3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
2NVTK 2B63C 1TWAC 1YNJA 2NVYC 3S2DK 5C4XK 2E2HK 3GTJK 4A3KK 3H0GC 4KN7A 2E2JC 4OIQA 1TWHK 1XPPA 2JA5K 4A3IK 3DXJA 4QJVB 3S15K 4A93K 4MEYA 4LK1A 2JA8C 3S2HK 4Y7NK 2PMZL 5IYCC 3HKZL 4OIRA 3RZDC 1Y1WK 3HOWK 4A3DK 4A3BK 3RZOC 3PO2C 1WCMK 5M3MK 4A3CK 4BBSK 2E2IK 4C2MC 4G7ZA 2WAQL 1SFOK 3FKIK 4A3JC 1TWFC 5IP9K 4A3FK 3M3YK 3S1NC 3S17C 4C3JK 1Y1VK 2WAQD 4C3IC 5C3EC 4A3EK 4A3MC 3GTKC 4KMUA 3HOUC 3S1MC 4A3LC 1K83K 5IYBC 3CQZC 5FLMC 4QJVA 4C3HC 3GTPC 5IYDK 4ZH4A 2WB1L 3GTGK 2YU9C 1TWAK 2O5IA 2NVYK 3H0GK 2E2JK 3K7AC 2NVXC 1I6VA 4G7HA 4OIOA 2WB1D 5TMFA 1BDFA 4NOIA 5IP7C 3HOZC 4Q5SA 3S16C 2A6HA 5D4DA 2JA7K 2A68A 2JA8K 2PPBA 5IYCK 3RZDK 4AYBL 2Y0SL 3RZOK 3PO2K 3HKZD 2PMZD 3HOXC 4BXXC 5C4JC 1I6HC 4C2MK 2A6EA 3GTLK 4LLGA 4BY7C 1YNNA 4AYBD 4A3JK 1TWFK 2R7ZC 3HOVC 3S1NK 4XSXA 1I50C 4C3IK 5C3EK 3GTOC 2O5JA 4BBRC 3GTKK 4BY1C 3S1MK 3HOUK 4KN4A 4A3LK 1I3QC 3S1QC 3S15C 5IYBK 1ZYRA 3HOYC 2R92C 2JA6C 4X6AC 3CQZK 4A3GC 4C3HK 5FLMK 1TWGC 1R9TK 2B63K 3GTPK 4GZYA 3S2HC 3S14C 4MEXA 3GTQC 1TWCC 2NVQC 3PO3C 3HOWC 4A3DC 2YU9K 4A3BC 3K7AK 2NVXK 4JK1A 2E2IC 4Y52C 2VUMC 5IP7K 3HOZK 3S16K 2CW0A 2R93C 5M5WK 1HQMA 4YFKA 3H3VL 3I4NC 5C44C 2BE5A 3S1RC 3EQLA 3I4MC 3M4OC 5M5YK 3GTMC 3HOXK 4BXXK 5C4JK 5M3FK 4OIPA 1SMYA 1IW7A 2NVTC 3H3VD 1I6HK 2Y0SD 4YG2A 4LJZA 3GTGC 2A69A 2E2HC 3GTJC 4A3KC 1TWHC 3S2DC 5C4XC 3S17K 2JA5C 2R7ZK 3HOVK 4A3MK 4A3IC 4YFNA 1I50K 3GTOK 4BBRK 4BY1K 4A93C 1I3QK 3S1QK 3WODA 3HOYK 2PA8L 2R92K 2JA6K 4X6AK 5TMCA 4Y7NC 2JA7C 1TWGK 5M5XK 1Y1WC 4A3GK 3S14K 4YFXA 3GTQK 1TWCK 2NVQK 3PO3K 1WCMC 4A3CC 2PA8D 4BBSC 1SFOC 3FKIC 4QIWL 3GTLC 4Y52K 2VUMK 5IP9C 4A3FC 4MQ9A 3M3YC 4XSZA 4C3JC 4LK0A 1Y1VC 4XLNA 4XLPA 4OINA 2R93K 4QIWD 4A3EC 4G7OA 1K83C 3I4NK 5C44K 3I4MK 4Q4ZA 3S1RK 3M4OK 3GTMK 5IYDC 4BY7K 5FJ8K 1R9TC
chains in the Genus database with same CATH superfamily
2B63C 1B4BA 1YNJA 2NVYC 1O29A 2JA5K 1Y1VA 1WORA 1BGWA 4A93K 4MEYA 4GTEA 3NUHA 4KB4A 4U67S 4OIRA 3RZDC 4KATA 4A3BK 3RZOC 2E2IK 1ZBSA 3FKIK 2RGRA 4A3FK 4LQYA 3M3YK 5CHPA 2RH6A 1VLOA 4C3IC 1WOOA 4A3EK 4A3MC 3TTGA 3T01A 3S1MC 1K83K 1WQGA 5FLMC 2WB1L 1BJTA 1YCLA 3H0GK 1I6VA 4C45A 1BDFA 5IP7C 1ZQ1C 5EGEA 5D4DA 1I3QA 2JA8K 4IOAS 5IYCK 2JA6A 1TWGA 3AQOA 2V6SA 3GTQA 2PMZD 4BXXC 4GTDA 5C4JC 5JVGS 