3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
3HKZD 1HQMA 4C3HC 4Y7NC 2JA5K 5C44K 2R92K 4C2MC 1TWFK 3HOUK 2WAQL 4BXXK 3GTKC 3PO3K 3DXJA 1I50C 1I6VA 3I4MC 4A3GK 2Y0SL 4X6AK 4YG2A 1Y1VK 2WAQD 2R93C 1I6HC 1I3QC 5M3FK 5FJ8K 4BY1C 3EQLA 5IYCK 2O5JA 2Y0SD 4Q5SA 3HOYK 4Q4ZA 4AYBL 3M4OK 3S1RK 2A6EA 4GZYA 1TWGK 2A69A 2A6HA 2JA5C 2R92C 3WODA 5M3MK 1TWFC 2CW0A 3HOUC 4AYBD 4A3EK 4KMUA 2E2IK 3GTGK 3PO3C 2A68A 4BBRC 3HKZL 4LK0A 4OIOA 4BY7K 2JA8K 4X6AC 3I4NK 4C3IC 1Y1VC 4C3JK 1YNJA 5M5YK 1YNNA 3S17K 1TWAK 5IYCC 4Y52K 3HOYC 2NVYK 3PO2K 4LJZA 3M4OC 4A3JK 4XSZA 3S1RC 4MEYA 1TWGC 2E2JK 4LLGA 2PA8D 3HOVK 3RZOK 1ZYRA 4XSXA 4BBSK 5C3EK 5IYBK 2E2HK 4A3IK 3S2DK 2E2IC 3GTGC 4JK1A 2VUMC 5IP7K 3GTMK 4QIWD 4BY7C 2PPBA 2JA8C 3I4NC 4G7OA 2PMZD 2R7ZK 2YU9K 3S1QK 4C3JC 4A3BK 5IP9C 5FLMK 4KN7A 5C44C 3S17C 3S2HK 3GTQK 1TWAC 4Y52C 2JA6K 4A3DK 4BXXC 2NVYC 2O5IA 4A3JC 3FKIK 4NOIA 2E2JC 3H0GK 5C3EC 5IYBC 2E2HC 4A3IC 5TMFA 4OIQA 3S2DC 1K83K 4A3KK 3S1NK 3K7AK 5IP7C 3GTMC 4LK1A 2PA8L 3S14K 4A3CK 4C3HK 2YU9C 5D4DA 4A3BC 3GTLK 3HOWK 4OIPA 4QIWL 4G7ZA 5M5XK 2NVQK 1IW7A 3S2HC 4A3DC 3GTQC 1I50K 2PMZL 4A93K 4A3EC 3CQZK 3S1MK 3FKIC 4QJVA 2WB1L 3RZDK 4A3LK 2R93K 5TMCA 5C4XK 5IYDK 4OINA 4A3MK 3H0GC 1R9TK 1TWCK 4YFXA 4A3GC 1TWHK 3S15K 1K83C 4A3KC 3S1NC 4G7HA 2WB1D 4MQ9A 4A3CC 3M3YK 3PO2C 4A3FK 3HOZC 3HOXK 3GTPK 2NVXK 3HOWC 3GTLC 3H3VL 4OIRA 3HOVC 2NVQC 3RZOC 4BBSC 4BBRK 1WCMK 2B63K 4A93C 3GTOK 3GTJK 1SMYA 5M5WK 3CQZC 1Y1WK 3S1MC 3S16K 5IYDC 4XLNA 3RZDC 3H3VD 4A3LC 5C4XC 4C3IK 5C4JK 1SFOK 2JA7K 3HOZK 4A3MC 4Y7NK 4QJVB 2R7ZC 1R9TC 1TWCC 1TWHC 3S15C 3S1QC 5FLMC 4C2MK 4XLPA 3GTKK 4KN4A 3M3YC 3I4MK 2JA6C 4YFNA 4A3FC 3HOXC 3GTPC 2NVXC 4YFKA 1BDFA 1I6HK 4ZH4A 2B63C 1I3QK 2VUMK 4BY1K 1WCMC 3GTOC 3GTJC 4MEXA 3K7AC 1Y1WC 3S14C 3S16C 2NVTC 1XPPA 5C4JC 1SFOC 5IP9K 2JA7C 2NVTK 2BE5A
