA5C 4BBSC 4BY7K 5IP9C 3S1NC 3RZOC 4XSZA 4Q4ZA 3GTGC 5C3EK 3S14K 1TWAC 2PMZD 2PA8D 5TMCA 1Y1VK 4A3FK 1R9TC 2JA6K 2A6EA 2CW0A 4Y7NK 3S1QK 3H0GC 1I6HK 4A3CC 4BBSK 3K7AC 3GTQC 3GTLK 2YU9C 4OINA 5FLMC 1XPPA 4A3MK 3S1MK 4Y52K 2E2IK 2R93C 1ZYRA 4A3CK 3FKIK 3GTJC 2JA8C 2NVXC 5C4XK 3S2DK 2A6HA 5IYBC 4Y52C 1SFOK 3S1RC 3GTPC 4LK0A 3HOXK 4NOIA 3CQZC 4KN7A 3M4OK 1TWCC 4BBRK 2R92K 4YG2A 1TWGK 4LLGA 4QJVB 4C2MC 3I4MK 4A3BK 1R9TK 4Q5SA 1Y1VC 2A69A 4Y7NC 4A3FC 5D4DA 1TWAK 3I4NK 2JA6C 4AYBD 5TMFA 4OIPA 4XSXA 3GTKK 4XLPA 3GTOC 3K7AK 3GTQK 3RZDK 4G7HA 2E2HC 3S2HC 4LJZA 4G7OA 4GZYA 1TWHK 2JA5K 3I4NC 3HOYC 4ZH4A 5C4XC 4A3LC 5C4JC 1WCMK 3GTJK 2E2JC 1IW7A 2E2HK 4AYBL 2JA8K 4A3EC 3HOWC 3GTOK 4A3DK 4BXXK 3HOUK 3M4OC 4C3HC 2WAQD 2E2JK 5IYDK 1I6HC 3H0GK 3HOWK 4A3IC 5IYCC 3EQLA 3HKZD 4MQ9A 3HOZK 4A3GC 4BY1K 5M5WK 4A3JK 2E2IC 4C3HK 5C3EC 2WB1L 3GTPK 4C3IC 3RZOK 3RZDC 3DXJA 4X6AK 1TWFK 3S1RK 3S1QC 3HOYK 5IP7K 3GTMK 2NVTK 1YNJA
chains in the Genus database with same CATH superfamily
1WQHA 1YX2A 1RU0A 2PA8L 1SMYA 1WOPA 3GEHA 1AB4A 2GAGC 1K83K 3PO2K 2WAQL 4FZBA 2NVQC 1XXCA 3S2HK 4MEYA 2PPBA 2O5IA 4WFBS 5M5YK 4A93K 1O27A 3AD7C 2O5JA 5CHPA 5IYDC 2KPUA 2VUMK 3H3VD 2Y0SL 4KATA 1BS2A 5HL8A 4LQYA 4YFNA 3GTJA 1I3QK 2L3UA 1VGXA 1USOA 5IYBK 1YNJA 4GTDA 4IOAS 3LAJA 1ZQ1C 1TWGC 3GTOA 3TFJA 1WCMA 2P8TA 3FKIC 3PO3K 2JA5A 1V5VA 1VRQC 1C0AA 4KMDA 2JA5C 1WQFA 4BY7K 1O2FB 1DCHA 4A3FK 2VUMA 1ISEA 2JA6K 2A6EA 1I6HK 4A3CC 3K7AC 1WSRA 4KARA 2ZJQS 3S1MK 4KM9A 2R93C 4KMAA 2NVXC 1SFOK 3S1RC 3A8JA 4NOIA 4GT9A 3M4OK 1TWCC 4LLGA 4C2MC 3CQZA 4PABA 2GSUA 3IPJA 3AD9C 4O2DA 5CJ9A 1JQWA 3RZDK 2E2HC 4G7OA 2GSOA 5DM6S 3HOYC 5C4JC 3H0GA 3GTJK 1IW7A 4GTCA 3HOWC 4BXXK 4KC6A 2WAQD 3GTKA 2RH6A 2W7VA 2XCOA 5IYCC 2E2IC 2WB1L 1XXBA 3N3YA 3GSIA 4DDQA 1TWFK 4X6AK 3GTPK 3S1QC 5IP7K 1Y1WA 4JK1A 3I4MC 1WOOA 4KN4A 1YNNA 1JOEA 1B4AA 5C44K 3BP3A 3S2DC 2ZJPS 1O28A 1PJ5A 3GTGK 2JH3A 5JVHS 2ZFZA 1IBAA 3SZZA 1INNA 2YU9K 1EK8A 1JVIA 3S17K 2ZJRS 4A3EK 3GTMC 1Y1VA 1UV7A 3GDZA 4ILDA 3CF5S 1B4BA 4BY1C 1TWCA 4A3LK 2NVYK 4GTFA 3M3YK 5C4JK 3N0CA 4C3JK 5IOTA 3S0XA 4G0VA 1TWHA 5FLMK 4YFXA 3GTQA 4M1XA 3S16C 3HOXC 3HOZC 1TWAA 1R9TA 2Y0SD 3H3VL 4QIWD 4A3MC 1PJ6A 