1O2FB 2A6EA 4LLGA 2P5MA 2GAHC 1C0AA 4A3JK 2VUMA 2ZJRS 2R7ZC 3S1NK 4BBRC 3GTKK 3HOUK 2L5NA 4KN4A 1I3QC 3CF5S 1ZYRA 3HOYC 3CQZK 2JA6C 1R9TK 4A3GC 1TWGC 3GTQC 2NVQC 3PO3C 3LYWA 4A3BC 1DCPA 3K7AK 2NVXK 2E2IC 4Y52C 2VUMC 5HL7S 1EFWA 3S16K 2CW0A 2R93C 5M5WK 1HQMA 4YFKA 2ZJQS 2JH3A 5C44C 2BE5A 1Y1WA 4PABA 3HOXK 1PJ5A 1WCMA 2Y0SD 1J98A 3L4KA 1XXCA 4G0VA 4A3IC 4BY1K 3S1QK 3GIRA 4X6AK 4Y7NC 1KQ4A 5DM7S 1Y1WC 3S14K 3GTGA 1WCMC 1TWAA 3GEIA 4BBSC 1IS1A 1WOPA 1IE0A 1DCOA 2ZJPS 3DLLS 3OREA 1WSVA 4XSZA 4LK0A 1JVIA 4XLPA 2JA7A 3I4NK 4Q4ZA 3S1RK 3GTMK 4KASA 1R9TC 4KM9A 2NVTK 1SFOA 1TWAC 3S2DK 2FQTA 5C4XK 1G51A 4KN7A 1J6WA 3S15K 1F9NA 4LK1A 1XZPA 3GTPA 3HOWK 2B63A 3PO2C 2KQ1A 3GSIA 2ZUEA 2W7VA 4C3JK 1Y1VK 2XCOA 3AD9C 4KMUA 4A3LC 2KXYA 4C3HC 3GTPC 2ZUFA 4ZH4A 3JSTA 2E2JK 4G7HA 1XXBA 4FM9A 2WB1D 2V6TA 4KMAA 3Q3QA 1I50A 2A68A 1L0WA 3HKZD 2GSUA 1ISEA 3G4AA 4C2MK 3GTLK 3FOFA 1YNNA 1TWFK 3PIPS 3GDZA 3HOVC 1O25A 4GTCA 1I50C 1O2AA 4FZBA 5C3EK 4KMDA 1WOSA 3S15C 5IYBK 4KAWX 1F93A 1O27A 1RU0A 5TJ3A 2YU9K 3HOWC 4ILDA 2CFAB 4WFNS 4WFBS 1WIHA 2R7ZA 2PHCB 3OPFA 1EQRA 2JA5A 3HOZK 3ERED 4GFQA 5M5YK 3AD8C 1I6HK 3N0CA 2E2IA 3FKIA 2JA5C 3LPXA 2R93A 4YFNA 1J6VA 4LOWA 3GTOK 4GTBA 1F7UA 2FQOA 4A93C 2PA8L 2R92K 4WF9S 5M5XK 4YFXA 1TWCK 4BLAA 4XCHA 3H0GA 3FKIC 3GTLC 1VRQC 4A3FC 4MQ9A 3M3YC 2GSNA 4A3EC 1K83C 2KPUA 3I4MK 3M4OK 1INNA 3TFIA 5CJ9A 5IOSA 2E2HK 3GTJK 4A3KK 3H0GC 1TWHK 3FOEA 4WILA 4GTLA 4QJVB 3GTKA 2JA8C 2PMZL 5IYCC 3CQZA 1R9TA 4A3DK 1VJEA 3HXAA 1PJ7A 5M3MK 3TFHA 4A3CK 4IO9S 2WAQL 1O26A 3BP3A 4P5BA 1SFOK 2NVXA 4A3JC 3A8IA 5IP9K 4BKWA 3S1NC 5E68A 3GTKC 4DDQA 3LAJA 3HOUC 3CQZC 1V5VA 5IYDK 3AD7C 1YX2A 4M1XA 2NVYK 3K7AC 2NVXC 1JOEA 1USOA 1VGXA 4Q5SA 3S16C 1JQWA 1O28A 3CAGA 2XCQA 3RZDK 4RMFA 4AYBL 1GE9A 5DM6S 2Y0SL 3RZOK 3HOXC 2GSOA 2KWAA 3GEEA 4KMHA 4C3IK 1XXAA 2O5JA 4BY1C 3S1MK 3S1QC 1HI9A 4J3NA 1AB4A 1PJ6A 4X6AC 4PAAA 5FLMK 2L3UA 3GTMA 3S14C 4A3DC 5JVHS 1IBAA 3VA7A 3A8JA 5IP7K 1EK8A 4KARA 3H3VL 3I4NC 3S1RC 3EQLA 3GTMC 1WQHA 4BXXK 5C4JK 5M3FK 4OIPA 2NVTC 1WQFA 4YG2A 4LJZA 3S2DC 2A69A 5C4XC 1ZXOA 3S17K 1XZQB 2R7ZK 3T00A 2CFAA 4BBRK 1I3QK 3WODA 3HOYK 2JA6K 4A3GK 1TWGK 1DCHA 3GTQK 5IOQA 2NVQK 3PO3K 1J6XA 2PA8D 3BUEA 2D6FC 3AQPA 4WJ4A 4QIWL 2Y3PA 4Y52K 2VUMK 5JVOA 5EGHA 4WJ3M 3ADAC 4C3JC 1Y1VC 4OINA 2R93K 3BP8C 