chains in the Genus database with same CATH superfamily
4C3HC 3GEIA 4C2MC 3CF5S 2FQOA 4WILA 4KARA 3HOUK 4BXXK 4U67S 1INNA 1I50C 2Y0SL 3AQOA 3GIRA 4LQYA 4GTDA 5FJ8K 4Q4ZA 4IO9S 4AYBL 1O27A 1TWAA 3S1RK 2A6EA 4BLBA 4KM9A 1WSVA 3WODA 5HL7S 1TWFC 2E2IK 4KMUA 3PO3C 2A68A 1UV7A 3HKZL 4LK0A 4GTFA 3I4NK 2KWAA 3MMLB 1Y1VC 4O2DA 4BLAA 5M5YK 1TWHA 4LJZA 2GSNA 1L0WA 3V4GA 4XSZA 1WOPA 1TWGC 1O2AA 1O26A 3RZOK 1ZYRA 4P5BA 4KDDA 5C3EK 5IYBK 2E2HK 3GTPA 2L3UA 2V6SA 3H0GA 4KMDA 3GTOA 2JA8C 3S0XA 2PMZD 1J6WA 1IL2A 4KN7A 4A3DK 4Y52C 2JA6K 2NVYC 5DM7S 4A3JC 4G0WA 3OPFA 2ZUEA 2R93A 3OEPA 1K83K 2JH3A 2PA8L 2KXYA 4QIWL 3CAGA 1IW7A 3GTQC 2B63A 3CQZK 1JQWA 5TMCA 2P8TA 1ZXOA 4A3GC 4IOCS 1VGXA 3LPXA 3OREA 4A3CC 3PO2C 1F93A 3HOXK 5IORA 2XCRB 3HOWC 3DLLS 2V6UA 3H3VL 2NVQC 4KM8A 4BBRK 1WOOA 4A93C 1JOEA 3GTJK 5M5WK 5HL8A 3RZDC 1G51A 1WQGA 2JA7K 4Y7NK 1TWHC 3S15C 5FLMC 4XLPA 4KN4A 4GFQA 3I4MK 4KATA 4LOWA 3GTPC 2NVXC 3GSIA 4LR2A 1DCHA 1I6HK 1Y1VA 2VUMK 1WOSA 3GTOC 4MEXA 3K7AC 5CHPA 3S14C 1F9NA 1XPPA 5C4JC 2P5MA 4WJ4A 2XCOA 1GE9A 3Q3QA 1IE0A 2JA5K 5C44K 2R92K 3GTKC 3NUHA 1WQHA 1I6VA 4X6AK 2R93C 1O24A 4RMFA 4ILDA 3EQLA 2O5JA 4Q5SA 1WQFA 4GT9A 3HOYK 4GZYA 1J6VA 1XZQB 1F7UA 1EH1A 1WIHA 1ZVUA 2A6HA 4WJ3M 3HOUC 4A3EK 1J98A 2CFAA 3A8JA 3GTGK 4M1XA 4BY7K 3CQZA 4KB2A 2R7ZA 1YNNA 4GTBA 1ZBSA 3GTQA 3S1RC 2E2JK 4XSXA 3SZZA 2E2IC 3I4NC 2GSOA 3S1QK 1PJ5A 1DCPA 2YU9K 4A3BK 2JA7A 4GTLA 3L4KA 3FKIK 2ZJRS 5C3EC 5IYBC 2E2HC 3GDZA 3S1NK 1PJ6A 4C3HK 5JVOA 3ERED 2JA5A 2NVXA 2ZJPS 4A3DC 1I50K 4WFAS 1EQRA 4KB4A 1B4BA 4A3MK 4G0UA 1TWCK 1K83C 4PAAA 4G7HA 5IOTA 3GTKA 3HOVC 4BBSC 1BGWA 3AQPA 1WCMK 3GTGA 3CQZC 1Y1WK 3S16K 2NVTK 1SFOK 1XZPB 4G0VA 4QJVB 2R7ZC 1USOA 5IOQA 3G4AA 3T00A 2FQTA 5L46A 4J3NA 3HOXC 3T01A 1BDFA 1I3QK 4BY1K 3GTJC 2ZFZA 1XXBA 1V5VA 4KMAA 4KMHA 5M3FK 2JA7C 5M3MK 