3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
2R92C 4A3LK 3HOVC 2VUMC 1SFOC 3CQZC 3DXJA 4C3JK 4XSZA 4QJVA 5M5WK 5M5YK 5IYBK 2PMZL 3GTGK 3S1QK 2JA8C 1I6HK 4G7OA 1WCMK 4G7HA 3I4MK 3HKZL 5FLMK 3HKZD 4YFNA 4A3IC 2E2JC 4C3IC 4MQ9A 4A3FC 4BY7C 2NVYK 1YNNA 3H0GK 4A3DK 1YNJA 4XSXA 5IYBC 5FLMC 3PO2K 3S1NC 2PMZD 2NVXK 3GTOK 1I6VA 4XLNA 1ZYRA 1Y1WC 3H3VD 2O5IA 3GTLK 2JA7C 4C2MC 5IP9C 4A3BC 4BY7K 2CW0A 5C4JK 2B63C 3S16K 3RZOK 4GZYA 2NVQK 1K83C 4A3LC 4BBSK 2O5JA 5C3EK 2R93K 3GTKC 2R7ZC 3HOWK 2PPBA 2JA6K 4ZH4A 4YFKA 2JA5K 2A6EA 4A3MC 3GTLC 1TWAC 4OIQA 1R9TK 3S2DC 4A3KK 4A3EC 4A3CC 2E2IK 1TWCC 3GTGC 1TWFC 3I4MC 5TMCA 3HOVK 4OINA 3S2HC 2E2HC 1I6HC 4BXXC 3HOZK 3H0GC 4A3IK 4A3MK 2E2JK 1I3QC 4Q4ZA 3I4NK 5FJ8K 3HOXC 1TWHC 4MEYA 3RZDC 3S1MK 1TWGC 4A3JC 3CQZK 4Y7NC 2B63K 5M3MK 3K7AC 3S17K 4Y52K 5IYDK 3S1RC 3HOZC 4OIRA 2WAQD 4BXXK 3GTPC 3GTKK 4X6AK 1Y1VK 4Y7NK 3GTOC 4NOIA 3GTMC 4AYBD 2A6HA 5IP7C 4KMUA 1TWFK 4AYBL 4BBRK 3S1MC 2YU9K 3M3YK 1I50C 4A93K 4LLGA 2BE5A 3GTQK 1SMYA 2NVTC 5IYCK 2Y0SD 3S1RK 5C3EC 2R93C 4JK1A 3H3VL 4OIOA 3PO2C 4BY1C 1TWGK 4YG2A 5C44C 3S1QC 3M3YC 3HOXK 4QIWL 3RZDK 3K7AK 2PA8L 4QIWD 4LJZA 3S15K 1BDFA 3HOWC 2R7ZK 4MEXA 3PO3C 4QJVB 3M4OK 2WB1L 2WB1D 4A3KC 2E2IC 3S2DK 4C3JC 3GTJC 1SFOK 3M4OC 4A3DC 4LK0A 2JA6C 3HOUC 4Q5SA 4A3GC 1TWHK 4LK1A 2PA8D 3FKIK 3EQLA 2A69A 3HOYK 5TMFA 4XLPA 5D4DA 3GTJK 1TWCK 2E2HK 5C44K 2JA8K 3S14C 2NVQC 1IW7A 4A93C 1I50K 2JA7K 4KN7A 2VUMK 3HOYC 5C4JC 3GTMK 3S15C 4C3IK 2NVTK 4C3HC 3FKIC 2NVXC 1I3QK 4OIPA 1R9TC 1K83K 1TWAK 4KN4A 4Y52C 5IYDC 3S17C 1XPPA 5M3FK 5C4XC 3S1NK 4BY1K 3S14K 4A3JK 4A3FK 1Y1VC 4YFXA 3PO3K 2YU9C 5IP7K 5M5XK 2R92K 2A68A 1HQMA 2NVYC 4BBSC 5IP9K 3GTPK 3GTQC 3HOUK 4A3GK 4X6AC 3RZOC 2Y0SL 3S2HK 4BBRC 1WCMC 2WAQL 5C4XK 4A3EK 4A3CK 4C2MK 3WODA 4A3BK 3I4NC 2JA5C 3S16C 1Y1WK 4C3HK 5IYCC 4G7ZA
chains in the Genus database with same CATH superfamily
3A8KA 3CQZC 3BP8C 4XSZA 2JA7A 3S1QK 4PAAA 4G7HA 3QX3A 5FLMK 3AQPA 5E68A 1K83A 1VLOA 4WFAS 1VH2A 4KMDA 3PO2K 1G51A 4GFQA 3ERED 1ZYRA 3SZYA 3GTLK 1EI6A 1IBAA 4G0WA 3G4CA 5IP9C 4IO9S 3H0GA 4AH6A 2NVQK 1K83C 2Y3PA 4A3LC 1PJ7A 2JA6K 3LAJA 1TWAC 3MMLB 1J6WA 1TWFC 4OINA 3S2HC 3GTLA 3FOFA 1I3QC 3I4NK 4KC6A 5FJ8K 3RZDC 4IOAS 1TWGC 4A3JC 5M3MK 3S17K 5IYDK 4OIRA 1O24A 3IPJA 2FQOA 3LAPA 5HL7S 4Y7NK 