4G7OA 5C44K 3S0XA 4BY7K 5FJ8K 3GTLA 2E2JC 4OIQA 1XPPA 1TWFA 1IQ0A 3L4JA 4A3IK 3DXJA 1K83A 1ZVUA 3MMLB 4WCES 3S2HK 4Y7NK 3HKZL 1B4AA 1Y1WK 4P9SA 3LAPA 1F7VA 3N3YA 2GAGC 1BS2A 5HQHA 3PIOS 1WCMK 3T02A 3V4GA 5IOTA 3OEPA 1X31C 4C2MC 2YU9A 4BBSK 4G7ZA 1TWFC 4G0WA 1WSRA 3S17C 2WAQD 5C3EC 5IYBC 1FEUA 4GTFA 3FHZA 4QJVA 3GTGK 2YU9C 1TWAK 2O5IA 2EBBA 3N0BA 2ZFZA 4OIOA 4IOCS 5TMFA 3AH5A 4NOIA 4AH6A 3GTOA 3HOZC 2A6HA 2JA7K 2PPBA 2R92A 1UV7A 3PO2K 1TWCA 4LR2A 1EI6A 1I6HC 4BY7C 4AYBD 1VH2A 4XSXA 4O2DA 2XCRB 3GTOC 4A3LK 4P5AA 4WFAS 4KM8A 2R92C 4C3HK 2B63K 3GTPK 4GZYA 3S2HC 4MEXA 1TWCC 4GT9A 5JFEA 2E2HA 3GTJA 1TWHA 4JK1A 3G4CA 1O24A 3SZYA 1DD5A 4G0UA 4KB2A 3I4MC 1USMA 3M4OC 2P8TA 3TFJA 1SMYA 1IW7A 3H3VD 5HL8A 3GTGC 2E2HC 3GTJC 4A3KC 1TWHC 3GEHA 3HOVK 4A3MK 5IORA 1I50K 4KC6A 5L46A 4BLBA 5TMCA 2JA7C 3QX3A 1IL2A 4A3CC 2NVYA 1EH1A 4KDDA 1SFOC 3A8KA 5IP9C 1XZPB 3SZZA 4XLNA 1O2BA 2V6UA 4QIWD 4GTAA 1XZQA 3IPJA 5IYDC
chains in the Genus database with same CATH topology
2NVTK 2B63C 1TWAC 1YNJA 2NVYC 3S2DK 5C4XK 2E2HK 3GTJK 4A3KK 3H0GC 4KN7A 2E2JC 4OIQA 1TWHK 1XPPA 2JA5K 4A3IK 3DXJA 4QJVB 3S15K 4A93K 4MEYA 4LK1A 2JA8C 3S2HK 4Y7NK 2PMZL 5IYCC 3HKZL 4OIRA 3RZDC 1Y1WK 3HOWK 4A3DK 4A3BK 3RZOC 3PO2C 1WCMK 5M3MK 4A3CK 4BBSK 2E2IK 4C2MC 4G7ZA 2WAQL 1SFOK 3FKIK 4A3JC 1TWFC 5IP9K 4A3FK 3M3YK 3S1NC 3S17C 4C3JK 1Y1VK 2WAQD 4C3IC 5C3EC 4A3EK 4A3MC 3GTKC 4KMUA 3HOUC 3S1MC 4A3LC 1K83K 5IYBC 3CQZC 5FLMC 4QJVA 4C3HC 3GTPC 5IYDK 4ZH4A 2WB1L 3GTGK 2YU9C 1TWAK 2O5IA 2NVYK 3H0GK 2E2JK 3K7AC 2NVXC 1I6VA 4G7HA 4OIOA 2WB1D 5TMFA 1BDFA 4NOIA 5IP7C 3HOZC 4Q5SA 3S16C 2A6HA 5D4DA 2JA7K 2A68A 2JA8K 2PPBA 5IYCK 3RZDK 4AYBL 2Y0SL 3RZOK 3PO2K 3HKZD 2PMZD 3HOXC 4BXXC 5C4JC 1I6HC 4C2MK 2A6EA 3GTLK 4LLGA 4BY7C 1YNNA 4AYBD 4A3JK 1TWFK 2R7ZC 3HOVC 3S1NK 4XSXA 1I50C 4C3IK 5C3EK 3GTOC 2O5JA 4BBRC 3GTKK 4BY1C 3S1MK 3HOUK 4KN4A 4A3LK 1I3QC 3S1QC 3S15C 5IYBK 1ZYRA 3HOYC 2R92C 2JA6C 4X6AC 3CQZK 4A3GC 4C3HK 5FLMK 1TWGC 1R9TK 2B63K 3GTPK 4GZYA 3S2HC 3S14C 4MEXA 3GTQC 1TWCC 2NVQC 3PO3C 3HOWC 4A3DC 2YU9K 4A3BC 3K7AK 2NVXK 4JK1A 2E2IC 4Y52C 2VUMC 5IP7K 3HOZK 3S16K 2CW0A 2R93C 5M5WK 1HQMA 4YFKA 3H3VL 3I4NC 5C44C 2BE5A 3S1RC 3EQLA 3I4MC 3M4OC 5M5YK 3GTMC 3HOXK 4BXXK 5C4JK 5M3FK 4OIPA 1SMYA 1IW7A 2NVTC 3H3VD 1I6HK 2Y0SD 4YG2A 4LJZA 3GTGC 2A69A 