3HKZD 1HQMA 4Y7NC 2YU9A 2RH6A 4PABA 5TJ3A 1J6XA 1X31C 2E2IA 3I4MC 2GAHC 2ZJQS 2WAQD 2KQ1A 1I6HC 4KASA 5IYCK 1ISEA 3M4OK 3N0BA 2JA5C 2R92C 2EBBA 2GAGC 3TFJA 2E2HA 4IOAS 4X6AC 4C3IC 1RU0A 4C3JK 1EI6A 1TWCA 1XXCA 3S17K 1TWAK 3HOYC 3PO2K 4MEYA 1USMA 2JA6A 2V6TA 4WFNS 1F7VA 2PA8D 3S2DK 4A3IK 3GTGC 4JK1A 5IP7K 1WCMA 3GTMK 1K83A 4QIWD 1WSRA 4BY7C 2PPBA 5IP9C 4XCHA 5FLMK 3S2HK 1VLOA 4GTEA 4BXXC 3QX3A 3BP8C 2O5IA 4NOIA 2E2JC 3H0GK 1VH2A 5TMFA 4A3KK 1I3QA 3K7AK 3S14K 3VA7A 2YU9C 5D4DA 4A3BC 3GTLK 2D6FC 4OIPA 4G7ZA 2PMZL 3L4JA 1EK8A 3FKIC 5EGHA 3GTJA 3S1MK 4A3LK 2R93K 5C4XK 3BUEA 5IYDK 5CJ9A 1DCOA 4KAWX 1R9TK 2XCQA 5IOSA 3S1NC 2WB1D 4MQ9A 1AB4A 3M3YK 3A8IA 4A3FK 3LAJA 3RZOC 2B63K 1SMYA 2VUMA 4XLNA 2PHCB 3HOZK 4A3MC 1TWCC 4C2MK 1DD5A 2R92A 1FEUA 1O28A 2JA6C 4YFNA 2ZUFA 4BKWA 5HQHA 3G4CA 1WCMC 2GSUA 4C45A 1XZQA 3GTMA 1Y1WC 3S16C 2NVTC 1SFOC 4WF9S 2BE5A 1TWFK 4DDQA 3N0CA 2WAQL 3GEEA 3PO3K 3DXJA 3ADAC 3AH5A 3PIOS 4YG2A 1BJTA 1Y1VK 3FHZA 3A8KA 2RGRA 3LYWA 3FOEA 1I3QC 3TTGA 4BY1C 1O25A 2Y0SD 1IBAA 1TWGK 2A69A 3GTLA 2CW0A 4AYBD 5DM6S 4BBRC 4OIOA 2JA8K 1YNJA 1IS1A 1R9TA 5IYCC 4Y52K 2NVYK 3M4OC 4A3JK 1WORA 3T02A 4LLGA 3FKIA 5E68A 3HOVK 4BBSK 1PJ7A 2W7VA 2Y3PA 2VUMC 1VRQC 2KPUA 2CFAB 4P5AA 4AH6A 4G7OA 2R7ZK 4C3JC 1BS2A 2L5NA 1B4AA 4WFBS 5C44C 3S17C 1ZQ1C 1EFWA 3GTQK 1TWAC 3IPJA 1I50A 1O2BA 5JFEA 4A3GK 3S2DC 1YX2A 4A3IC 4OIQA 3HXAA 5IP7C 3GTMC 4LK1A 4KC6A 4A3CK 5JVHS 4FZBA 5EGEA 3HOWK 2NVQK 5M5XK 1TWFA 3S2HC 4A93K 3LAPA 4A3EC 3TFIA 1XZPA 1C0AA 4QJVA 4WCES 2WB1L 3RZDK 5JVGS 4OINA 1Y1WA 3H0GC 1TWHK 4YFXA 3FOFA 1SFOA 3S15K 4A3KC 4FM9A 1IQ0A 1VJEA 3GTPK 2NVXK 1TWGA 3GTLC 1O29A 4OIRA 3PIPS 3GTOK 4GTAA 3SZYA 3TFHA 3N3YA 3S1MC 5IYDC 3H3VD 4A3LC 4C3IK 5C4JK 5C4XC 3GEHA 1KQ4A 1XXAA 1R9TC 3S1QC 3AD8C 3GTKK 3AD9C 3M3YC 3AD7C 1HI9A 2NVYA 3JSTA 3BP3A 4A3FC 4YFKA 4ZH4A 2B63C 1JVIA 1YCLA 4GTCA 1O2FB 4P9SA 5IP9K 3HOZC
