3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
b'LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
1BDFA 4YFNA 4C3IC 4MQ9A 3HOXC 4A3IK 2YU9K 3PO2K 4OIOA 1I3QK 5FLMC 1Y1WC 4XSXA 2NVXC 2Y0SL 4QJVB 4LK1A 3HOUC 4A3KK 3S2HK 5M3MK 4BXXC 3RZDC 3S1NC 3I4NK 4Y7NK 2JA5C 4A3MC 4A3LC 4YFKA 5D4DA 1WCMK 3M4OK 4BBRC 3GTPK 3HOVK 3GTQK 4MEYA 4BY1K 4G7ZA 1Y1VC 3GTGK 2O5IA 4LLGA 2E2JC 3S2DK 4A3EK 5IP7C 5IYDK 4A3JC 3I4MK 3M3YC 3GTKK 2WAQL 4KMUA 3GTOK 3GTMK 1TWHK 2JA7K 4Y52K 1HQMA 1TWCC 3H3VL 3HOZK 4XLNA 4OINA 1R9TC 2JA6C 5C3EK 3S14K 3HOXK 3S16K 4C2MC 4BBSC 3HOWC 5FLMK 3RZOC 1Y1WK 4AYBD 1K83C 3FKIC 1TWAK 4X6AK 4A3CC 3PO3C 3RZDK 3S1NK 5IYCK 1TWGC 4A3MK 2JA5K 4A3LK 1I6HK 4A3GC 2VUMC 2WAQD 3H0GC 1Y1VK 1IW7A 1SFOC 2B63C 3S15C 2E2IC 4AYBL 3H3VD 2E2JK 4A3DC 2R92C 2NVTK 3S17K 4Q5SA 4A3JK 4LJZA 3S1QC 5M5WK 3M3YK 2NVQK 5C44K 3CQZC 5IYBC 4A93C 4QJVA 3HOYC 2JA8C 2PPBA 4YFXA 4Q4ZA 1I50K 3S1MC 4BY7C 1TWCK 5M3FK 2JA6K 5TMCA 1I3QC 1R9TK 3HKZD 4OIPA 5IP9K 4C3IK 4C2MK 4BBSK 3HOWK 4A3KC 3RZOK 1K83K 2R7ZC 3FKIK 3GTJC 2NVXK 4A3BC 4C3JC 2R93C 3HOUK 4A3CK 2A68A 1WCMC 3PO3K 4BXXK 4XSZA 3HKZL 4BBRK 2PA8D 3H0GK 1SFOK 3S2DC 4C3HC 4A3EC 2E2IK 2B63K 3S15K 4G7HA 2R92K 2A69A 5C4XC 1TWFC 1XPPA 4OIRA 3GTOC 4QIWL 5IP7K 1SMYA 1TWHC 2WB1D 2E2HC 3S1RC 3DXJA 3CQZK 5M5XK 5IYBK 3GTLC 4A3FC 3HOYK 4A93K 2NVYC 2PA8L 5C4JC 3S1MK 5TMFA 3K7AC 4BY7K 4A3IC 4KN7A 3PO2C 2YU9C 3S16C 1YNJA 4LK0A 4NOIA 4G7OA 1TWAC 2A6EA 2WB1L 3S2HC 4X6AC 2R7ZK 3GTJK 5C4JK 4A3BK 5IYCC 3EQLA 3K7AK 4C3JK 2R93K 3WODA 1I6HC 3I4NC 1YNNA 4Y7NC 1ZYRA 4KN4A 3M4OC 4JK1A 4QIWD 3GTPC 3HOVC 3GTQC 1TWGK 5FJ8K 4BY1C 5M5YK 2O5JA 4A3GK 4YG2A 4MEXA 3GTGC 2VUMK 2BE5A 4C3HK 2PMZD 4OIQA 2NVTC 3S17C 4GZYA 5IYDC 2NVQC 4A3DK 5C44C 1I6VA 3I4MC 2Y0SD 3GTKC 1TWFK 2PMZL 5C4XK 3S1QK 3GTMC 3S1RK 2E2HK 1I50C 2JA7C 4Y52C 3GTLK 4A3FK 2A6HA 2NVYK 4XLPA 2JA8K 3HOZC 2CW0A 3S14C 5C3EC 5IP9C 4ZH4A
chains in the Genus database with same CATH superfamily
4OIOA 2Y0SL 4GTAA 3CQZA 3Q3QA 4P5AA 2JA5C 3M4OK 4MEYA 4G7ZA 3OEPA 2O5IA 1O2FB 3GTJA 5IP7C 3M3YC 4KDDA 3GTOK 3GTMK 4XLNA 4OINA 4C2MC 4BBSC 3HOWC 1Y1WK 1F7UA 4GTCA 3PIPS 1IS1A 3A8IA 1O24A 4PABA 4A3GC 1O2AA 3H0GC 1TWAA 2E2JK 4A3DC 3CAGA 2NVTK 1F7VA 1BS2A 4FZBA 1AB4A 5C44K 3CQZC 4A93C 3HOYC 4U67S 2XCRB 1XZQA 4BY7C 2JA6K 4WJ3M 1K83K 3GTJC 4BLAA 