3GTOC 4P5BA 2YU9K 1TWFK 4AYBL 4RMFA 3S1MC 4A93K 4LLGA 2BE5A 4FM9A 3S1RK 2JA6A 5C3EC 2R93C 1F7UA 1WOOA 1TWGK 3TTGA 1WQFA 5EGEA 4QIWL 4ILDA 4KATA 1F9NA 3GTMA 1I50A 4GTFA 1VGXA 1J98A 1YX2A 4WF9S 4KARA 4C3JC 1I3QA 2JA6C 3OPFA 1X31C 1TWHK 1TWHA 2PA8D 1Y1VA 2A69A 3HOYK 4XLPA 5C44K 5JVHS 2NVQC 5HL8A 2JA7K 1I50K 2P8TA 4KN7A 3GTMK 3G4AA 4OIPA 1TWAK 1EFWA 1JQWA 4KN4A 5IYDC 3S17C 4BY1K 2L5NA 1WCMA 4A3JK 3S14K 2B63A 1Y1VC 3PIPS 5IP7K 2R92K 2NVXA 4KDDA 5IP9K 3GTPK 5L46A 4A3GK 4X6AC 4WJ3M 4A3EK 2XCOA 3WODA 1WSVA 3GSIA 1RU0A 2VUMC 5M5YK 3DXJA 5M5WK 1I6HK 1F7VA 3L4JA 3V4GA 3I4MK 3HKZL 4YFNA 4MQ9A 4A3FC 4BY7C 1J6XA 1ZXOA 4GTAA 4G0VA 4GTCA 1SFOA 4GTLA 5CJ9A 1EK8A 2NVXK 2R92A 3GTOK 3GTGA 2O5IA 4C2MC 4A3BC 1IE0A 5C4JK 3SZZA 3HXAA 2R7ZC 2PPBA 1BGWA 4ZH4A 2JA5K 4A3MC 3GTLC 3S2DC 4A3CC 2GAGC 3GTGC 1WOPA 4BLAA 3HOVK 3AD9C 2V6UA 4BXXC 4O2DA 3HOZK 2E2JK 3Q3QA 1EH1A 3BP3A 4KASA 1F93A 3CQZK 3LPXA 3N0CA 5IOQA 2KWAA 2W7VA 3GTPC 3GTKK 2ZJPS 2XCQA 2KPUA 2A6HA 4KMUA 4GTEA 4KB2A 4M1XA 3JSTA 2CFAB 2E2IA 1XZPA 2Y0SD 3GTJA 4JK1A 3AD8C 1ZQ1C 4YG2A 5C44C 2EBBA 2V6SA 3M3YC 2V6TA 3HOXK 3FOEA 4QIWD 2RH6A 4KMAA 4MEXA 1O28A 4QJVB 2R93A 3GIRA 4LOWA 4U67S 3S2DK 2E2HA 5TJ3A 4A3DC 2ZJRS 3GTJK 1VRQC 4GT9A 2GSNA 1IW7A 5JVGS 2VUMK 3HOYC 4BLBA 3VA7A 2NVXC 2NVYA 4XCHA 5M3FK 5C4XC 3T01A 4WILA 4A3FK 2YU9C 5M5XK 2L3UA 1USMA 5IOTA 3HOUK 1ZBSA 4KB4A 2Y0SL 1WCMC 4KM8A 4C2MK 4A3BK 4J3NA 3OREA 3S0XA 4A3LK 2ZJQS 5DM7S 1SFOC 1YCLA 5IYBK 4QJVA 1O26A 4X6AK 3TFHA 2JA8C 1INNA 1L0WA 2E2JC 2NVYK 4C3IC 1YNNA 2GSOA 2D6FC 1VJEA 5FLMC 3LYWA 3GTOA 1R9TA 4XLNA 4WFNS 1Y1WC 4GTBA 3N3YA 4KMHA 2JA7C 4BY7K 1J6VA 3S16K 3PIOS 3RZOK 1WSRA 3OEPA 4C45A 3A8IA 4BBSK 5C3EK 2R93K 3GTKC 3HOWK 1HI9A 4YFKA 4OIQA 1XZPB 5TMCA 3H0GC 4A3IK 4A3MK 3GEEA 1TWCA 1TWHC 2KXYA 3A8JA 1WORA 1WOSA 2B63K 3S1RC 2XCRB 4LR2A 2WAQD 3NUHA 3GTMC 4AYBD 5CHPA 4BBRK 1I50C 1SMYA 3TFIA 4OIOA 4BY1C 1WIHA 1XZQA 3RZDK 3K7AK 3GEIA 1O25A 3AH5A 1DCPA 1BDFA 1FEUA 2R7ZK 3M4OK 1XXAA 2WB1L 4KAWX 4LK0A 4Q5SA 4A3GC 4G0UA 3FKIA 1IL2A 4LK1A 3FKIK 2ZUEA 5D4DA 1TWCK 3GEHA 4KM9A 3S14C 2JA8K 4FZBA 4A93C 1EQRA 1ZVUA 1B4AA 1DCHA 2YU9A 2NVTK 1GE9A 2GSUA 3TFJA 1XPPA 3AD7C 3PO3K 4BKWA 2RGRA 1O29A 2KQ1A 1XZQB 4P5AA 2NVYC 2JH3A 4BBSC 3RZOC 3S2HK 4BBRC 2WAQL 5C4XK 4A3CK 4WJ4A 1KQ4A 2JA5C 1Y1WK 5HQHA 5IYCC 4G7ZA 