chains in the Genus database with same CATH topology
3HKZD 1HQMA 4C3HC 4Y7NC 2JA5K 5C44K 2R92K 4C2MC 1TWFK 3HOUK 2WAQL 4BXXK 3GTKC 3PO3K 3DXJA 1I50C 1I6VA 3I4MC 4A3GK 2Y0SL 4X6AK 4YG2A 1Y1VK 2WAQD 2R93C 1I6HC 1I3QC 5M3FK 5FJ8K 4BY1C 3EQLA 5IYCK 2O5JA 2Y0SD 4Q5SA 3HOYK 4Q4ZA 4AYBL 3M4OK 3S1RK 2A6EA 4GZYA 1TWGK 2A69A 2A6HA 2JA5C 2R92C 3WODA 5M3MK 1TWFC 2CW0A 3HOUC 4AYBD 4A3EK 4KMUA 2E2IK 3GTGK 3PO3C 2A68A 4BBRC 3HKZL 4LK0A 4OIOA 4BY7K 2JA8K 4X6AC 3I4NK 4C3IC 1Y1VC 4C3JK 1YNJA 5M5YK 1YNNA 3S17K 1TWAK 5IYCC 4Y52K 3HOYC 2NVYK 3PO2K 4LJZA 3M4OC 4A3JK 4XSZA 3S1RC 4MEYA 1TWGC 2E2JK 4LLGA 2PA8D 3HOVK 3RZOK 1ZYRA 4XSXA 4BBSK 5C3EK 5IYBK 2E2HK 4A3IK 3S2DK 2E2IC 3GTGC 4JK1A 2VUMC 5IP7K 3GTMK 4QIWD 4BY7C 2PPBA 2JA8C 3I4NC 4G7OA 2PMZD 2R7ZK 2YU9K 3S1QK 4C3JC 4A3BK 5IP9C 5FLMK 4KN7A 5C44C 3S17C 3S2HK 3GTQK 1TWAC 4Y52C 2JA6K 4A3DK 4BXXC 2NVYC 2O5IA 4A3JC 3FKIK 4NOIA 2E2JC 3H0GK 5C3EC 5IYBC 2E2HC 4A3IC 5TMFA 4OIQA 3S2DC 1K83K 4A3KK 3S1NK 3K7AK 5IP7C 3GTMC 4LK1A 2PA8L 3S14K 4A3CK 4C3HK 2YU9C 5D4DA 4A3BC 3GTLK 3HOWK 4OIPA 4QIWL 4G7ZA 5M5XK 2NVQK 1IW7A 3S2HC 4A3DC 3GTQC 1I50K 2PMZL 4A93K 4A3EC 3CQZK 3S1MK 3FKIC 4QJVA 2WB1L 3RZDK 4A3LK 2R93K 5TMCA 5C4XK 5IYDK 4OINA 4A3MK 3H0GC 1R9TK 1TWCK 4YFXA 4A3GC 1TWHK 3S15K 1K83C 4A3KC 3S1NC 4G7HA 2WB1D 4MQ9A 4A3CC 3M3YK 3PO2C 4A3FK 3HOZC 3HOXK 3GTPK 2NVXK 3HOWC 3GTLC 3H3VL 4OIRA 3HOVC 2NVQC 3RZOC 4BBSC 4BBRK 1WCMK 2B63K 4A93C 3GTOK 3GTJK 1SMYA 5M5WK 3CQZC 1Y1WK 3S1MC 3S16K 5IYDC 4XLNA 3RZDC 3H3VD 4A3LC 5C4XC 4C3IK 5C4JK 1SFOK 2JA7K 3HOZK 4A3MC 4Y7NK 4QJVB 2R7ZC 1R9TC 1TWCC 1TWHC 3S15C 3S1QC 5FLMC 4C2MK 4XLPA 3GTKK 4KN4A 3M3YC 3I4MK 2JA6C 4YFNA 4A3FC 3HOXC 3GTPC 2NVXC 4YFKA 1BDFA 1I6HK 4ZH4A 2B63C 1I3QK 2VUMK 4BY1K 1WCMC 3GTOC 3GTJC 4MEXA 3K7AC 