3GTMA 4C3JC 2CFAA 2A68A 4GTLA 2P8TA 4RMFA 2ZJRS 2RH6A 1Y1WA 3G4AA 3S2DC 4C3HC 3S15K 4KARA 2R92K 4OIRA 1O26A 4QIWL 5IP7K 1BJTA 2KPUA 5M5XK 3DXJA 4A3FC 1F93A 4KC6A 5C4JC 1ZQ1C 1YNJA 3BP8C 5E68A 1TWAC 2A6EA 2WB1L 5JVGS 2ZJQS 1JVIA 1USMA 3EQLA 1EI6A 4XCHA 2R93K 4WFNS 5JVHS 3M4OC 1F9NA 4JK1A 5FJ8K 5JVOA 3T02A 4A3GK 4YG2A 4MEXA 1O27A 1XZPB 1K83A 3LPXA 1UV7A 3S17C 4LR2A 1VJEA 1YCLA 4A3DK 1J6WA 1TWFK 2Y0SD 1J6XA 3GTMC 2VUMA 1O25A 2NVYK 3T00A 5IP9C 4ZH4A 4C3IC 4MQ9A 2YU9K 1Y1WC 2KWAA 2R92A 1IE0A 3HOUC 1RU0A 3I4NK 2V6TA 4BBRC 1I3QA 3HOVK 1VLOA 5IOSA 3LAJA 4LLGA 4P9SA 2E2JC 2XCQA 3S2DK 2L5NA 2R93A 1GE9A 4KM8A 3I4MK 3GTKK 3JSTA 4M1XA 1HQMA 3H3VL 3HOZK 2JA6C 5EGEA 1VRQC 2XCOA 2GSUA 5FLMK 1TWFA 1WOOA 1K83C 4WFAS 1TWAK 1WIHA 2NVYA 3S1NK 4KAWX 3V4GA 4DDQA 1L0WA 2YU9A 2VUMC 2WAQD 2ZUFA 4AYBL 3S15C 4KB2A 1XXCA 2R92C 3G4CA 3S17K 4A3JK 4LJZA 3GDZA 3TFHA 4IOCS 2V6UA 3GSIA 1EFWA 5M3FK 4Q4ZA 1X31C 5TMCA 1I3QC 1R9TK 4OIPA 5IP9K 4C3IK 4A3KC 3GTKA 3FKIK 4KMHA 3FHZA 3PIOS 2R93C 1I50A 3HOUK 4A3CK 1FEUA 3GEHA 1BGWA 4BBRK 4LOWA 2B63K 2NVXA 2JH3A 2E2IK 4G7HA 2A69A 1XPPA 1TWFC 4G0UA 1KQ4A 2WB1D 3AD8C 2NVYC 2PA8L 1EH1A 4WILA 3S1MK 5TMFA 2YU9C 4LK0A 4G0VA 4NOIA 4G7OA 2R7ZK 4PAAA 5IYCC 3WODA 3I4NC 1ZYRA 1G51A 3HOVC 3NUHA 3N0CA 3TFIA 1R9TA 2GAGC 1XXAA 2O5JA 2P5MA 4KM9A 2VUMK 3FKIA 4OIQA 1WSRA 2NVQC 3I4MC 3GTKC 4GTEA 1TWGA 4WCES 3A8JA 1WQHA 3S1RK 1I50C 2E2HK 2A6HA 4XLPA 3HOZC 2CW0A 2B63A 2E2IA 2PMZL 4YFNA 3SZYA 4G0WA 3PO2K 1I3QK 5FLMC 3GIRA 2NVXC 4QJVB 1ZXOA 4A3KK 5TJ3A 3S2HK 1WOSA 4BXXC 1XXBA 3S1NC 3GEIA 4P5BA 5D4DA 2ZUEA 5DM6S 4BY1K 5CJ9A 3GTGK 2R7ZA 4A3JC 3DLLS 1WCMA 4ILDA 4LQYA 2GSNA 3QX3A 2JA7K 1B4AA 3S14K 1R9TC 2D6FC 3HOXK 3AQPA 2L3UA 4AYBD 3FKIC 1DCPA 1TWHA 2PHCB 5IOTA 2E2HA 1J6VA 1INNA 1WQGA 4A3CC 4WF9S 1YX2A 5IYCK 3RZDK 1TWGC 1VH2A 4A3MK 4A3LK 3T01A 3L4KA 3FOFA 1Y1VK 1IW7A 2B63C 2E2IC 2W7VA 3N3YA 5IOQA 1JQWA 1PJ6A 4Q5SA 1ISEA 5M5WK 3S1QC 2NVQK 3AQOA 2JA8C 1I50K 1TWCK 1IBAA 3S1MC 3GTGA 3VA7A 2FQTA 4GFQA 5HQHA 3RZOK 1PJ7A 2R7ZC 2NVXK 3N0BA 2JA7A 4GTDA 1DD5A 2V6SA 1WCMC 3PO3K 4WFBS 4BXXK 3BP3A 4O2DA 3HKZL 2PA8D 1SFOK 4A3EC 1JOEA 2RGRA 3SZZA 2EBBA 3BUEA 1O28A 4KATA 3S0XA 4FM9A 1SMYA 1TWHC 2E2HC 3S1RC 5IYBK 2FQOA 1Y1VA 3OREA 4GT9A 4KN7A 3PO2C 3S16C 4GTBA 3AD7C 4KMDA 3S2HC 4X6AC 1ZVUA 4A3BK 1I6HC 4IO9S 1TWCA 