4C3HK 2R92C 3HOVC 5JFEA 4C3JK 2PMZL 3GTGK 4G7OA 1WCMK 1Y1WA 2CFAA 3HKZD 4A3IC 3H0GK 4WCES 3CQZA 3N0BA 5EGHA 4A3DK 1YNJA 4XSXA 5IYBC 1XXBA 3S1NC 2PMZD 4DDQA 1I6VA 5IOSA 5JVOA 3H3VD 1C0AA 2CW0A 2B63C 4GZYA 1IS1A 3CF5S 2O5JA 1JVIA 3L4KA 1XXCA 2A6EA 1R9TK 1BJTA 4A3KK 4A3EC 2E2IK 4PABA 1TWCC 1TWGA 3I4MC 3BUEA 2VUMA 2E2HC 3GTKA 1I6HC 2ZUFA 3FHZA 1PJ5A 1V5VA 4Q4ZA 3T00A 1TWAA 3HOXC 3GDZA 4MEYA 1WQHA 2R7ZA 1IQ0A 3S1MK 5DM6S 1TWFA 4Y7NC 3K7AC 4IOCS 4Y52K 3HOZC 4BXXK 3ADAC 1Y1VK 4NOIA 5IP7C 1ISEA 3M3YK 1DCOA 1B4BA 3GTQK 5IORA 2NVTC 5IYCK 2ZFZA 3H3VL 1WQGA 4LQYA 3PO2C 3S1QC 4P9SA 1JOEA 3GTPA 2PA8L 4WFBS 2GAHC 4LJZA 3S15K 3HOWC 3PO3C 4GTDA 2WB1D 4A3KC 2E2IC 1SFOK 3GTJC 3M4OC 1O27A 3HOUC 1BS2A 3EQLA 5TMFA 2E2HK 3DLLS 1PJ6A 3AQOA 3GTQA 1DD5A 1O2BA 5C4JC 1USOA 3S15C 4C3IK 4C3HC 3FKIC 1AB4A 1I3QK 1R9TC 1K83K 2FQTA 4Y52C 3S1NK 1O2FB 1O2AA 4YFXA 2P5MA 2JA5A 2A68A 1HQMA 2PHCB 1UV7A 3GTQC 3CAGA 3I4NC 3S16C 3T02A
chains in the Genus database with same CATH topology
2R92C 4A3LK 3HOVC 2VUMC 1SFOC 3CQZC 3DXJA 4C3JK 4XSZA 4QJVA 5M5WK 5M5YK 5IYBK 2PMZL 3GTGK 3S1QK 2JA8C 1I6HK 4G7OA 1WCMK 4G7HA 3I4MK 3HKZL 5FLMK 3HKZD 4YFNA 4A3IC 2E2JC 4C3IC 4MQ9A 4A3FC 4BY7C 2NVYK 1YNNA 3H0GK 4A3DK 1YNJA 4XSXA 5IYBC 5FLMC 3PO2K 3S1NC 2PMZD 2NVXK 3GTOK 1I6VA 4XLNA 1ZYRA 1Y1WC 3H3VD 2O5IA 3GTLK 2JA7C 4C2MC 5IP9C 4A3BC 4BY7K 2CW0A 5C4JK 2B63C 3S16K 3RZOK 4GZYA 2NVQK 1K83C 4A3LC 4BBSK 2O5JA 5C3EK 2R93K 3GTKC 2R7ZC 3HOWK 2PPBA 2JA6K 4ZH4A 4YFKA 2JA5K 2A6EA 4A3MC 3GTLC 1TWAC 4OIQA 1R9TK 3S2DC 4A3KK 4A3EC 4A3CC 2E2IK 1TWCC 3GTGC 1TWFC 3I4MC 5TMCA 3HOVK 4OINA 3S2HC 2E2HC 1I6HC 4BXXC 3HOZK 3H0GC 4A3IK 4A3MK 2E2JK 1I3QC 4Q4ZA 3I4NK 5FJ8K 3HOXC 1TWHC 4MEYA 3RZDC 3S1MK 1TWGC 4A3JC 3CQZK 4Y7NC 2B63K 5M3MK 3K7AC 3S17K 4Y52K 5IYDK 3S1RC 3HOZC 4OIRA 2WAQD 4BXXK 3GTPC 3GTKK 4X6AK 1Y1VK 4Y7NK 3GTOC 4NOIA 3GTMC 4AYBD 2A6HA 5IP7C 4KMUA 1TWFK 4AYBL 4BBRK 3S1MC 2YU9K 3M3YK 1I50C 4A93K 4LLGA 2BE5A 3GTQK 1SMYA 2NVTC 5IYCK 2Y0SD 3S1RK 5C3EC 2R93C 4JK1A 3H3VL 4OIOA 3PO2C 4BY1C 1TWGK 4YG2A 5C44C 3S1QC 3M3YC 3HOXK 4QIWL 3RZDK 3K7AK 2PA8L 4QIWD 4LJZA 3S15K 1BDFA 3HOWC 2R7ZK 4MEXA 3PO3C 4QJVB 3M4OK 2WB1L 2WB1D 4A3KC 2E2IC 3S2DK 4C3JC 3GTJC 1SFOK 3M4OC 4A3DC 4LK0A 2JA6C 3HOUC 4Q5SA 4A3GC 1TWHK 4LK1A 2PA8D 3FKIK 3EQLA 2A69A 3HOYK 5TMFA 4XLPA 