1Y1WC 3S14C 3S16C 2NVTC 1XPPA 5C4JC 1SFOC 5IP9K 2JA7C 2NVTK 2BE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ D;  1HQM A;  4C3H C;  4Y7N C;  2JA5 K;  5C44 K;  2R92 K;  4C2M C;  1TWF K;  3HOU K;  2WAQ L;  4BXX K;  3GTK C;  3PO3 K;  3DXJ A;  1I50 C;  1I6V A;  3I4M C;  4A3G K;  2Y0S L;  4X6A K;  4YG2 A;  1Y1V K;  2WAQ D;  2R93 C;  1I6H C;  1I3Q C;  5M3F K;  5FJ8 K;  4BY1 C;  3EQL A;  5IYC K;  2O5J A;  2Y0S D;  4Q5S A;  3HOY K;  4Q4Z A;  4AYB L;  3M4O K;  3S1R K;  2A6E A;  4GZY A;  1TWG K;  2A69 A;  2A6H A;  2JA5 C;  2R92 C;  3WOD A;  5M3M K;  1TWF C;  2CW0 A;  3HOU C;  4AYB D;  4A3E K;  4KMU A;  2E2I K;  3GTG K;  3PO3 C;  2A68 A;  4BBR C;  3HKZ L;  4LK0 A;  4OIO A;  4BY7 K;  2JA8 K;  4X6A C;  3I4N K;  4C3I C;  1Y1V C;  4C3J K;  1YNJ A;  5M5Y K;  1YNN A;  3S17 K;  1TWA K;  5IYC C;  4Y52 K;  3HOY C;  2NVY K;  3PO2 K;  4LJZ A;  3M4O C;  4A3J K;  4XSZ A;  3S1R C;  4MEY A;  1TWG C;  2E2J K;  4LLG A;  2PA8 D;  3HOV K;  3RZO K;  1ZYR A;  4XSX A;  4BBS K;  5C3E K;  5IYB K;  2E2H K;  4A3I K;  3S2D K;  2E2I C;  3GTG C;  4JK1 A;  2VUM C;  5IP7 K;  3GTM K;  4QIW D;  4BY7 C;  2PPB A;  2JA8 C;  3I4N C;  4G7O A;  2PMZ D;  2R7Z K;  2YU9 K;  3S1Q K;  4C3J C;  4A3B K;  5IP9 C;  5FLM K;  4KN7 A;  5C44 C;  3S17 C;  3S2H K;  3GTQ K;  1TWA C;  4Y52 C;  2JA6 K;  4A3D K;  4BXX C;  2NVY C;  2O5I A;  4A3J C;  3FKI K;  4NOI A;  2E2J C;  3H0G K;  5C3E C;  5IYB C;  2E2H C;  4A3I C;  5TMF A;  4OIQ A;  3S2D C;  1K83 K;  4A3K K;  3S1N K;  3K7A K;  5IP7 C;  3GTM C;  4LK1 A;  2PA8 L;  3S14 K;  4A3C K;  4C3H K;  2YU9 C;  5D4D A;  4A3B C;  3GTL K;  3HOW K;  4OIP A;  4QIW L;  4G7Z A;  5M5X K;  2NVQ K;  1IW7 A;  3S2H C;  4A3D C;  3GTQ C;  1I50 K;  2PMZ L;  4A93 K;  4A3E C;  3CQZ K;  3S1M K;  3FKI C;  4QJV A;  2WB1 L;  3RZD K;  4A3L K;  2R93 K;  5TMC A;  5C4X