2ZJPS 1V5VA 1WORA 2ZFZA 1IL2A 4QIWD 1B4BA 1TWGK 4BY1C 3GTGC 2BE5A 2PMZD 5L46A 5C4XK 1O29A 5EGHA 4GTFA 3TFJA 1PJ5A 3S1QK 2JA7C 3GTLK 2JA8K 4KASA 1SFOA 3S14C 3K7AK 1BDFA 3HOXC 4A3IK 4XSXA 3LYWA 1ZBSA 4LK1A 1XZQB 3A8KA 3OPFA 5M3MK 3RZDC 2Y3PA 4Y7NK 4A3MC 4A3LC 4YFKA 1WCMK 3GTPK 3GTQK 1Y1VC 1WQFA 4BLBA 2CFAB 4A3EK 4AH6A 4KMAA 5IYDK 2WAQL 4KMUA 3MMLB 1TWHK 4Y52K 3LAPA 1TWCC 5DM7S 5C3EK 3S16K 5IORA 3RZOC 3ERED 3GTOA 3GTLA 4X6AK 3PO3C 2JA5K 1I6HK 5HL7S 3AD9C 4KB4A 1SFOC 3H3VD 4J3NA 1C0AA 3M3YK 5IYBC 1WOPA 4QJVA 3FOEA 3GTPA 1VGXA 3GTQA 2PPBA 4YFXA 1DCHA 2GSOA 3HKZD 3TTGA 4WJ4A 4C2MK 4BBSK 3HOWK 1USOA 4A3BC 1XZPA 5HL8A 2JA6A 4XSZA 2KXYA 1EQRA 3H0GK 3IPJA 3ADAC 1EK8A 5JFEA 5C4XC 5CHPA 3GTOC 3AH5A 3L4JA 2GAHC 2JA5A 1O2BA 3CQZK 4A93K 1HI9A 3GTLC 3HOYK 4BY7K 3K7AC 4A3IC 1WSVA 3GEEA 4BKWA 3GTJK 4C3JK 1J98A 1YNNA 4Y7NC 4KN4A 4C45A 3CF5S 3GTPC 3GTQC 1DCOA 4IOAS 5M5YK 4C3HK 2NVTC 4GZYA 5IYDC 3HXAA 1IQ0A 5C44C 1I6VA 4Y52C 4A3FK 3H0GA 5C4JK 5C3EC 2KQ1A
chains in the Genus database with same CATH topology
1BDFA 4YFNA 4C3IC 4MQ9A 3HOXC 4A3IK 2YU9K 3PO2K 4OIOA 1I3QK 5FLMC 1Y1WC 4XSXA 2NVXC 2Y0SL 4QJVB 4LK1A 3HOUC 4A3KK 3S2HK 5M3MK 4BXXC 3RZDC 3S1NC 3I4NK 4Y7NK 2JA5C 4A3MC 4A3LC 4YFKA 5D4DA 1WCMK 3M4OK 4BBRC 3GTPK 3HOVK 3GTQK 4MEYA 4BY1K 4G7ZA 1Y1VC 3GTGK 2O5IA 4LLGA 2E2JC 3S2DK 4A3EK 5IP7C 5IYDK 4A3JC 3I4MK 3M3YC 3GTKK 2WAQL 4KMUA 3GTOK 3GTMK 1TWHK 2JA7K 4Y52K 1HQMA 1TWCC 3H3VL 3HOZK 4XLNA 4OINA 1R9TC 2JA6C 5C3EK 3S14K 3HOXK 3S16K 4C2MC 4BBSC 3HOWC 5FLMK 3RZOC 1Y1WK 4AYBD 1K83C 3FKIC 1TWAK 4X6AK 4A3CC 3PO3C 3RZDK 3S1NK 5IYCK 1TWGC 4A3MK 2JA5K 4A3LK 1I6HK 4A3GC 2VUMC 2WAQD 3H0GC 1Y1VK 1IW7A 1SFOC 2B63C 3S15C 2E2IC 4AYBL 3H3VD 2E2JK 4A3DC 2R92C 2NVTK 3S17K 4Q5SA 4A3JK 4LJZA 3S1QC 5M5WK 3M3YK 2NVQK 5C44K 3CQZC 5IYBC 4A93C 4QJVA 3HOYC 2JA8C 2PPBA 4YFXA 4Q4ZA 1I50K 3S1MC 4BY7C 1TWCK 5M3FK 2JA6K 5TMCA 1I3QC 1R9TK 3HKZD 4OIPA 5IP9K 4C3IK 4C2MK 4BBSK 3HOWK 4A3KC 3RZOK 1K83K 2R7ZC 3FKIK 3GTJC 2NVXK 4A3BC 4C3JC 2R93C 3HOUK 4A3CK 2A68A 1WCMC 3PO3K 4BXXK 4XSZA 3HKZL 4BBRK 2PA8D 3H0GK 1SFOK 3S2DC 4C3HC 4A3EC 2E2IK 2B63K 3S15K 4G7HA 2R92K 2A69A 5C4XC 1TWFC 1XPPA 4OIRA 3GTOC 4QIWL 5IP7K 1SMYA 1TWHC 2WB1D 2E2HC 3S1RC 3DXJA 3CQZK 5M5XK 5IYBK 3GTLC 4A3FC 3HOYK 4A93K 2NVYC 2PA8L 5C4JC 3S1MK 5TMFA 3K7AC 4BY7K 4A3IC 