3LYWA 2E2HA 1I50C 4OIOA 2NVXK 4GFQA 3FKIA 1HQMA 4OIQA 2JA7K 5IORA 4G0WA 4BBSC 4IOCS 3RZOC 4C45A 4Q4ZA 5C3EK 3S14K 2KXYA 2PMZD 2PA8D 5TMCA 1Y1VK 5EGEA 5JVGS 2CW0A 4WILA 4WCES 2V6TA 2YU9A 4BBSK 1BGWA 3GTLK 2YU9C 4OINA 3TFIA 4Y52K 2JA7A 1XZQA 1ZYRA 2JA8C 2A6HA 5IYBC 4WFAS 3DLLS 3MMLB 2R92K 2L5NA 4YG2A 1F9NA 1TWGK 1I50A 4A3BK 1R9TK 4Q5SA 2JA6A 4A3FC 4Y7NC 3GTPA 5D4DA 1PJ7A 2JA6C 4XCHA 4AYBD 5IOQA 3GTKK 3K7AK 2GAHC 4G7HA 3S2HC 4LJZA 5JVOA 2JA5K 1FEUA 1EI6A 1TWHK 1XZPA 4ZH4A 5C4XC 1WCMK 1ZVUA 2NVYA 3T01A 4A3DK 1O25A 2E2JK 4KAWX 3FHZA 3H0GK 5IOSA 4A3IC 3ERED 1DD5A 4A3GC 3OPFA 5M5WK 1WOSA 3JSTA 3QX3A 4BLAA 3FOFA 3GTMK 2NVTK 3CAGA 4GTEA 4BBRC 4XLNA 2R7ZC 3HOUC 3S15K 2NVQK 5M3FK 1BDFA 2R93A 4QJVA 3HXAA 1Y1WK 1KQ4A 5IYCK 4A93C 3G4CA 1K83C 4C3IK 3T02A 2CFAB 2KWAA 4GTLA 4BXXC 3NUHA 1Y1WC 4MEXA 5M3MK 3BP8C 2R93K 4AH6A 1HI9A 3T00A 1IS1A 5IP9K 3S1NK 1I6VA 4KB2A 2EBBA 3AQOA 4PAAA 1X31C 2PMZL 4LR2A 1EFWA 1J6WA 2Y3PA 2B63K 1WCMC 4LK1A 4X6AC 5IP7C 5E68A 2BE5A 3WODA 2KQ1A 4WJ3M 1I3QC 1ZBSA 2B63C 4A3JC 1I3QA 4KASA 4A3GK 2B63A 3CQZK 3GEEA 4GTBA 1O2AA 5DM7S 3GTLC 1ZXOA 4P9SA 1J98A 3HOVC 5M5XK 3AD8C 3M3YC 2V6UA 1VLOA 2E2IA 4BKWA 4XSZA 1O2BA 4KM8A 1F7UA 1TWAC 1R9TC 4Y7NK 3S1QK 1TWGA 3GTQC 5FLMC 1XPPA 3SZYA 3LPXA 4A3MK 2V6SA 2E2IK 4A3CK 5C4XK 3S2DK 3V4GA 3GTPC 4FM9A 4KN7A 5HQHA 4QJVB 2FQOA 3L4JA 3GTMA 1Y1VC 4G0UA 3I4NK 4WFNS 5TMFA 4OIPA 4U67S 1BJTA 4GTAA 1DCOA 4GZYA 2NVXA 3I4NC 4A3LC 2JA8K 3ADAC 4AYBL 2E2HK 4A3EC 2ZUFA 2ZUEA 3HOUK 1O29A 2XCQA 4LOWA 5IYDK 1I6HC 3TTGA 3VA7A 3HOWK 3EQLA 3HKZD 1WIHA 4MQ9A 1USMA 4P5BA 1L0WA 4BY1K 3HOZK 1F7VA 3GIRA 4C3IC 2XCRB 1F93A 1WSVA 3DXJA 1XXAA 4J3NA 1XZPB 5L46A 3S1RK 3AQPA 5C44C 3S16K 1DCPA 1I50K 1TWCK 2P5MA 2R92A 4C2MK 1K83A 1J6VA 4A3DC 3N0BA 3GTLA 4P5AA 2JA7C 4G7ZA 1YCLA 5FJ8K 3Q3QA 5HL7S 1WORA 3PO3C 3GTGA 2D6FC 3OEPA 2A68A 2NVTC 5JFEA 4A3IK 3S17C 5EGHA 2WB1D 2GSNA 2R7ZK 3S15C 4KMUA 3HOVK 4KDDA 4WJ4A 4KMHA 4YFKA 3S1MC 2NVYC 4BY7C 1TWFC 3LAPA 4C3JC 3GTKC 1SFOC 3PO2C 2VUMC 1WQGA 4RMFA 1TWHC 2R92C 4A3BC 3G4AA 4QIWL 3FOEA 3HKZL 4A3KK 1O26A 3BUEA 3S14C 4A3KC 1IQ0A 1O24A 5IP9C 3S1NC 3GTGC 1J6XA 1IE0A 2FQTA 3A8IA 3H0GC 1GE9A 3TFHA 1SFOA 3FKIK 3GTJC 4Y52C 1TWFA 1G51A 4LK0A 3HOXK 3CQZC 4BBRK 2PHCB 3I4MK 1TWAK 2A69A 1VH2A 4XSXA 4XLPA 4WF9S 3GTOC 3GTQK 5TJ3A 3GEIA 3AH5A 2E2JC 1VJEA 4BLBA 2RGRA 3GTOK 1XZQB 3OREA 3M4OC 4C3HC 4KB4A 2R7ZA 3PIPS 1IL2A 1EQRA 4IO9S 3PIOS 2CFAA 4A3JK 1EH1A 3L4KA 4C3HK 5C3EC 3RZOK 3RZDC 3A8KA 3HOYK 4OIRA