K;  5IYD K;  4OIN A;  4A3M K;  3H0G C;  1R9T K;  1TWC K;  4YFX A;  4A3G C;  1TWH K;  3S15 K;  1K83 C;  4A3K C;  3S1N C;  4G7H A;  2WB1 D;  4MQ9 A;  4A3C C;  3M3Y K;  3PO2 C;  4A3F K;  3HOZ C;  3HOX K;  3GTP K;  2NVX K;  3HOW C;  3GTL C;  3H3V L;  4OIR A;  3HOV C;  2NVQ C;  3RZO C;  4BBS C;  4BBR K;  1WCM K;  2B63 K;  4A93 C;  3GTO K;  3GTJ K;  1SMY A;  5M5W K;  3CQZ C;  1Y1W K;  3S1M C;  3S16 K;  5IYD C;  4XLN A;  3RZD C;  3H3V D;  4A3L C;  5C4X C;  4C3I K;  5C4J K;  1SFO K;  2JA7 K;  3HOZ K;  4A3M C;  4Y7N K;  4QJV B;  2R7Z C;  1R9T C;  1TWC C;  1TWH C;  3S15 C;  3S1Q C;  5FLM C;  4C2M K;  4XLP A;  3GTK K;  4KN4 A;  3M3Y C;  3I4M K;  2JA6 C;  4YFN A;  4A3F C;  3HOX C;  3GTP C;  2NVX C;  4YFK A;  1BDF A;  1I6H K;  4ZH4 A;  2B63 C;  1I3Q K;  2VUM K;  4BY1 K;  1WCM C;  3GTO C;  3GTJ C;  4MEX A;  3K7A C;  1Y1W C;  3S14 C;  3S16 C;  2NVT C;  1XPP A;  5C4J C;  1SFO C;  5IP9 K;  2JA7 C;  2NVT K;  2BE5 A; 
#chains in the Genus database with same CATH topology
 4C3H C;  3GEI A;  4C2M C;  3CF5 S;  2FQO A;  4WIL A;  4KAR A;  3HOU K;  4BXX K;  4U67 S;  1INN A;  1I50 C;  2Y0S L;  3AQO A;  3GIR A;  4LQY A;  4GTD A;  5FJ8 K;  4Q4Z A;  4IO9 S;  4AYB L;  1O27 A;  1TWA A;  3S1R K;  2A6E A;  4BLB A;  4KM9 A;  1WSV A;  3WOD A;  5HL7 S;  1TWF C;  2E2I K;  4KMU A;  3PO3 C;  2A68 A;  1UV7 A;  3HKZ L;  4LK0 A;  4GTF A;  3I4N K;  2KWA A;  3MML B;  1Y1V C;  4O2D A;  4BLA A;  5M5Y K;  1TWH A;  4LJZ A;  2GSN A;  1L0W A;  3V4G A;  4XSZ A;  1WOP A;  1TWG C;  1O2A A;  1O26 A;  3RZO K;  1ZYR A;  4P5B A;  4KDD A;  5C3E K;  5IYB K;  2E2H K;  3GTP A;  2L3U A;  2V6S A;  3H0G A;  4KMD A;  3GTO A;  2JA8 C;  3S0X A;  2PMZ D;  1J6W A;  1IL2 A;  4KN7 A;  4A3D K;  4Y52 C;  2JA6 K;  2NVY C;  5DM7 S;  4A3J C;  4G0W A;  3OPF A;  2ZUE A;  2R93 A;  3OEP A;  1K83 K;  