4KN7A 3PO2C 2YU9C 3S16C 1YNJA 4LK0A 4NOIA 4G7OA 1TWAC 2A6EA 2WB1L 3S2HC 4X6AC 2R7ZK 3GTJK 5C4JK 4A3BK 5IYCC 3EQLA 3K7AK 4C3JK 2R93K 3WODA 1I6HC 3I4NC 1YNNA 4Y7NC 1ZYRA 4KN4A 3M4OC 4JK1A 4QIWD 3GTPC 3HOVC 3GTQC 1TWGK 5FJ8K 4BY1C 5M5YK 2O5JA 4A3GK 4YG2A 4MEXA 3GTGC 2VUMK 2BE5A 4C3HK 2PMZD 4OIQA 2NVTC 3S17C 4GZYA 5IYDC 2NVQC 4A3DK 5C44C 1I6VA 3I4MC 2Y0SD 3GTKC 1TWFK 2PMZL 5C4XK 3S1QK 3GTMC 3S1RK 2E2HK 1I50C 2JA7C 4Y52C 3GTLK 4A3FK 2A6HA 2NVYK 4XLPA 2JA8K 3HOZC 2CW0A 3S14C 5C3EC 5IP9C 4ZH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDF A;  4YFN A;  4C3I C;  4MQ9 A;  3HOX C;  4A3I K;  2YU9 K;  3PO2 K;  4OIO A;  1I3Q K;  5FLM C;  1Y1W C;  4XSX A;  2NVX C;  2Y0S L;  4QJV B;  4LK1 A;  3HOU C;  4A3K K;  3S2H K;  5M3M K;  4BXX C;  3RZD C;  3S1N C;  3I4N K;  4Y7N K;  2JA5 C;  4A3M C;  4A3L C;  4YFK A;  5D4D A;  1WCM K;  3M4O K;  4BBR C;  3GTP K;  3HOV K;  3GTQ K;  4MEY A;  4BY1 K;  4G7Z A;  1Y1V C;  3GTG K;  2O5I A;  4LLG A;  2E2J C;  3S2D K;  4A3E K;  5IP7 C;  5IYD K;  4A3J C;  3I4M K;  3M3Y C;  3GTK K;  2WAQ L;  4KMU A;  3GTO K;  3GTM K;  1TWH K;  2JA7 K;  4Y52 K;  1HQM A;  1TWC C;  3H3V L;  3HOZ K;  4XLN A;  4OIN A;  1R9T C;  2JA6 C;  5C3E K;  3S14 K;  3HOX K;  3S16 K;  4C2M C;  4BBS C;  3HOW C;  5FLM K;  3RZO C;  1Y1W K;  4AYB D;  1K83 C;  3FKI C;  1TWA K;  4X6A K;  4A3C C;  3PO3 C;  3RZD K;  3S1N K;  5IYC K;  1TWG C;  4A3M K;  2JA5 K;  4A3L K;  1I6H K;  4A3G C;  2VUM C;  2WAQ D;  3H0G C;  1Y1V K;  1IW7 A;  1SFO C;  2B63 C;  3S15 C;  2E2I C;  4AYB L;  3H3V D;  2E2J K;  4A3D C;  2R92 C;  2NVT K;  3S17 K;  4Q5S A;  4A3J K;  4LJZ A;  3S1Q C;  5M5W K;  3M3Y K;  2NVQ K;  5C44 K;  3CQZ C;  5IYB C;  4A93 C;  4QJV A;  3HOY C;  2JA8 C;  2PPB A;  4YFX A;  4Q4Z A;  1I50 K;  3S1M C;  4BY7 C;  1TWC K;  5M3F K;  2JA6 K;  5TMC A;  1I3Q C;  1R9T K;  3HKZ D;  4OIP A;  5IP9 K;  4C3I K;  4C2M K;  4BBS K;  3HOW K;  4A3K C;  3RZO K;  1K83 K;  2R7Z C;  3FKI K;  3GTJ C;  2NVX K;  4A3B C;  4C3J C;  2R93 C;  3HOU K;  4A3C K;  2A68 A;  1WCM C;  3PO3 K;  4BXX K;  4XSZ A;  3HKZ L;  4BBR K;  2PA8 D;  3H0G K;  1SFO K;  3S2D C;  4C3H C;  4A3E C;  2E2I K;  2B63 K;  3S15 K;  4G7H A;  2R92 K;  2A69 A;  5C4X C;  1TWF C;  1XPP A;  4OIR A;  3GTO C;  4QIW L;  5IP7 K;  1SMY A;  1TWH C;  2WB1 D;  2E2H C;  3S1R C;  