chains in the Genus database with same CATH topology
4JK1A 3I4MC 5C44C 3S16K 1I50K 4BBRC 1TWCK 4KN4A 4XLNA 2R7ZC 4C2MK 1YNNA 3HOUC 1SMYA 2PA8L 3S15K 4A3DC 1K83K 5M3FK 5C44K 1BDFA 2JA7C 2NVQK 3S2DC 3PO2K 4G7ZA 4QJVA 2WAQL 5FJ8K 1Y1WK 3GTGK 5IYCK 4A93C 1K83C 2NVQC 3S2HK 4MEYA 2PPBA 4C3IK 2O5IA 5M5YK 2YU9K 3S17K 4BXXC 4A93K 3PO3C 4A3EK 1Y1WC 4MEXA 3GTMC 2O5JA 5M3MK 5IYDC 2VUMK 2R93K 2A68A 3H3VD 2NVTC 2Y0SL 4A3IK 3S17C 5IP9K 3S1NK 1I6VA 2WB1D 2R7ZK 3S15C 4BY1C 4YFNA 2NVYK 4KMUA 2PMZL 4A3LK 3HOVK 3M3YK 2B63K 1WCMC 4LK1A 5C4JK 4X6AC 1I3QK 4C3JK 5IP7C 4YFKA 3S1MC 2BE5A 2NVYC 1TWFC 3WODA 4BY7C 5FLMK 4YFXA 1I3QC 4C3JC 3GTKC 3HOXC 3HOZC 3S16C 2B63C 1SFOC 5IYBK 4A3JC 4OIRA 3PO2C 2VUMC 4A3GK 1TWHC 2R92C 4A3BC 2Y0SD 3H3VL 3CQZK 4QIWL 4QIWD 1TWGC 4A3MC 3HKZL 3GTLC 4A3KK 1I50C 3HOVC 3FKIC 5M5XK 4OIOA 3PO3K 2NVXK 3M3YC 1HQMA 4OIQA 3S14C 4A3KC 2JA7K 2JA5C 4BBSC 4BY7K 5IP9C 3S1NC 3RZOC 4XSZA 4Q4ZA 3GTGC 5C3EK 3S14K 1TWAC 2PMZD 2PA8D 5TMCA 1Y1VK 4A3FK 1R9TC 2JA6K 2A6EA 2CW0A 4Y7NK 3S1QK 3H0GC 1I6HK 4A3CC 4BBSK 3K7AC 3GTQC 3GTLK 2YU9C 4OINA 5FLMC 1XPPA 4A3MK 3S1MK 4Y52K 2E2IK 2R93C 1ZYRA 4A3CK 3FKIK 3GTJC 2JA8C 2NVXC 5C4XK 3S2DK 2A6HA 5IYBC 4Y52C 1SFOK 3S1RC 3GTPC 4LK0A 3HOXK 4NOIA 3CQZC 4KN7A 3M4OK 1TWCC 4BBRK 2R92K 4YG2A 1TWGK 4LLGA 4QJVB 4C2MC 3I4MK 4A3BK 1R9TK 4Q5SA 1Y1VC 2A69A 4Y7NC 4A3FC 5D4DA 1TWAK 3I4NK 2JA6C 4AYBD 5TMFA 4OIPA 4XSXA 3GTKK 4XLPA 3GTOC 3K7AK 3GTQK 3RZDK 4G7HA 2E2HC 3S2HC 4LJZA 4G7OA 4GZYA 1TWHK 2JA5K 3I4NC 3HOYC 4ZH4A 5C4XC 4A3LC 5C4JC 1WCMK 3GTJK 2E2JC 1IW7A 2E2HK 4AYBL 2JA8K 4A3EC 3HOWC 3GTOK 4A3DK 4BXXK 3HOUK 3M4OC 4C3HC 2WAQD 2E2JK 5IYDK 1I6HC 3H0GK 3HOWK 4A3IC 5IYCC 3EQLA 3HKZD 4MQ9A 3HOZK 4A3GC 4BY1K 5M5WK 4A3JK 2E2IC 4C3HK 5C3EC 2WB1L 3GTPK 4C3IC 3RZOK 3RZDC 3DXJA 4X6AK 1TWFK 3S1RK 3S1QC 3HOYK 5IP7K 3GTMK 2NVTK 1YNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 A;  3I4M C;  5C44 C;  