5D4DA 3GTJK 1TWCK 2E2HK 5C44K 2JA8K 3S14C 2NVQC 1IW7A 4A93C 1I50K 2JA7K 4KN7A 2VUMK 3HOYC 5C4JC 3GTMK 3S15C 4C3IK 2NVTK 4C3HC 3FKIC 2NVXC 1I3QK 4OIPA 1R9TC 1K83K 1TWAK 4KN4A 4Y52C 5IYDC 3S17C 1XPPA 5M3FK 5C4XC 3S1NK 4BY1K 3S14K 4A3JK 4A3FK 1Y1VC 4YFXA 3PO3K 2YU9C 5IP7K 5M5XK 2R92K 2A68A 1HQMA 2NVYC 4BBSC 5IP9K 3GTPK 3GTQC 3HOUK 4A3GK 4X6AC 3RZOC 2Y0SL 3S2HK 4BBRC 1WCMC 2WAQL 5C4XK 4A3EK 4A3CK 4C2MK 3WODA 4A3BK 3I4NC 2JA5C 3S16C 1Y1WK 4C3HK 5IYCC 4G7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 C;  4A3L K;  3HOV C;  2VUM C;  1SFO C;  3CQZ C;  3DXJ A;  4C3J K;  4XSZ A;  4QJV A;  5M5W K;  5M5Y K;  5IYB K;  2PMZ L;  3GTG K;  3S1Q K;  2JA8 C;  1I6H K;  4G7O A;  1WCM K;  4G7H A;  3I4M K;  3HKZ L;  5FLM K;  3HKZ D;  4YFN A;  4A3I C;  2E2J C;  4C3I C;  4MQ9 A;  4A3F C;  4BY7 C;  2NVY K;  1YNN A;  3H0G K;  4A3D K;  1YNJ A;  4XSX A;  5IYB C;  5FLM C;  3PO2 K;  3S1N C;  2PMZ D;  2NVX K;  3GTO K;  1I6V A;  4XLN A;  1ZYR A;  1Y1W C;  3H3V D;  2O5I A;  3GTL K;  2JA7 C;  4C2M C;  5IP9 C;  4A3B C;  4BY7 K;  2CW0 A;  5C4J K;  2B63 C;  3S16 K;  3RZO K;  4GZY A;  2NVQ K;  1K83 C;  4A3L C;  4BBS K;  2O5J A;  5C3E K;  2R93 K;  3GTK C;  2R7Z C;  3HOW K;  2PPB A;  2JA6 K;  4ZH4 A;  4YFK A;  2JA5 K;  2A6E A;  4A3M C;  3GTL C;  1TWA C;  4OIQ A;  1R9T K;  3S2D C;  4A3K K;  4A3E C;  4A3C C;  2E2I K;  1TWC C;  3GTG C;  1TWF C;  3I4M C;  5TMC A;  3HOV K;  4OIN A;  3S2H C;  2E2H C;  1I6H C;  4BXX C;  3HOZ K;  3H0G C;  4A3I K;  4A3M K;  2E2J K;  1I3Q C;  4Q4Z A;  3I4N K;  5FJ8 K;  3HOX C;  1TWH C;  4MEY A;  3RZD C;  3S1M K;  1TWG C;  4A3J C;  3CQZ K;  4Y7N C;  2B63 K;  5M3M K;  3K7A C;  3S17 K;  4Y52 K;  5IYD K;  3S1R C;  3HOZ C;  4OIR A;  2WAQ D;  4BXX K;  3GTP C;  3GTK K;  4X6A K;  1Y1V K;  4Y7N K;  3GTO C;  4NOI A;  3GTM C;  4AYB D;  2A6H A;  5IP7 C;  4KMU A;  1TWF K;  4AYB L;  4BBR K;  3S1M C;  2YU9 K;  3M3Y K;  1I50 C;  4A93 K;  4LLG A;  2BE5 A;  3GTQ K;  1SMY A;  2NVT C;  5IYC K;  2Y0S D;  3S1R K;  5C3E C;  2R93 C;  4JK1 A;  3H3V L;  4OIO A;  3PO2 C;  4BY1 C;  1TWG K;  4YG2 A;  5C44 C;  3S1Q C;  3M3Y C;  3HOX K;  4QIW L;  3RZD K;  3K7A K;  2PA8 L;  4QIW D;  4LJZ A;  3S15 K;  1BDF A;  3HOW C;  2R7Z K;  4MEX A;  3PO3 C;  4QJV B;  3M4O K;  2WB1 L;  2WB1 D;  4A3K C;  2E2I C;  3S2D K;  