3DXJ A;  3CQZ K;  5M5X K;  5IYB K;  3GTL C;  4A3F C;  3HOY K;  4A93 K;  2NVY C;  2PA8 L;  5C4J C;  3S1M K;  5TMF A;  3K7A C;  4BY7 K;  4A3I C;  4KN7 A;  3PO2 C;  2YU9 C;  3S16 C;  1YNJ A;  4LK0 A;  4NOI A;  4G7O A;  1TWA C;  2A6E A;  2WB1 L;  3S2H C;  4X6A C;  2R7Z K;  3GTJ K;  5C4J K;  4A3B K;  5IYC C;  3EQL A;  3K7A K;  4C3J K;  2R93 K;  3WOD A;  1I6H C;  3I4N C;  1YNN A;  4Y7N C;  1ZYR A;  4KN4 A;  3M4O C;  4JK1 A;  4QIW D;  3GTP C;  3HOV C;  3GTQ C;  1TWG K;  5FJ8 K;  4BY1 C;  5M5Y K;  2O5J A;  4A3G K;  4YG2 A;  4MEX A;  3GTG C;  2VUM K;  2BE5 A;  4C3H K;  2PMZ D;  4OIQ A;  2NVT C;  3S17 C;  4GZY A;  5IYD C;  2NVQ C;  4A3D K;  5C44 C;  1I6V A;  3I4M C;  2Y0S D;  3GTK C;  1TWF K;  2PMZ L;  5C4X K;  3S1Q K;  3GTM C;  3S1R K;  2E2H K;  1I50 C;  2JA7 C;  4Y52 C;  3GTL K;  4A3F K;  2A6H A;  2NVY K;  4XLP A;  2JA8 K;  3HOZ C;  2CW0 A;  3S14 C;  5C3E C;  5IP9 C;  4ZH4 A; 
#chains in the Genus database with same CATH topology
 4OIO A;  2Y0S L;  4GTA A;  3CQZ A;  3Q3Q A;  4P5A A;  2JA5 C;  3M4O K;  4MEY A;  4G7Z A;  3OEP A;  2O5I A;  1O2F B;  3GTJ A;  5IP7 C;  3M3Y C;  4KDD A;  3GTO K;  3GTM K;  4XLN A;  4OIN A;  4C2M C;  4BBS C;  3HOW C;  1Y1W K;  1F7U A;  4GTC A;  3PIP S;  1IS1 A;  3A8I A;  1O24 A;  4PAB A;  4A3G C;  1O2A A;  3H0G C;  1TWA A;  2E2J K;  4A3D C;  3CAG A;  2NVT K;  1F7V A;  1BS2 A;  4FZB A;  1AB4 A;  5C44 K;  3CQZ C;  4A93 C;  3HOY C;  4U67 S;  2XCR B;  1XZQ A;  4BY7 C;  2JA6 K;  4WJ3 M;  1K83 K;  3GTJ C;  4BLA A;  3GTM A;  4C3J C;  2CFA A;  2A68 A;  4GTL A;  2P8T A;  4RMF A;  2ZJR S;  2RH6 A;  1Y1W A;  3G4A A;  3S2D C;  4C3H C;  3S15 K;  4KAR A;  2R92 K;  4OIR A;  1O26 A;  4QIW L;  5IP7 K;  1BJT A;  2KPU A;  5M5X K;  3DXJ A;  4A3F C;  1F93 A;  4KC6 A;  5C4J C;  1ZQ1 C;  1YNJ A;  3BP8 C;  5E68 A;  1TWA C;  2A6E A;  2WB1 L;  5JVG S;  2ZJQ S;  1JVI A;  1USM A;  3EQL A;  1EI6 A;  4XCH A;  2R93 K;  4WFN S;  5JVH S;  3M4O C;  1F9N A;  4JK1 A;  5FJ8 K;  5JVO A;  3T02 A;  4A3G K;  4YG2 A;  4MEX A;  1O27 A;  1XZP B;  1K83 A;  3LPX A;  1UV7 A;  3S17 C;  4LR2 A;  1VJE A;  1YCL A;  4A3D K;  1J6W A;  1TWF K;  2Y0S D;  1J6X A;  3GTM C;  2VUM A;  1O25 A;  2NVY K;  3T00 A;  5IP9 C;  4ZH4 A;  4C3I C;  4MQ9 A;  2YU9 K;  1Y1W C;  2KWA A;  2R92 A;  1IE0 A;  3HOU C;  1RU0 A;  3I4N K;  2V6T A;  4BBR C;  1I3Q A;  3HOV K;  1VLO A;  5IOS A;  3LAJ A;  4LLG A;  4P9S A;  2E2J C;  2XCQ A;  3S2D K;  2L5N A;  2R93 A;  1GE9 A;  4KM8 A;  3I4M K;  3GTK K;  3JST A;  4M1X A;  1HQM A;  3H3V L;  3HOZ K;  2JA6 C;  5EGE A;  1VRQ C;  2XCO A;  2GSU A;  5FLM K;  1TWF A;  1WOO A;  1K83 C;  4WFA S;  1TWA K;  1WIH A;  2NVY A;  3S1N K;  4KAW X;  3V4G A;  4DDQ A;  1L0W A;  2YU9 A;  2VUM C;  2WAQ D;  2ZUF A;  4AYB L;  3S15 C;  4KB2 A;  1XXC A;  2R92 C;  3G4C A;  3S17 K;  4A3J K;  4LJZ A;  3GDZ A;  3TFH A;  4IOC S;  2V6U A;  3GSI A;  1EFW A;  5M3F K;  4Q4Z A;  1X31 C;  5TMC A;  1I3Q C;  1R9T K;  4OIP A;  5IP9 K;  4C3I K;  4A3K C;  3GTK A;  3FKI K;  4KMH A;  3FHZ A;  3PIO S;  2R93 C;  1I50 A;  3HOU K;  4A3C K;  1FEU A;  3GEH A;  1BGW A;  4BBR K;  4LOW A;  2B63 K;  2NVX A;  2JH3 A;  2E2I K;  4G7H A;  2A69 A;  1XPP A;  1TWF C;  4G0U A;  1KQ4 A;  2WB1 D;  3AD8 C;  2NVY C;  2PA8 L;  1EH1 A;  4WIL A;  3S1M K;  5TMF A;  2YU9 C;  4LK0 A;  4G0V A;  4NOI A;  4G7O A;  2R7Z K;  4PAA A;  5IYC C;  3WOD A;  3I4N C;  1ZYR A;  1G51 A;  3HOV C;  3NUH A;  3N0C A;  3TFI A;  1R9T A;  2GAG C;  1XXA A;  2O5J A;  2P5M A;  4KM9 A;  2VUM K;  3FKI A;  4OIQ A;  1WSR A;  2NVQ C;  3I4M C;  3GTK C;  4GTE A;  1TWG A;  4WCE S;  3A8J A;  1WQH A;  3S1R K;  1I50 C;  2E2H K;  2A6H A;  4XLP A;  3HOZ C;  2CW0 A;  2B63 A;  2E2I A;  2PMZ L;  4YFN A;  3SZY A;  4G0W A;  3PO2 K;  1I3Q K;  5FLM C;  3GIR A;  2NVX C;  4QJV B;  1ZXO A;  4A3K K;  5TJ3 A;  3S2H K;  1WOS A;  4BXX C;  1XXB A;  3S1N C;  3GEI A;  4P5B A;  5D4D A;  2ZUE A;  5DM6 S;  4BY1 K;  5CJ9 A;  3GTG K;  2R7Z A;  4A3J C;  3DLL S;  1WCM A;  4ILD A;  4LQY A;  2GSN A;  3QX3 A;  2JA7 K;  1B4A A;  3S14 K;  1R9T C;  2D6F C;  3HOX K;  3AQP A;  2L3U A;  4AYB D;  3FKI C;  1DCP A;  1TWH A;  2PHC B;  5IOT A;  2E2H A;  1J6V A;  1INN A;  1WQG A;  4A3C C;  4WF9 S;  1YX2 A;  5IYC K;  3RZD K;  1TWG C;  1VH2 A;  4A3M K;  4A3L K;  3T01 A;  3L4K A;  3FOF A;  1Y1V K;  1IW7 A;  2B63 C;  2E2I C;  2W7V A;  3N3Y A;  5IOQ A;  1JQW A;  1PJ6 A;  4Q5S A;  1ISE A;  5M5W K;  3S1Q C;  2NVQ K;  3AQO A;  2JA8 C;  1I50 K;  1TWC K;  1IBA A;  3S1M C;  3GTG A;  3VA7 A;  2FQT A;  4GFQ A;  5HQH A;  3RZO K;  1PJ7 A;  2R7Z C;  2NVX K;  3N0B A;  2JA7 A;  4GTD A;  1DD5 A;  2V6S A;  1WCM C;  3PO3 K;  4WFB