3S16 K;  1I50 K;  4BBR C;  1TWC K;  4KN4 A;  4XLN A;  2R7Z C;  4C2M K;  1YNN A;  3HOU C;  1SMY A;  2PA8 L;  3S15 K;  4A3D C;  1K83 K;  5M3F K;  5C44 K;  1BDF A;  2JA7 C;  2NVQ K;  3S2D C;  3PO2 K;  4G7Z A;  4QJV A;  2WAQ L;  5FJ8 K;  1Y1W K;  3GTG K;  5IYC K;  4A93 C;  1K83 C;  2NVQ C;  3S2H K;  4MEY A;  2PPB A;  4C3I K;  2O5I A;  5M5Y K;  2YU9 K;  3S17 K;  4BXX C;  4A93 K;  3PO3 C;  4A3E K;  1Y1W C;  4MEX A;  3GTM C;  2O5J A;  5M3M K;  5IYD C;  2VUM K;  2R93 K;  2A68 A;  3H3V D;  2NVT C;  2Y0S L;  4A3I K;  3S17 C;  5IP9 K;  3S1N K;  1I6V A;  2WB1 D;  2R7Z K;  3S15 C;  4BY1 C;  4YFN A;  2NVY K;  4KMU A;  2PMZ L;  4A3L K;  3HOV K;  3M3Y K;  2B63 K;  1WCM C;  4LK1 A;  5C4J K;  4X6A C;  1I3Q K;  4C3J K;  5IP7 C;  4YFK A;  3S1M C;  2BE5 A;  2NVY C;  1TWF C;  3WOD A;  4BY7 C;  5FLM K;  4YFX A;  1I3Q C;  4C3J C;  3GTK C;  3HOX C;  3HOZ C;  3S16 C;  2B63 C;  1SFO C;  5IYB K;  4A3J C;  4OIR A;  3PO2 C;  2VUM C;  4A3G K;  1TWH C;  2R92 C;  4A3B C;  2Y0S D;  3H3V L;  3CQZ K;  4QIW L;  4QIW D;  1TWG C;  4A3M C;  3HKZ L;  3GTL C;  4A3K K;  1I50 C;  3HOV C;  3FKI C;  5M5X K;  4OIO A;  3PO3 K;  2NVX K;  3M3Y C;  1HQM A;  4OIQ A;  3S14 C;  4A3K C;  2JA7 K;  2JA5 C;  4BBS C;  4BY7 K;  5IP9 C;  3S1N C;  3RZO C;  4XSZ A;  4Q4Z A;  3GTG C;  5C3E K;  3S14 K;  1TWA C;  2PMZ D;  2PA8 D;  5TMC A;  1Y1V K;  4A3F K;  1R9T C;  2JA6 K;  2A6E A;  2CW0 A;  4Y7N K;  3S1Q K;  3H0G C;  1I6H K;  4A3C C;  4BBS K;  3K7A C;  3GTQ C;  3GTL K;  2YU9 C;  4OIN A;  5FLM C;  1XPP A;  4A3M K;  3S1M K;  4Y52 K;  2E2I K;  2R93 C;  1ZYR A;  4A3C K;  3FKI K;  3GTJ C;  2JA8 C;  2NVX C;  5C4X K;  3S2D K;  2A6H A;  5IYB C;  4Y52 C;  1SFO K;  3S1R C;  3GTP C;  4LK0 A;  3HOX K;  4NOI A;  3CQZ C;  4KN7 A;  3M4O K;  1TWC C;  4BBR K;  2R92 K;  4YG2 A;  1TWG K;  4LLG A;  4QJV B;  4C2M C;  3I4M K;  4A3B K;  1R9T K;  4Q5S A;  1Y1V C;  2A69 A;  4Y7N C;  4A3F C;  5D4D A;  1TWA K;  3I4N K;  2JA6 C;  4AYB D;  5TMF A;  4OIP A;  4XSX A;  3GTK K;  4XLP A;  3GTO C;  3K7A K;  3GTQ K;  3RZD K;  4G7H A;  2E2H C;  3S2H C;  4LJZ A;  4G7O A;  4GZY A;  1TWH K;  2JA5 K;  3I4N C;  3HOY C;  4ZH4 A;  5C4X C;  4A3L C;  5C4J C;  1WCM K;  3GTJ K;  2E2J C;  1IW7 A;  2E2H K;  4AYB L;  2JA8 K;  4A3E C;  3HOW C;  3GTO K;  4A3D K;  4BXX K;  3HOU K;  3M4O C;  4C3H C;  2WAQ D;  2E2J K;  5IYD K;  1I6H C;  3H0G K;  3HOW K;  4A3I C;  5IYC C;  3EQL A;  3HKZ D;  4MQ9 A;  3HOZ K;  4A3G C;  4BY1 K;  5M5W K;  4A3J K;  2E2I C;  4C3H K;  5C3E C;  2WB1 L;  3GTP K;  4C3I C;  3RZO K;  3RZD C;  3DXJ A;  4X6A K;  1TWF K;  3S1R K;  3S1Q C;  3HOY K;  5IP7 K;  3GTM K;  2NVT K;  1YNJ A; 
#chains in the Genus database with same CATH topology
 1WQH A;  1YX2 A;  1RU0 A;  2PA8 L;  1SMY A;  1WOP A;  3GEH A;  1AB4 A;  2GAG C;  1K83 K;  3PO2 K;  2WAQ L;  4FZB A;  2NVQ C;  1XXC A;  3S2H K;  4MEY A;  2PPB A;  2O5I A;  4WFB S;  5M5Y K;  4A93 K;  1O27 A;  3AD7 C;  2O5J A;  5CHP A;  5IYD C;  2KPU A;  2VUM K;  3H3V D;  2Y0S L;  4KAT A;  1BS2 A;  5HL8 A;  4LQY A;  4YFN A;  3GTJ A;  1I3Q K;  2L3U A;  1VGX A;  1USO A;  5IYB K;  1YNJ A;  4GTD A;  4IOA S;  3LAJ A;  1ZQ1 C;  1TWG C;  3GTO A;  3TFJ A;  1WCM A;  2P8T A;  3FKI C;  3PO3 K;  2JA5 A;  1V5V A;  1VRQ C;  1C0A A;  4KMD A;  2JA5 C;  1WQF A;  4BY7 K;  1O2F B;  1DCH A;  4A3F K;  2VUM A;  1ISE A;  2JA6 K;  2A6E A;  1I6H K;  4A3C C;  3K7A C;  1WSR A;  4KAR A;  2ZJQ S;  3S1M K;  4KM9 A;  2R93 C;  4KMA A;  2NVX C;  1SFO K;  3S1R C;  3A8J A;  4NOI A;  4GT9 A;  3M4O K;  1TWC C;  4LLG A;  4C2M C;  3CQZ A;  4PAB A;  2GSU A;  3IPJ A;  3AD9 C;  4O2D A;  5CJ9 A;  1JQW A;  3RZD K;  2E2H C;  4G7O A;  2GSO A;  5DM6 S;  3HOY C;  5C4J C;  3H0G A;  3GTJ K;  1IW7 A;  4GTC A;  3HOW C;  4BXX K;  4KC6 A;  2WAQ D;  3GTK A;  2RH6 A;  2W7V A;  2XCO A;  5IYC C;  2E2I C;  2WB1 L;  1XXB A;  3N3Y A;  3GSI A;  4DDQ A;  1TWF K;  4X6A K;  3GTP K;  3S1Q C;  5IP7 K;  1Y1W A;  4JK1 A;  3I4M C;  1WOO A;  4KN4 A;  1YNN A;  1JOE A;  1B4A A;  5C44 K;  3BP3 A;  3S2D C;  2ZJP S;  1O28 A;  1PJ5 A;  3GTG K;  2JH3 A;  5JVH S;  2ZFZ A;  1IBA A;  3SZZ A;  1INN A;  2YU9 K;  1EK8 A;  1JVI A;  3S17 K;  2ZJR S;  4A3E K;  3GTM C;  1Y1V A;  1UV7 A;  3GDZ A;  4ILD A;  3CF5 S;  1B4B A;  4BY1 C;  1TWC A;  4A3L K;  2NVY K;  4GTF A;  3M3Y K;  5C4J K;  3N0C A;  4C3J K;  5IOT A;  3S0X A;  4G0V A;  1TWH A;  5FLM K;  4YFX A;  3GTQ A;  4M1X A;  3S16 