2E2HC 3GTJC 4A3KC 1TWHC 3S2DC 5C4XC 3S17K 2JA5C 2R7ZK 3HOVK 4A3MK 4A3IC 4YFNA 1I50K 3GTOK 4BBRK 4BY1K 4A93C 1I3QK 3S1QK 3WODA 3HOYK 2PA8L 2R92K 2JA6K 4X6AK 5TMCA 4Y7NC 2JA7C 1TWGK 5M5XK 1Y1WC 4A3GK 3S14K 4YFXA 3GTQK 1TWCK 2NVQK 3PO3K 1WCMC 4A3CC 2PA8D 4BBSC 1SFOC 3FKIC 4QIWL 3GTLC 4Y52K 2VUMK 5IP9C 4A3FC 4MQ9A 3M3YC 4XSZA 4C3JC 4LK0A 1Y1VC 4XLNA 4XLPA 4OINA 2R93K 4QIWD 4A3EC 4G7OA 1K83C 3I4NK 5C44K 3I4MK 4Q4ZA 3S1RK 3M4OK 3GTMK 5IYDC 4BY7K 5FJ8K 1R9TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT K;  2B63 C;  1TWA C;  1YNJ A;  2NVY C;  3S2D K;  5C4X K;  2E2H K;  3GTJ K;  4A3K K;  3H0G C;  4KN7 A;  2E2J C;  4OIQ A;  1TWH K;  1XPP A;  2JA5 K;  4A3I K;  3DXJ A;  4QJV B;  3S15 K;  4A93 K;  4MEY A;  4LK1 A;  2JA8 C;  3S2H K;  4Y7N K;  2PMZ L;  5IYC C;  3HKZ L;  4OIR A;  3RZD C;  1Y1W K;  3HOW K;  4A3D K;  4A3B K;  3RZO C;  3PO2 C;  1WCM K;  5M3M K;  4A3C K;  4BBS K;  2E2I K;  4C2M C;  4G7Z A;  2WAQ L;  1SFO K;  3FKI K;  4A3J C;  1TWF C;  5IP9 K;  4A3F K;  3M3Y K;  3S1N C;  3S17 C;  4C3J K;  1Y1V K;  2WAQ D;  4C3I C;  5C3E C;  4A3E K;  4A3M C;  3GTK C;  4KMU A;  3HOU C;  3S1M C;  4A3L C;  1K83 K;  5IYB C;  3CQZ C;  5FLM C;  4QJV A;  4C3H C;  3GTP C;  5IYD K;  4ZH4 A;  2WB1 L;  3GTG K;  2YU9 C;  1TWA K;  2O5I A;  2NVY K;  3H0G K;  2E2J K;  3K7A C;  2NVX C;  1I6V A;  4G7H A;  4OIO A;  2WB1 D;  5TMF A;  1BDF A;  4NOI A;  5IP7 C;  3HOZ C;  4Q5S A;  3S16 C;  2A6H A;  5D4D A;  2JA7 K;  2A68 A;  2JA8 K;  2PPB A;  5IYC K;  3RZD K;  4AYB L;  2Y0S L;  3RZO K;  3PO2 K;  3HKZ D;  2PMZ D;  3HOX C;  4BXX C;  5C4J C;  1I6H C;  4C2M K;  2A6E A;  3GTL K;  4LLG A;  4BY7 C;  1YNN A;  4AYB D;  4A3J K;  1TWF K;  2R7Z C;  3HOV C;  3S1N K;  4XSX A;  1I50 C;  4C3I K;  5C3E K;  3GTO C;  2O5J A;  4BBR C;  3GTK K;  4BY1 C;  3S1M K;  3HOU K;  4KN4 A;  4A3L K;  1I3Q C;  3S1Q C;  3S15 C;  5IYB K;  1ZYR A;  3HOY C;  2R92 C;  2JA6 C;  4X6A C;  3CQZ K;  4A3G C;  4C3H K;  5FLM K;  1TWG C;  1R9T K;  2B63 K;  3GTP K;  4GZY A;  3S2H C;  3S14 C;  4MEX A;  3GTQ C;  1TWC C;  2NVQ C;  3PO3 C;  3HOW C;  4A3D C;  2YU9 K;  4A3B C;  3K7A K;  2NVX K;  4JK1 A;  2E2I C;  4Y52 C;  2VUM C;  5IP7 K;  3HOZ K;  3S16 K;  2CW0 A;  2R93 C;  5M5W K;  1HQM A;  4YFK A;  3H3V L;  3I4N C;  5C44 C;  2BE5 A;  3S1R C;  3EQL A;  