S;  4BXX K;  3BP3 A;  4O2D A;  3HKZ L;  2PA8 D;  1SFO K;  4A3E C;  1JOE A;  2RGR A;  3SZZ A;  2EBB A;  3BUE A;  1O28 A;  4KAT A;  3S0X A;  4FM9 A;  1SMY A;  1TWH C;  2E2H C;  3S1R C;  5IYB K;  2FQO A;  1Y1V A;  3ORE A;  4GT9 A;  4KN7 A;  3PO2 C;  3S16 C;  4GTB A;  3AD7 C;  4KMD A;  3S2H C;  4X6A C;  1ZVU A;  4A3B K;  1I6H C;  4IO9 S;  1TWC A;  2ZJP S;  1V5V A;  1WOR A;  2ZFZ A;  1IL2 A;  4QIW D;  1B4B A;  1TWG K;  4BY1 C;  3GTG C;  2BE5 A;  2PMZ D;  5L46 A;  5C4X K;  1O29 A;  5EGH A;  4GTF A;  3TFJ A;  1PJ5 A;  3S1Q K;  2JA7 C;  3GTL K;  2JA8 K;  4KAS A;  1SFO A;  3S14 C;  3K7A K;  1BDF A;  3HOX C;  4A3I K;  4XSX A;  3LYW A;  1ZBS A;  4LK1 A;  1XZQ B;  3A8K A;  3OPF A;  5M3M K;  3RZD C;  2Y3P A;  4Y7N K;  4A3M C;  4A3L C;  4YFK A;  1WCM K;  3GTP K;  3GTQ K;  1Y1V C;  1WQF A;  4BLB A;  2CFA B;  4A3E K;  4AH6 A;  4KMA A;  5IYD K;  2WAQ L;  4KMU A;  3MML B;  1TWH K;  4Y52 K;  3LAP A;  1TWC C;  5DM7 S;  5C3E K;  3S16 K;  5IOR A;  3RZO C;  3ERE D;  3GTO A;  3GTL A;  4X6A K;  3PO3 C;  2JA5 K;  1I6H K;  5HL7 S;  3AD9 C;  4KB4 A;  1SFO C;  3H3V D;  4J3N A;  1C0A A;  3M3Y K;  5IYB C;  1WOP A;  4QJV A;  3FOE A;  3GTP A;  1VGX A;  3GTQ A;  2PPB A;  4YFX A;  1DCH A;  2GSO A;  3HKZ D;  3TTG A;  4WJ4 A;  4C2M K;  4BBS K;  3HOW K;  1USO A;  4A3B C;  1XZP A;  5HL8 A;  2JA6 A;  4XSZ A;  2KXY A;  1EQR A;  3H0G K;  3IPJ A;  3ADA C;  1EK8 A;  5JFE A;  5C4X C;  5CHP A;  3GTO C;  3AH5 A;  3L4J A;  2GAH C;  2JA5 A;  1O2B A;  3CQZ K;  4A93 K;  1HI9 A;  3GTL C;  3HOY K;  4BY7 K;  3K7A C;  4A3I C;  1WSV A;  3GEE A;  4BKW A;  3GTJ K;  4C3J K;  1J98 A;  1YNN A;  4Y7N C;  4KN4 A;  4C45 A;  3CF5 S;  3GTP C;  3GTQ C;  1DCO A;  4IOA S;  5M5Y K;  4C3H K;  2NVT C;  4GZY A;  5IYD C;  3HXA A;  1IQ0 A;  5C44 C;  1I6V A;  4Y52 C;  4A3F K;  3H0G A;  5C4J K;  5C3E C;  2KQ1 A; 
#chains in the Genus database with same CATH homology
 1BDF A;  4YFN A;  4C3I C;  4MQ9 A;  3HOX C;  4A3I K;  2YU9 K;  3PO2 K;  4OIO A;  1I3Q K;  5FLM C;  1Y1W C;  4XSX A;  2NVX C;  2Y0S L;  4QJV B;  4LK1 A;  3HOU C;  4A3K K;  3S2H K;  5M3M K;  4BXX C;  3RZD C;  3S1N C;  3I4N K;  4Y7N K;  2JA5 C;  4A3M C;  4A3L C;  4YFK A;  5D4D A;  1WCM K;  3M4O K;  4BBR C;  3GTP K;  3HOV K;  3GTQ K;  4MEY A;  4BY1 K;  4G7Z A;  1Y1V C;  3GTG K;  2O5I A;  4LLG