C;  3HOX C;  3HOZ C;  1TWA A;  1R9T A;  2Y0S D;  3H3V L;  4QIW D;  4A3M C;  1PJ6 A;  3LYW A;  2E2H A;  1I50 C;  4OIO A;  2NVX K;  4GFQ A;  3FKI A;  1HQM A;  4OIQ A;  2JA7 K;  5IOR A;  4G0W A;  4BBS C;  4IOC S;  3RZO C;  4C45 A;  4Q4Z A;  5C3E K;  3S14 K;  2KXY A;  2PMZ D;  2PA8 D;  5TMC A;  1Y1V K;  5EGE A;  5JVG S;  2CW0 A;  4WIL A;  4WCE S;  2V6T A;  2YU9 A;  4BBS K;  1BGW A;  3GTL K;  2YU9 C;  4OIN A;  3TFI A;  4Y52 K;  2JA7 A;  1XZQ A;  1ZYR A;  2JA8 C;  2A6H A;  5IYB C;  4WFA S;  3DLL S;  3MML B;  2R92 K;  2L5N A;  4YG2 A;  1F9N A;  1TWG K;  1I50 A;  4A3B K;  1R9T K;  4Q5S A;  2JA6 A;  4A3F C;  4Y7N C;  3GTP A;  5D4D A;  1PJ7 A;  2JA6 C;  4XCH A;  4AYB D;  5IOQ A;  3GTK K;  3K7A K;  2GAH C;  4G7H A;  3S2H C;  4LJZ A;  5JVO A;  2JA5 K;  1FEU A;  1EI6 A;  1TWH K;  1XZP A;  4ZH4 A;  5C4X C;  1WCM K;  1ZVU A;  2NVY A;  3T01 A;  4A3D K;  1O25 A;  2E2J K;  4KAW X;  3FHZ A;  3H0G K;  5IOS A;  4A3I C;  3ERE D;  1DD5 A;  4A3G C;  3OPF A;  5M5W K;  1WOS A;  3JST A;  3QX3 A;  4BLA A;  3FOF A;  3GTM K;  2NVT K;  3CAG A;  4GTE A;  4BBR C;  4XLN A;  2R7Z C;  3HOU C;  3S15 K;  2NVQ K;  5M3F K;  1BDF A;  2R93 A;  4QJV A;  3HXA A;  1Y1W K;  1KQ4 A;  5IYC K;  4A93 C;  3G4C A;  1K83 C;  4C3I K;  3T02 A;  2CFA B;  2KWA A;  4GTL A;  4BXX C;  3NUH A;  1Y1W C;  4MEX A;  5M3M K;  3BP8 C;  2R93 K;  4AH6 A;  1HI9 A;  3T00 A;  1IS1 A;  5IP9 K;  3S1N K;  1I6V A;  4KB2 A;  2EBB A;  3AQO A;  4PAA A;  1X31 C;  2PMZ L;  4LR2 A;  1EFW A;  1J6W A;  2Y3P A;  2B63 K;  1WCM C;  4LK1 A;  4X6A C;  5IP7 C;  5E68 A;  2BE5 A;  3WOD A;  2KQ1 A;  4WJ3 M;  1I3Q C;  1ZBS A;  2B63 C;  4A3J C;  1I3Q A;  4KAS A;  4A3G K;  2B63 A;  3CQZ K;  3GEE A;  4GTB A;  1O2A A;  5DM7 S;  3GTL C;  1ZXO A;  4P9S A;  1J98 A;  3HOV C;  5M5X K;  3AD8 C;  3M3Y C;  2V6U A;  1VLO A;  2E2I A;  4BKW A;  4XSZ A;  1O2B A;  4KM8 A;  1F7U A;  1TWA C;  1R9T C;  4Y7N K;  3S1Q K;  1TWG A;  3GTQ C;  5FLM C;  1XPP A;  3SZY A;  3LPX A;  4A3M K;  2V6S A;  2E2I K;  4A3C K;  5C4X K;  3S2D K;  3V4G A;  3GTP C;  4FM9 A;  4KN7 A;  5HQH A;  4QJV B;  2FQO A;  3L4J A;  3GTM A;  1Y1V C;  4G0U A;  3I4N K;  4WFN S;  5TMF A;  4OIP A;  4U67 S;  1BJT A;  