3I4M C;  3M4O C;  5M5Y K;  3GTM C;  3HOX K;  4BXX K;  5C4J K;  5M3F K;  4OIP A;  1SMY A;  1IW7 A;  2NVT C;  3H3V D;  1I6H K;  2Y0S D;  4YG2 A;  4LJZ A;  3GTG C;  2A69 A;  2E2H C;  3GTJ C;  4A3K C;  1TWH C;  3S2D C;  5C4X C;  3S17 K;  2JA5 C;  2R7Z K;  3HOV K;  4A3M K;  4A3I C;  4YFN A;  1I50 K;  3GTO K;  4BBR K;  4BY1 K;  4A93 C;  1I3Q K;  3S1Q K;  3WOD A;  3HOY K;  2PA8 L;  2R92 K;  2JA6 K;  4X6A K;  5TMC A;  4Y7N C;  2JA7 C;  1TWG K;  5M5X K;  1Y1W C;  4A3G K;  3S14 K;  4YFX A;  3GTQ K;  1TWC K;  2NVQ K;  3PO3 K;  1WCM C;  4A3C C;  2PA8 D;  4BBS C;  1SFO C;  3FKI C;  4QIW L;  3GTL C;  4Y52 K;  2VUM K;  5IP9 C;  4A3F C;  4MQ9 A;  3M3Y C;  4XSZ A;  4C3J C;  4LK0 A;  1Y1V C;  4XLN A;  4XLP A;  4OIN A;  2R93 K;  4QIW D;  4A3E C;  4G7O A;  1K83 C;  3I4N K;  5C44 K;  3I4M K;  4Q4Z A;  3S1R K;  3M4O K;  3GTM K;  5IYD C;  4BY7 K;  5FJ8 K;  1R9T C; 
#chains in the Genus database with same CATH topology
 2B63 C;  1B4B A;  1YNJ A;  2NVY C;  1O29 A;  2JA5 K;  1Y1V A;  1WOR A;  1BGW A;  4A93 K;  4MEY A;  4GTE A;  3NUH A;  4KB4 A;  4U67 S;  4OIR A;  3RZD C;  4KAT A;  4A3B K;  3RZO C;  2E2I K;  1ZBS A;  3FKI K;  2RGR A;  4A3F K;  4LQY A;  3M3Y K;  5CHP A;  2RH6 A;  1VLO A;  4C3I C;  1WOO A;  4A3E K;  4A3M C;  3TTG A;  3T01 A;  3S1M C;  1K83 K;  1WQG A;  5FLM C;  2WB1 L;  1BJT A;  1YCL A;  3H0G K;  1I6V A;  4C45 A;  1BDF A;  5IP7 C;  1ZQ1 C;  5EGE A;  5D4D A;  1I3Q A;  2JA8 K;  4IOA S;  5IYC K;  2JA6 A;  1TWG A;  3AQO A;  2V6S A;  3GTQ A;  2PMZ D;  4BXX C;  4GTD A;  5C4J C;  5JVG S;  1O2F B;  2A6E A;  4LLG A;  2P5M A;  2GAH C;  1C0A A;  4A3J K;  2VUM A;  2ZJR S;  2R7Z C;  3S1N K;  4BBR C;  3GTK K;  3HOU K;  2L5N A;  4KN4 A;  1I3Q C;  3CF5 S;  1ZYR A;  3HOY C;  3CQZ K;  2JA6 C;  1R9T K;  4A3G C;  1TWG C;  3GTQ C;  2NVQ C;  3PO3 C;  3LYW A;  4A3B C;  1DCP A;  3K7A K;  2NVX K;  2E2I C;  4Y52 C;  2VUM C;  5HL7 S;  1EFW A;  3S16 K;  2CW0 A;  2R93 C;  5M5W K;  1HQM A;  4YFK A;  2ZJQ S;  2JH3 A;  5C44 C;  2BE5 A;  1Y1W A;  4PAB A;  3HOX K;  1PJ5 A;  1WCM A;  2Y0S D;  1J98 A;  3L4K A;  1XXC A;  4G0V A;  4A3I C;  4BY1 K;  3S1Q K;  3GIR A;  4X6A K;  4Y7N C;  1KQ4 A;  5DM7 S;  1Y1W C;  3S14 K;  3GTG A;  1WCM C;  1TWA A;  3GEI A;  4BBS C;  1IS1 A;  1WOP A;  1IE0 A;  1DCO A;  2ZJP S;  3DLL S;  