A;  2E2J C;  3S2D K;  4A3E K;  5IP7 C;  5IYD K;  4A3J C;  3I4M K;  3M3Y C;  3GTK K;  2WAQ L;  4KMU A;  3GTO K;  3GTM K;  1TWH K;  2JA7 K;  4Y52 K;  1HQM A;  1TWC C;  3H3V L;  3HOZ K;  4XLN A;  4OIN A;  1R9T C;  2JA6 C;  5C3E K;  3S14 K;  3HOX K;  3S16 K;  4C2M C;  4BBS C;  3HOW C;  5FLM K;  3RZO C;  1Y1W K;  4AYB D;  1K83 C;  3FKI C;  1TWA K;  4X6A K;  4A3C C;  3PO3 C;  3RZD K;  3S1N K;  5IYC K;  1TWG C;  4A3M K;  2JA5 K;  4A3L K;  1I6H K;  4A3G C;  2VUM C;  2WAQ D;  3H0G C;  1Y1V K;  1IW7 A;  1SFO C;  2B63 C;  3S15 C;  2E2I C;  4AYB L;  3H3V D;  2E2J K;  4A3D C;  2R92 C;  2NVT K;  3S17 K;  4Q5S A;  4A3J K;  4LJZ A;  3S1Q C;  5M5W K;  3M3Y K;  2NVQ K;  5C44 K;  3CQZ C;  5IYB C;  4A93 C;  4QJV A;  3HOY C;  2JA8 C;  2PPB A;  4YFX A;  4Q4Z A;  1I50 K;  3S1M C;  4BY7 C;  1TWC K;  5M3F K;  2JA6 K;  5TMC A;  1I3Q C;  1R9T K;  3HKZ D;  4OIP A;  5IP9 K;  4C3I K;  4C2M K;  4BBS K;  3HOW K;  4A3K C;  3RZO K;  1K83 K;  2R7Z C;  3FKI K;  3GTJ C;  2NVX K;  4A3B C;  4C3J C;  2R93 C;  3HOU K;  4A3C K;  2A68 A;  1WCM C;  3PO3 K;  4BXX K;  4XSZ A;  3HKZ L;  4BBR K;  2PA8 D;  3H0G K;  1SFO K;  3S2D C;  4C3H C;  4A3E C;  2E2I K;  2B63 K;  3S15 K;  4G7H A;  2R92 K;  2A69 A;  5C4X C;  1TWF C;  1XPP A;  4OIR A;  3GTO C;  4QIW L;  5IP7 K;  1SMY A;  1TWH C;  2WB1 D;  2E2H C;  3S1R C;  3DXJ A;  3CQZ K;  5M5X K;  5IYB K;  3GTL C;  4A3F C;  3HOY K;  4A93 K;  2NVY C;  2PA8 L;  5C4J C;  3S1M K;  5TMF A;  3K7A C;  4BY7 K;  4A3I C;  4KN7 A;  3PO2 C;  2YU9 C;  3S16 C;  1YNJ A;  4LK0 A;  4NOI A;  4G7O A;  1TWA C;  2A6E A;  2WB1 L;  3S2H C;  4X6A C;  2R7Z K;  3GTJ K;  5C4J K;  4A3B K;  5IYC C;  3EQL A;  3K7A K;  4C3J K;  2R93 K;  3WOD A;  1I6H C;  3I4N C;  1YNN A;  4Y7N C;  1ZYR A;  4KN4 A;  3M4O C;  4JK1 A;  4QIW D;  3GTP C;  3HOV C;  3GTQ C;  1TWG K;  5FJ8 K;  4BY1 C;  5M5Y K;  2O5J A;  4A3G K;  4YG2 A;  4MEX A;  3GTG C;  2VUM K;  2BE5 A;  4C3H K;  2PMZ D;  4OIQ A;  2NVT C;  3S17 C;  4GZY A;  5IYD C;  2NVQ C;  4A3D K;  5C44 C;  1I6V A;  3I4M C;  2Y0S D;  3GTK C;  1TWF K;  2PMZ L;  5C4X K;  3S1Q K;  3GTM C;  3S1R K;  2E2H K;  1I50 C;  2JA7 C;  4Y52 C;  3GTL K;  4A3F K;  2A6H A;  2NVY K;  4XLP A;  2JA8 K;  3HOZ C;  2CW0 A;  3S14 C;  5C3E C;  5IP9 C;  4ZH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...