2JH3 A;  2PA8 L;  2KXY A;  4QIW L;  3CAG A;  1IW7 A;  3GTQ C;  2B63 A;  3CQZ K;  1JQW A;  5TMC A;  2P8T A;  1ZXO A;  4A3G C;  4IOC S;  1VGX A;  3LPX A;  3ORE A;  4A3C C;  3PO2 C;  1F93 A;  3HOX K;  5IOR A;  2XCR B;  3HOW C;  3DLL S;  2V6U A;  3H3V L;  2NVQ C;  4KM8 A;  4BBR K;  1WOO A;  4A93 C;  1JOE A;  3GTJ K;  5M5W K;  5HL8 A;  3RZD C;  1G51 A;  1WQG A;  2JA7 K;  4Y7N K;  1TWH C;  3S15 C;  5FLM C;  4XLP A;  4KN4 A;  4GFQ A;  3I4M K;  4KAT A;  4LOW A;  3GTP C;  2NVX C;  3GSI A;  4LR2 A;  1DCH A;  1I6H K;  1Y1V A;  2VUM K;  1WOS A;  3GTO C;  4MEX A;  3K7A C;  5CHP A;  3S14 C;  1F9N A;  1XPP A;  5C4J C;  2P5M A;  4WJ4 A;  2XCO A;  1GE9 A;  3Q3Q A;  1IE0 A;  2JA5 K;  5C44 K;  2R92 K;  3GTK C;  3NUH A;  1WQH A;  1I6V A;  4X6A K;  2R93 C;  1O24 A;  4RMF A;  4ILD A;  3EQL A;  2O5J A;  4Q5S A;  1WQF A;  4GT9 A;  3HOY K;  4GZY A;  1J6V A;  1XZQ B;  1F7U A;  1EH1 A;  1WIH A;  1ZVU A;  2A6H A;  4WJ3 M;  3HOU C;  4A3E K;  1J98 A;  2CFA A;  3A8J A;  3GTG K;  4M1X A;  4BY7 K;  3CQZ A;  4KB2 A;  2R7Z A;  1YNN A;  4GTB A;  1ZBS A;  3GTQ A;  3S1R C;  2E2J K;  4XSX A;  3SZZ A;  2E2I C;  3I4N C;  2GSO A;  3S1Q K;  1PJ5 A;  1DCP A;  2YU9 K;  4A3B K;  2JA7 A;  4GTL A;  3L4K A;  3FKI K;  2ZJR S;  5C3E C;  5IYB C;  2E2H C;  3GDZ A;  3S1N K;  1PJ6 A;  4C3H K;  5JVO A;  3ERE D;  2JA5 A;  2NVX A;  2ZJP S;  4A3D C;  1I50 K;  4WFA S;  1EQR A;  4KB4 A;  1B4B A;  4A3M K;  4G0U A;  1TWC K;  1K83 C;  4PAA A;  4G7H A;  5IOT A;  3GTK A;  3HOV C;  4BBS C;  1BGW A;  3AQP A;  1WCM K;  3GTG A;  3CQZ C;  1Y1W K;  3S16 K;  2NVT K;  1SFO K;  1XZP B;  4G0V A;  4QJV B;  2R7Z C;  1USO A;  5IOQ A;  3G4A A;  3T00 A;  2FQT A;  5L46 A;  4J3N A;  3HOX C;  3T01 A;  1BDF A;  1I3Q K;  4BY1 K;  3GTJ C;  2ZFZ A;  1XXB A;  1V5V A;  4KMA A;  4KMH A;  5M3F K;  2JA7 C;  5M3M