3ORE A;  1WSV A;  4XSZ A;  4LK0 A;  1JVI A;  4XLP A;  2JA7 A;  3I4N K;  4Q4Z A;  3S1R K;  3GTM K;  4KAS A;  1R9T C;  4KM9 A;  2NVT K;  1SFO A;  1TWA C;  3S2D K;  2FQT A;  5C4X K;  1G51 A;  4KN7 A;  1J6W A;  3S15 K;  1F9N A;  4LK1 A;  1XZP A;  3GTP A;  3HOW K;  2B63 A;  3PO2 C;  2KQ1 A;  3GSI A;  2ZUE A;  2W7V A;  4C3J K;  1Y1V K;  2XCO A;  3AD9 C;  4KMU A;  4A3L C;  2KXY A;  4C3H C;  3GTP C;  2ZUF A;  4ZH4 A;  3JST A;  2E2J K;  4G7H A;  1XXB A;  4FM9 A;  2WB1 D;  2V6T A;  4KMA A;  3Q3Q A;  1I50 A;  2A68 A;  1L0W A;  3HKZ D;  2GSU A;  1ISE A;  3G4A A;  4C2M K;  3GTL K;  3FOF A;  1YNN A;  1TWF K;  3PIP S;  3GDZ A;  3HOV C;  1O25 A;  4GTC A;  1I50 C;  1O2A A;  4FZB A;  5C3E K;  4KMD A;  1WOS A;  3S15 C;  5IYB K;  4KAW X;  1F93 A;  1O27 A;  1RU0 A;  5TJ3 A;  2YU9 K;  3HOW C;  4ILD A;  2CFA B;  4WFN S;  4WFB S;  1WIH A;  2R7Z A;  2PHC B;  3OPF A;  1EQR A;  2JA5 A;  3HOZ K;  3ERE D;  4GFQ A;  5M5Y K;  3AD8 C;  1I6H K;  3N0C A;  2E2I A;  3FKI A;  2JA5 C;  3LPX A;  2R93 A;  4YFN A;  1J6V A;  4LOW A;  3GTO K;  4GTB A;  1F7U A;  2FQO A;  4A93 C;  2PA8 L;  2R92 K;  4WF9 S;  5M5X K;  4YFX A;  1TWC K;  4BLA A;  4XCH A;  3H0G A;  3FKI C;  3GTL C;  1VRQ C;  4A3F C;  4MQ9 A;  3M3Y C;  2GSN A;  4A3E C;  1K83 C;  2KPU A;  3I4M K;  3M4O K;  1INN A;  3TFI A;  5CJ9 A;  5IOS A;  2E2H K;  3GTJ K;  4A3K K;  3H0G C;  1TWH K;  3FOE A;  4WIL A;  4GTL A;  4QJV B;  3GTK A;  2JA8 C;  2PMZ L;  5IYC C;  3CQZ A;  1R9T A;  4A3D K;  1VJE A;  3HXA A;  1PJ7 A;  5M3M K;  3TFH A;  4A3C K;  4IO9 S;  2WAQ L;  1O26 A;  3BP3 A;  4P5B A;  1SFO K;  2NVX A;  4A3J C;  3A8I A;  5IP9 K;  4BKW A;  3S1N C;  5E68 A;  3GTK C;  4DDQ A;  3LAJ A;  3HOU C;  3CQZ C;  1V5V A;  5IYD K;  3AD7 C;  1YX2 A;  4M1X A;  2NVY K;  3K7A C;  2NVX C;  1JOE A;  1USO A;  1VGX A;  4Q5S A;  3S16 C;  1JQW A;  1O28 A;  3CAG A;  2XCQ A;  3RZD K;  4RMF A;  4AYB L;  1GE9 A;  5DM6 S;  2Y0S L;  3RZO K;  3HOX C;  2GSO A;  2KWA A;  3GEE A;  4KMH A;  4C3I K;  1XXA A;  2O5J A;  4BY1 C;  3S1M K;  3S1Q C;  1HI9 A;  4J3N A;  1AB4 A;  1PJ6 A;  4X6A C;  4PAA A;  5FLM K;  2L3U A;  3GTM A;  3S14 C;  4A3D C;  5JVH S;  1IBA A;  3VA7 A;  3A8J A;  5IP7 K;  1EK8 A;  4KAR A;  3H3V L;  3I4N C;  3S1R C;  3EQL A;  3GTM C;  1WQH A;  4BXX K;  5C4J K;  5M3F K;  4OIP A;  2NVT