4GTA A;  1DCO A;  4GZY A;  2NVX A;  3I4N C;  4A3L C;  2JA8 K;  3ADA C;  4AYB L;  2E2H K;  4A3E C;  2ZUF A;  2ZUE A;  3HOU K;  1O29 A;  2XCQ A;  4LOW A;  5IYD K;  1I6H C;  3TTG A;  3VA7 A;  3HOW K;  3EQL A;  3HKZ D;  1WIH A;  4MQ9 A;  1USM A;  4P5B A;  1L0W A;  4BY1 K;  3HOZ K;  1F7V A;  3GIR A;  4C3I C;  2XCR B;  1F93 A;  1WSV A;  3DXJ A;  1XXA A;  4J3N A;  1XZP B;  5L46 A;  3S1R K;  3AQP A;  5C44 C;  3S16 K;  1DCP A;  1I50 K;  1TWC K;  2P5M A;  2R92 A;  4C2M K;  1K83 A;  1J6V A;  4A3D C;  3N0B A;  3GTL A;  4P5A A;  2JA7 C;  4G7Z A;  1YCL A;  5FJ8 K;  3Q3Q A;  5HL7 S;  1WOR A;  3PO3 C;  3GTG A;  2D6F C;  3OEP A;  2A68 A;  2NVT C;  5JFE A;  4A3I K;  3S17 C;  5EGH A;  2WB1 D;  2GSN A;  2R7Z K;  3S15 C;  4KMU A;  3HOV K;  4KDD A;  4WJ4 A;  4KMH A;  4YFK A;  3S1M C;  2NVY C;  4BY7 C;  1TWF C;  3LAP A;  4C3J C;  3GTK C;  1SFO C;  3PO2 C;  2VUM C;  1WQG A;  4RMF A;  1TWH C;  2R92 C;  4A3B C;  3G4A A;  4QIW L;  3FOE A;  3HKZ L;  4A3K K;  1O26 A;  3BUE A;  3S14 C;  4A3K C;  1IQ0 A;  1O24 A;  5IP9 C;  3S1N C;  3GTG C;  1J6X A;  1IE0 A;  2FQT A;  3A8I A;  3H0G C;  1GE9 A;  3TFH A;  1SFO A;  3FKI K;  3GTJ C;  4Y52 C;  1TWF A;  1G51 A;  4LK0 A;  3HOX K;  3CQZ C;  4BBR K;  2PHC B;  3I4M K;  1TWA K;  2A69 A;  1VH2 A;  4XSX A;  4XLP A;  4WF9 S;  3GTO C;  3GTQ K;  5TJ3 A;  3GEI A;  3AH5 A;  2E2J C;  1VJE A;  4BLB A;  2RGR A;  3GTO K;  1XZQ B;  3ORE A;  3M4O C;  4C3H C;  4KB4 A;  2R7Z A;  3PIP S;  1IL2 A;  1EQR A;  4IO9 S;  3PIO S;  2CFA A;  4A3J K;  1EH1 A;  3L4K A;  4C3H K;  5C3E C;  3RZO K;  3RZD C;  3A8K A;  3HOY K;  4OIR A; 
#chains in the Genus database with same CATH homology
 4JK1 A;  3I4M C;  5C44 C;  3S16 K;  1I50 K;  4BBR C;  1TWC K;  4KN4 A;  4XLN A;  2R7Z C;  4C2M K;  1YNN A;  3HOU C;  1SMY A;  2PA8 L;  3S15 K;  4A3D C;  1K83 K;  5M3F K;  5C44 K;  1BDF A;  2JA7 C;  2NVQ K;  3S2D C;  3PO2 K;  4G7Z A;  4QJV A;  2WAQ L;  5FJ8 K;  1Y1W K;  3GTG K;  5IYC K;  4A93 C;  1K83 C;  2NVQ C;  3S2H K;  4MEY A;  2PPB A;  4C3I K;  2O5I A;  5M5Y K;  2YU9 K;  3S17 K;  4BXX C;  4A93 K;  3PO3 C;  4A3E K;  1Y1W C;  4MEX A;  3GTM C;  2O5J A;  5M3M K;  5IYD C;  2VUM K;  2R93 K;  2A68 A;  