4C3J C;  3GTJ C;  1SFO K;  3M4O C;  4A3D C;  4LK0 A;  2JA6 C;  3HOU C;  4Q5S A;  4A3G C;  1TWH K;  4LK1 A;  2PA8 D;  3FKI K;  3EQL A;  2A69 A;  3HOY K;  5TMF A;  4XLP A;  5D4D A;  3GTJ K;  1TWC K;  2E2H K;  5C44 K;  2JA8 K;  3S14 C;  2NVQ C;  1IW7 A;  4A93 C;  1I50 K;  2JA7 K;  4KN7 A;  2VUM K;  3HOY C;  5C4J C;  3GTM K;  3S15 C;  4C3I K;  2NVT K;  4C3H C;  3FKI C;  2NVX C;  1I3Q K;  4OIP A;  1R9T C;  1K83 K;  1TWA K;  4KN4 A;  4Y52 C;  5IYD C;  3S17 C;  1XPP A;  5M3F K;  5C4X C;  3S1N K;  4BY1 K;  3S14 K;  4A3J K;  4A3F K;  1Y1V C;  4YFX A;  3PO3 K;  2YU9 C;  5IP7 K;  5M5X K;  2R92 K;  2A68 A;  1HQM A;  2NVY C;  4BBS C;  5IP9 K;  3GTP K;  3GTQ C;  3HOU K;  4A3G K;  4X6A C;  3RZO C;  2Y0S L;  3S2H K;  4BBR C;  1WCM C;  2WAQ L;  5C4X K;  4A3E K;  4A3C K;  4C2M K;  3WOD A;  4A3B K;  3I4N C;  2JA5 C;  3S16 C;  1Y1W K;  4C3H K;  5IYC C;  4G7Z A; 
#chains in the Genus database with same CATH topology
 3A8K A;  3CQZ C;  3BP8 C;  4XSZ A;  2JA7 A;  3S1Q K;  4PAA A;  4G7H A;  3QX3 A;  5FLM K;  3AQP A;  5E68 A;  1K83 A;  1VLO A;  4WFA S;  1VH2 A;  4KMD A;  3PO2 K;  1G51 A;  4GFQ A;  3ERE D;  1ZYR A;  3SZY A;  3GTL K;  1EI6 A;  1IBA A;  4G0W A;  3G4C A;  5IP9 C;  4IO9 S;  3H0G A;  4AH6 A;  2NVQ K;  1K83 C;  2Y3P A;  4A3L C;  1PJ7 A;  2JA6 K;  3LAJ A;  1TWA C;  3MML B;  1J6W A;  1TWF C;  4OIN A;  3S2H C;  3GTL A;  3FOF A;  1I3Q C;  3I4N K;  4KC6 A;  5FJ8 K;  3RZD C;  4IOA S;  1TWG C;  4A3J C;  5M3M K;  3S17 K;  5IYD K;  4OIR A;  1O24 A;  3IPJ A;  2FQO A;  3LAP A;  5HL7 S;  4Y7N K;  3GTO C;  4P5B A;  2YU9 K;  1TWF K;  4AYB L;  4RMF A;  3S1M C;  4A93 K;  4LLG A;  2BE5 A;  4FM9 A;  3S1R K;  2JA6 A;  5C3E C;  2R93 C;  1F7U A;  1WOO A;  1TWG K;  3TTG A;  1WQF A;  5EGE A;  4QIW L;  4ILD A;  4KAT A;  1F9N A;  3GTM A;  1I50 A;  4GTF A;  1VGX A;  1J98 A;  1YX2 A;  4WF9 S;  4KAR A;  4C3J C;  1I3Q A;  2JA6 C;  3OPF A;  1X31 C;  1TWH K;  1TWH A;  2PA8 D;  1Y1V A;  2A69 A;  3HOY K;  4XLP A;  5C44 K;  5JVH S;  2NVQ C;  5HL8 A;  2JA7 K;  1I50 K;  2P8T A;  4KN7 A;  3GTM K;  3G4A A;  4OIP A;  1TWA K;  1EFW A;  1JQW A;  4KN4 A;  5IYD C;  3S17 C;  4BY1 K;  2L5N A;  1WCM A;  4A3J K;  3S14 K;  2B63 A;  1Y1V C;  3PIP S;  5IP7 K;  2R92 K;  2NVX A;  4KDD A;  5IP9 K;  3GTP K;  5L46 A;  4A3G K;  4X6A C;  