C;  1WQF A;  4YG2 A;  4LJZ A;  3S2D C;  2A69 A;  5C4X C;  1ZXO A;  3S17 K;  1XZQ B;  2R7Z K;  3T00 A;  2CFA A;  4BBR K;  1I3Q K;  3WOD A;  3HOY K;  2JA6 K;  4A3G K;  1TWG K;  1DCH A;  3GTQ K;  5IOQ A;  2NVQ K;  3PO3 K;  1J6X A;  2PA8 D;  3BUE A;  2D6F C;  3AQP A;  4WJ4 A;  4QIW L;  2Y3P A;  4Y52 K;  2VUM K;  5JVO A;  5EGH A;  4WJ3 M;  3ADA C;  4C3J C;  1Y1V C;  4OIN A;  2R93 K;  3BP8 C;  4G7O A;  5C44 K;  3S0X A;  4BY7 K;  5FJ8 K;  3GTL A;  2E2J C;  4OIQ A;  1XPP A;  1TWF A;  1IQ0 A;  3L4J A;  4A3I K;  3DXJ A;  1K83 A;  1ZVU A;  3MML B;  4WCE S;  3S2H K;  4Y7N K;  3HKZ L;  1B4A A;  1Y1W K;  4P9S A;  3LAP A;  1F7V A;  3N3Y A;  2GAG C;  1BS2 A;  5HQH A;  3PIO S;  1WCM K;  3T02 A;  3V4G A;  5IOT A;  3OEP A;  1X31 C;  4C2M C;  2YU9 A;  4BBS K;  4G7Z A;  1TWF C;  4G0W A;  1WSR A;  3S17 C;  2WAQ D;  5C3E C;  5IYB C;  1FEU A;  4GTF A;  3FHZ A;  4QJV A;  3GTG K;  2YU9 C;  1TWA K;  2O5I A;  2EBB A;  3N0B A;  2ZFZ A;  4OIO A;  4IOC S;  5TMF A;  3AH5 A;  4NOI A;  4AH6 A;  3GTO A;  3HOZ C;  2A6H A;  2JA7 K;  2PPB A;  2R92 A;  1UV7 A;  3PO2 K;  1TWC A;  4LR2 A;  1EI6 A;  1I6H C;  4BY7 C;  4AYB D;  1VH2 A;  4XSX A;  4O2D A;  2XCR B;  3GTO C;  4A3L K;  4P5A A;  4WFA S;  4KM8 A;  2R92 C;  4C3H K;  2B63 K;  3GTP K;  4GZY A;  3S2H C;  4MEX A;  1TWC C;  4GT9 A;  5JFE A;  2E2H A;  3GTJ A;  1TWH A;  4JK1 A;  3G4C A;  1O24 A;  3SZY A;  1DD5 A;  4G0U A;  4KB2 A;  3I4M C;  1USM A;  3M4O C;  2P8T A;  3TFJ A;  1SMY A;  1IW7 A;  3H3V D;  5HL8 A;  3GTG C;  2E2H C;  3GTJ C;  4A3K C;  1TWH C;  3GEH A;  3HOV K;  4A3M K;  5IOR A;  1I50 K;  4KC6 A;  5L46 A;  4BLB A;  5TMC A;  2JA7 C;  3QX3 A;  1IL2 A;  4A3C C;  2NVY A;  1EH1 A;  4KDD A;  1SFO C;  3A8K A;  5IP9 C;  1XZP B;  3SZZ A;  4XLN A;  1O2B A;  2V6U A;  4QIW D;  4GTA A;  1XZQ A;  3IPJ A;  5IYD C; 
#chains in the Genus database with same CATH homology
 2NVT K;  2B63 C;  1TWA C;  1YNJ A;  2NVY C;  3S2D K;  5C4X K;  2E2H K;  3GTJ K;  4A3K K;  3H0G C;  4KN7 A;  2E2J C;  4OIQ A;  1TWH K;  1XPP A;  2JA5 K;  4A3I K;  3DXJ A;  4QJV B;  3S15 K;  4A93 K;  4MEY A;  4LK1 A;  2JA8 C;  3S2H K;  4Y7N K;  2PMZ L;  5IYC C;  3HKZ L;  4OIR A;  3RZD C;  1Y1W K;  3HOW K;  4A3D K;  4A3B K;  3RZO C;  3PO2 C;  1WCM K;  5M3M K;  4A3C K;  4BBS K;  2E2I K;  4C2M C;  4G7Z