3H3V D;  2NVT C;  2Y0S L;  4A3I K;  3S17 C;  5IP9 K;  3S1N K;  1I6V A;  2WB1 D;  2R7Z K;  3S15 C;  4BY1 C;  4YFN A;  2NVY K;  4KMU A;  2PMZ L;  4A3L K;  3HOV K;  3M3Y K;  2B63 K;  1WCM C;  4LK1 A;  5C4J K;  4X6A C;  1I3Q K;  4C3J K;  5IP7 C;  4YFK A;  3S1M C;  2BE5 A;  2NVY C;  1TWF C;  3WOD A;  4BY7 C;  5FLM K;  4YFX A;  1I3Q C;  4C3J C;  3GTK C;  3HOX C;  3HOZ C;  3S16 C;  2B63 C;  1SFO C;  5IYB K;  4A3J C;  4OIR A;  3PO2 C;  2VUM C;  4A3G K;  1TWH C;  2R92 C;  4A3B C;  2Y0S D;  3H3V L;  3CQZ K;  4QIW L;  4QIW D;  1TWG C;  4A3M C;  3HKZ L;  3GTL C;  4A3K K;  1I50 C;  3HOV C;  3FKI C;  5M5X K;  4OIO A;  3PO3 K;  2NVX K;  3M3Y C;  1HQM A;  4OIQ A;  3S14 C;  4A3K C;  2JA7 K;  2JA5 C;  4BBS C;  4BY7 K;  5IP9 C;  3S1N C;  3RZO C;  4XSZ A;  4Q4Z A;  3GTG C;  5C3E K;  3S14 K;  1TWA C;  2PMZ D;  2PA8 D;  5TMC A;  1Y1V K;  4A3F K;  1R9T C;  2JA6 K;  2A6E A;  2CW0 A;  4Y7N K;  3S1Q K;  3H0G C;  1I6H K;  4A3C C;  4BBS K;  3K7A C;  3GTQ C;  3GTL K;  2YU9 C;  4OIN A;  5FLM C;  1XPP A;  4A3M K;  3S1M K;  4Y52 K;  2E2I K;  2R93 C;  1ZYR A;  4A3C K;  3FKI K;  3GTJ C;  2JA8 C;  2NVX C;  5C4X K;  3S2D K;  2A6H A;  5IYB C;  4Y52 C;  1SFO K;  3S1R C;  3GTP C;  4LK0 A;  3HOX K;  4NOI A;  3CQZ C;  4KN7 A;  3M4O K;  1TWC C;  4BBR K;  2R92 K;  4YG2 A;  1TWG K;  4LLG A;  4QJV B;  4C2M C;  3I4M K;  4A3B K;  1R9T K;  4Q5S A;  1Y1V C;  2A69 A;  4Y7N C;  4A3F C;  5D4D A;  1TWA K;  3I4N K;  2JA6 C;  4AYB D;  5TMF A;  4OIP A;  4XSX A;  3GTK K;  4XLP A;  3GTO C;  3K7A K;  3GTQ K;  3RZD K;  4G7H A;  2E2H C;  3S2H C;  4LJZ A;  4G7O A;  4GZY A;  1TWH K;  2JA5 K;  3I4N C;  3HOY C;  4ZH4 A;  5C4X C;  4A3L C;  5C4J C;  1WCM K;  3GTJ K;  2E2J C;  1IW7 A;  2E2H K;  4AYB L;  2JA8 K;  4A3E C;  3HOW C;  3GTO K;  4A3D K;  4BXX K;  3HOU K;  3M4O C;  4C3H C;  2WAQ D;  2E2J K;  5IYD K;  1I6H C;  3H0G K;  3HOW K;  4A3I C;  5IYC C;  3EQL A;  3HKZ D;  4MQ9 A;  3HOZ K;  4A3G C;  4BY1 K;  5M5W K;  4A3J K;  2E2I C;  4C3H K;  5C3E C;  2WB1 L;  3GTP K;  4C3I C;  3RZO K;  3RZD C;  3DXJ A;  4X6A K;  1TWF K;  3S1R K;  3S1Q C;  3HOY K;  5IP7 K;  3GTM K;  2NVT K;  1YNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...