4WJ3 M;  4A3E K;  2XCO A;  3WOD A;  1WSV A;  3GSI A;  1RU0 A;  2VUM C;  5M5Y K;  3DXJ A;  5M5W K;  1I6H K;  1F7V A;  3L4J A;  3V4G A;  3I4M K;  3HKZ L;  4YFN A;  4MQ9 A;  4A3F C;  4BY7 C;  1J6X A;  1ZXO A;  4GTA A;  4G0V A;  4GTC A;  1SFO A;  4GTL A;  5CJ9 A;  1EK8 A;  2NVX K;  2R92 A;  3GTO K;  3GTG A;  2O5I A;  4C2M C;  4A3B C;  1IE0 A;  5C4J K;  3SZZ A;  3HXA A;  2R7Z C;  2PPB A;  1BGW A;  4ZH4 A;  2JA5 K;  4A3M C;  3GTL C;  3S2D C;  4A3C C;  2GAG C;  3GTG C;  1WOP A;  4BLA A;  3HOV K;  3AD9 C;  2V6U A;  4BXX C;  4O2D A;  3HOZ K;  2E2J K;  3Q3Q A;  1EH1 A;  3BP3 A;  4KAS A;  1F93 A;  3CQZ K;  3LPX A;  3N0C A;  5IOQ A;  2KWA A;  2W7V A;  3GTP C;  3GTK K;  2ZJP S;  2XCQ A;  2KPU A;  2A6H A;  4KMU A;  4GTE A;  4KB2 A;  4M1X A;  3JST A;  2CFA B;  2E2I A;  1XZP A;  2Y0S D;  3GTJ A;  4JK1 A;  3AD8 C;  1ZQ1 C;  4YG2 A;  5C44 C;  2EBB A;  2V6S A;  3M3Y C;  2V6T A;  3HOX K;  3FOE A;  4QIW D;  2RH6 A;  4KMA A;  4MEX A;  1O28 A;  4QJV B;  2R93 A;  3GIR A;  4LOW A;  4U67 S;  3S2D K;  2E2H A;  5TJ3 A;  4A3D C;  2ZJR S;  3GTJ K;  1VRQ C;  4GT9 A;  2GSN A;  1IW7 A;  5JVG S;  2VUM K;  3HOY C;  4BLB A;  3VA7 A;  2NVX C;  2NVY A;  4XCH A;  5M3F K;  5C4X C;  3T01 A;  4WIL A;  4A3F K;  2YU9 C;  5M5X K;  2L3U A;  1USM A;  5IOT A;  3HOU K;  1ZBS A;  4KB4 A;  2Y0S L;  1WCM C;  4KM8 A;  4C2M K;  4A3B K;  4J3N A;  3ORE A;  3S0X A;  4A3L K;  2ZJQ S;  5DM7 S;  1SFO C;  1YCL A;  5IYB K;  4QJV A;  1O26 A;  4X6A K;  3TFH A;  2JA8 C;  1INN A;  1L0W A;  2E2J C;  2NVY K;  4C3I C;  1YNN A;  2GSO A;  2D6F C;  1VJE A;  5FLM C;  3LYW A;  3GTO A;  1R9T A;  4XLN A;  4WFN S;  1Y1W C;  4GTB A;  3N3Y A;  4KMH A;  2JA7 C;  4BY7 K;  1J6V A;  3S16 K;  3PIO S;  3RZO K;  1WSR A;  3OEP A;  4C45 A;  3A8I A;  4BBS K;  5C3E K;  2R93 K;  3GTK C;  3HOW K;  1HI9 A;  4YFK A;  4OIQ A;  1XZP B;  5TMC A;  3H0G C;  4A3I K;  4A3M K;  3GEE A;  1TWC A;  1TWH C;  2KXY A;  3A8J A;  1WOR A;  1WOS A;  2B63 K;  3S1R C;  2XCR B;  4LR2 A;  2WAQ D;  3NUH A;  3GTM C;  4AYB D;  5CHP A;  4BBR K;  1I50 C;  1SMY A;  3TFI A;  4OIO A;  4BY1 C;  1WIH A;  1XZQ A;  3RZD K;  3K7A K;  3GEI A;  1O25 A;  3AH5 A;  1DCP A;  1BDF A;  1FEU A;  2R7Z K;  3M4O K;  1XXA A;  2WB1 L;  4KAW X;  4LK0 A;  4Q5S A;  4A3G C;  4G0U A;  3FKI A;  1IL2 A;  4LK1 A;  3FKI