A;  2WAQ L;  1SFO K;  3FKI K;  4A3J C;  1TWF C;  5IP9 K;  4A3F K;  3M3Y K;  3S1N C;  3S17 C;  4C3J K;  1Y1V K;  2WAQ D;  4C3I C;  5C3E C;  4A3E K;  4A3M C;  3GTK C;  4KMU A;  3HOU C;  3S1M C;  4A3L C;  1K83 K;  5IYB C;  3CQZ C;  5FLM C;  4QJV A;  4C3H C;  3GTP C;  5IYD K;  4ZH4 A;  2WB1 L;  3GTG K;  2YU9 C;  1TWA K;  2O5I A;  2NVY K;  3H0G K;  2E2J K;  3K7A C;  2NVX C;  1I6V A;  4G7H A;  4OIO A;  2WB1 D;  5TMF A;  1BDF A;  4NOI A;  5IP7 C;  3HOZ C;  4Q5S A;  3S16 C;  2A6H A;  5D4D A;  2JA7 K;  2A68 A;  2JA8 K;  2PPB A;  5IYC K;  3RZD K;  4AYB L;  2Y0S L;  3RZO K;  3PO2 K;  3HKZ D;  2PMZ D;  3HOX C;  4BXX C;  5C4J C;  1I6H C;  4C2M K;  2A6E A;  3GTL K;  4LLG A;  4BY7 C;  1YNN A;  4AYB D;  4A3J K;  1TWF K;  2R7Z C;  3HOV C;  3S1N K;  4XSX A;  1I50 C;  4C3I K;  5C3E K;  3GTO C;  2O5J A;  4BBR C;  3GTK K;  4BY1 C;  3S1M K;  3HOU K;  4KN4 A;  4A3L K;  1I3Q C;  3S1Q C;  3S15 C;  5IYB K;  1ZYR A;  3HOY C;  2R92 C;  2JA6 C;  4X6A C;  3CQZ K;  4A3G C;  4C3H K;  5FLM K;  1TWG C;  1R9T K;  2B63 K;  3GTP K;  4GZY A;  3S2H C;  3S14 C;  4MEX A;  3GTQ C;  1TWC C;  2NVQ C;  3PO3 C;  3HOW C;  4A3D C;  2YU9 K;  4A3B C;  3K7A K;  2NVX K;  4JK1 A;  2E2I C;  4Y52 C;  2VUM C;  5IP7 K;  3HOZ K;  3S16 K;  2CW0 A;  2R93 C;  5M5W K;  1HQM A;  4YFK A;  3H3V L;  3I4N C;  5C44 C;  2BE5 A;  3S1R C;  3EQL A;  3I4M C;  3M4O C;  5M5Y K;  3GTM C;  3HOX K;  4BXX K;  5C4J K;  5M3F K;  4OIP A;  1SMY A;  1IW7 A;  2NVT C;  3H3V D;  1I6H K;  2Y0S D;  4YG2 A;  4LJZ A;  3GTG C;  2A69 A;  2E2H C;  3GTJ C;  4A3K C;  1TWH C;  3S2D C;  5C4X C;  3S17 K;  2JA5 C;  2R7Z K;  3HOV K;  4A3M K;  4A3I C;  4YFN A;  1I50 K;  3GTO K;  4BBR K;  4BY1 K;  4A93 C;  1I3Q K;  3S1Q K;  3WOD A;  3HOY K;  2PA8 L;  2R92 K;  2JA6 K;  4X6A K;  5TMC A;  4Y7N C;  2JA7 C;  1TWG K;  5M5X K;  1Y1W C;  4A3G K;  3S14 K;  4YFX A;  3GTQ K;  1TWC K;  2NVQ K;  3PO3 K;  1WCM C;  4A3C C;  2PA8 D;  4BBS C;  1SFO C;  3FKI C;  4QIW L;  3GTL C;  4Y52 K;  2VUM K;  5IP9 C;  4A3F C;  4MQ9 A;  3M3Y C;  4XSZ A;  4C3J C;  4LK0 A;  1Y1V C;  4XLN A;  4XLP A;  4OIN A;  2R93 K;  4QIW D;  4A3E C;  4G7O A;  1K83 C;  3I4N K;  5C44 K;  3I4M K;  4Q4Z A;  3S1R K;  3M4O K;  3GTM K;  5IYD C;  4BY7 K;  5FJ8 K;  1R9T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...