K;  2ZUE A;  5D4D A;  1TWC K;  3GEH A;  4KM9 A;  3S14 C;  2JA8 K;  4FZB A;  4A93 C;  1EQR A;  1ZVU A;  1B4A A;  1DCH A;  2YU9 A;  2NVT K;  1GE9 A;  2GSU A;  3TFJ A;  1XPP A;  3AD7 C;  3PO3 K;  4BKW A;  2RGR A;  1O29 A;  2KQ1 A;  1XZQ B;  4P5A A;  2NVY C;  2JH3 A;  4BBS C;  3RZO C;  3S2H K;  4BBR C;  2WAQ L;  5C4X K;  4A3C K;  4WJ4 A;  1KQ4 A;  2JA5 C;  1Y1W K;  5HQH A;  5IYC C;  4G7Z A;  4C3H K;  2R92 C;  3HOV C;  5JFE A;  4C3J K;  2PMZ L;  3GTG K;  4G7O A;  1WCM K;  1Y1W A;  2CFA A;  3HKZ D;  4A3I C;  3H0G K;  4WCE S;  3CQZ A;  3N0B A;  5EGH A;  4A3D K;  1YNJ A;  4XSX A;  5IYB C;  1XXB A;  3S1N C;  2PMZ D;  4DDQ A;  1I6V A;  5IOS A;  5JVO A;  3H3V D;  1C0A A;  2CW0 A;  2B63 C;  4GZY A;  1IS1 A;  3CF5 S;  2O5J A;  1JVI A;  3L4K A;  1XXC A;  2A6E A;  1R9T K;  1BJT A;  4A3K K;  4A3E C;  2E2I K;  4PAB A;  1TWC C;  1TWG A;  3I4M C;  3BUE A;  2VUM A;  2E2H C;  3GTK A;  1I6H C;  2ZUF A;  3FHZ A;  1PJ5 A;  1V5V A;  4Q4Z A;  3T00 A;  1TWA A;  3HOX C;  3GDZ A;  4MEY A;  1WQH A;  2R7Z A;  1IQ0 A;  3S1M K;  5DM6 S;  1TWF A;  4Y7N C;  3K7A C;  4IOC S;  4Y52 K;  3HOZ C;  4BXX K;  3ADA C;  1Y1V K;  4NOI A;  5IP7 C;  1ISE A;  3M3Y K;  1DCO A;  1B4B A;  3GTQ K;  5IOR A;  2NVT C;  5IYC K;  2ZFZ A;  3H3V L;  1WQG A;  4LQY A;  3PO2 C;  3S1Q C;  4P9S A;  1JOE A;  3GTP A;  2PA8 L;  4WFB S;  2GAH C;  4LJZ A;  3S15 K;  3HOW C;  3PO3 C;  4GTD A;  2WB1 D;  4A3K C;  2E2I C;  1SFO K;  3GTJ C;  3M4O C;  1O27 A;  3HOU C;  1BS2 A;  3EQL A;  5TMF A;  2E2H K;  3DLL S;  1PJ6 A;  3AQO A;  3GTQ A;  1DD5 A;  1O2B A;  5C4J C;  1USO A;  3S15 C;  4C3I K;  4C3H C;  3FKI C;  1AB4 A;  1I3Q K;  1R9T C;  1K83 K;  2FQT A;  4Y52 C;  3S1N K;  1O2F B;  1O2A A;  4YFX A;  2P5M A;  2JA5 A;  2A68 A;  1HQM A;  2PHC B;  1UV7 A;  3GTQ C;  3CAG A;  3I4N C;  3S16 C;  3T02 A; 
#chains in the Genus database with same CATH homology
 2R92 C;  4A3L K;  3HOV C;  2VUM C;  1SFO C;  3CQZ C;  3DXJ A;  4C3J K;  4XSZ A;  4QJV A;  5M5W K;  5M5Y K;  5IYB K;  2PMZ L;  3GTG K;  3S1Q K;  2JA8 C;  1I6H K;  4G7O A;  1WCM K;  4G7H A;  3I4M K;  3HKZ L;  5FLM K;  3HKZ D;  4YFN A;  4A3I C;  2E2J C;  4C3I C;  4MQ9 A;  4A3F C;  4BY7 C;  2NVY K;  1YNN A;  3H0G K;  4A3D K;  1YNJ A;  4XSX A;  5IYB C;  5FLM C;  3PO2 K;  3S1N C;  2PMZ D;  2NVX K;  3GTO K;  1I6V A;  4XLN A;  1ZYR A;  1Y1W C;  3H3V D;  2O5I A;  3GTL K;  2JA7 C;  4C2M C;  5IP9 C;  4A3B C;  4BY7 K;  2CW0 A;  5C4J K;  2B63 C;  3S16 K;  3RZO K;  4GZY A;  2NVQ K;  1K83 C;  4A3L C;  4BBS K;  2O5J A;  5C3E K;  2R93 K;  3GTK C;  2R7Z C;  3HOW K;  2PPB A;  2JA6 K;  4ZH4 A;  4YFK A;  2JA5 K;  2A6E A;  4A3M C;  3GTL C;  1TWA C;  4OIQ A;  1R9T K;  3S2D C;  4A3K K;  4A3E C;  4A3C C;  2E2I K;  1TWC C;  3GTG C;  1TWF C;  3I4M C;  5TMC A;  3HOV K;  4OIN A;  3S2H C;  2E2H C;  1I6H C;  4BXX C;  3HOZ K;  3H0G C;  4A3I K;  4A3M K;  2E2J K;  1I3Q C;  4Q4Z A;  3I4N K;  5FJ8 K;  3HOX C;  1TWH C;  4MEY A;  3RZD C;  3S1M K;  1TWG C;  4A3J C;  3CQZ K;  4Y7N C;  2B63 K;  5M3M K;  3K7A C;  3S17 K;  4Y52 K;  5IYD K;  3S1R C;  3HOZ C;  4OIR A;  2WAQ D;  4BXX K;  3GTP C;  3GTK K;  4X6A K;  1Y1V K;  4Y7N K;  3GTO C;  4NOI A;  3GTM C;  4AYB D;  2A6H A;  5IP7 C;  4KMU A;  1TWF K;  4AYB L;  4BBR K;  3S1M C;  2YU9 K;  3M3Y K;  1I50 C;  4A93 K;  4LLG A;  2BE5 A;  3GTQ K;  1SMY A;  2NVT C;  5IYC K;  2Y0S D;  3S1R K;  5C3E C;  2R93 C;  4JK1 A;  3H3V L;  4OIO A;  3PO2 C;  4BY1 C;  1TWG K;  4YG2 A;  5C44 C;  3S1Q C;  3M3Y C;  3HOX K;  4QIW L;  3RZD K;  3K7A K;  2PA8 L;  4QIW D;  4LJZ A;  3S15 K;  1BDF A;  3HOW C;  2R7Z K;  4MEX A;  3PO3 C;  4QJV B;  3M4O K;  2WB1 L;  2WB1 D;  4A3K C;  2E2I C;  3S2D K;  4C3J C;  3GTJ C;  1SFO K;  3M4O C;  4A3D C;  4LK0 A;  2JA6 C;  3HOU C;  4Q5S A;  4A3G C;  1TWH K;  4LK1 A;  2PA8 D;  3FKI K;  3EQL A;  2A69 A;  3HOY K;  5TMF A;  4XLP A;  5D4D A;  3GTJ K;  1TWC K;  2E2H K;  5C44 K;  2JA8 K;  3S14 C;  2NVQ C;  1IW7 A;  4A93 C;  1I50 K;  2JA7 K;  4KN7 A;  2VUM K;  3HOY C;  5C4J C;  3GTM K;  3S15 C;  4C3I K;  2NVT K;  4C3H C;  3FKI C;  2NVX C;  1I3Q K;  4OIP A;  1R9T C;  1K83 K;  1TWA K;  4KN4 A;  4Y52 C;  5IYD C;  3S17 C;  1XPP A;  5M3F K;  5C4X C;  3S1N K;  4BY1 K;  3S14 K;  4A3J K;  4A3F K;  1Y1V C;  4YFX A;  3PO3 K;  2YU9 C;  5IP7 K;  5M5X K;  2R92 K;  2A68 A;  1HQM A;  2NVY C;  4BBS C;  5IP9 K;  3GTP K;  3GTQ C;  3HOU K;  4A3G K;  4X6A C;  3RZO C;  2Y0S L;  3S2H K;  4BBR C;  1WCM C;  2WAQ L;  5C4X K;  4A3E K;  4A3C K;  4C2M K;  3WOD A;  4A3B K;  3I4N C;  2JA5 C;  3S16 C;  1Y1W K;  4C3H K;  5IYC C;  4G7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...