K;  3HKZ D;  1HQM A;  4Y7N C;  2YU9 A;  2RH6 A;  4PAB A;  5TJ3 A;  1J6X A;  1X31 C;  2E2I A;  3I4M C;  2GAH C;  2ZJQ S;  2WAQ D;  2KQ1 A;  1I6H C;  4KAS A;  5IYC K;  1ISE A;  3M4O K;  3N0B A;  2JA5 C;  2R92 C;  2EBB A;  2GAG C;  3TFJ A;  2E2H A;  4IOA S;  4X6A C;  4C3I C;  1RU0 A;  4C3J K;  1EI6 A;  1TWC A;  1XXC A;  3S17 K;  1TWA K;  3HOY C;  3PO2 K;  4MEY A;  1USM A;  2JA6 A;  2V6T A;  4WFN S;  1F7V A;  2PA8 D;  3S2D K;  4A3I K;  3GTG C;  4JK1 A;  5IP7 K;  1WCM A;  3GTM K;  1K83 A;  4QIW D;  1WSR A;  4BY7 C;  2PPB A;  5IP9 C;  4XCH A;  5FLM K;  3S2H K;  1VLO A;  4GTE A;  4BXX C;  3QX3 A;  3BP8 C;  2O5I A;  4NOI A;  2E2J C;  3H0G K;  1VH2 A;  5TMF A;  4A3K K;  1I3Q A;  3K7A K;  3S14 K;  3VA7 A;  2YU9 C;  5D4D A;  4A3B C;  3GTL K;  2D6F C;  4OIP A;  4G7Z A;  2PMZ L;  3L4J A;  1EK8 A;  3FKI C;  5EGH A;  3GTJ A;  3S1M K;  4A3L K;  2R93 K;  5C4X K;  3BUE A;  5IYD K;  5CJ9 A;  1DCO A;  4KAW X;  1R9T K;  2XCQ A;  5IOS A;  3S1N C;  2WB1 D;  4MQ9 A;  1AB4 A;  3M3Y K;  3A8I A;  4A3F K;  3LAJ A;  3RZO C;  2B63 K;  1SMY A;  2VUM A;  4XLN A;  2PHC B;  3HOZ K;  4A3M C;  1TWC C;  4C2M K;  1DD5 A;  2R92 A;  1FEU A;  1O28 A;  2JA6 C;  4YFN A;  2ZUF A;  4BKW A;  5HQH A;  3G4C A;  1WCM C;  2GSU A;  4C45 A;  1XZQ A;  3GTM A;  1Y1W C;  3S16 C;  2NVT C;  1SFO C;  4WF9 S;  2BE5 A;  1TWF K;  4DDQ A;  3N0C A;  2WAQ L;  3GEE A;  3PO3 K;  3DXJ A;  3ADA C;  3AH5 A;  3PIO S;  4YG2 A;  1BJT A;  1Y1V K;  3FHZ A;  3A8K A;  2RGR A;  3LYW A;  3FOE A;  1I3Q C;  3TTG A;  4BY1 C;  1O25 A;  2Y0S D;  1IBA A;  1TWG K;  2A69 A;  3GTL A;  2CW0 A;  4AYB D;  5DM6 S;  4BBR C;  4OIO A;  2JA8 K;  1YNJ A;  1IS1 A;  1R9T A;  5IYC C;  4Y52 K;  2NVY K;  3M4O C;  4A3J K;  1WOR A;  3T02 A;  4LLG A;  3FKI A;  5E68 A;  3HOV K;  4BBS K;  1PJ7 A;  2W7V A;  2Y3P A;  2VUM C;  1VRQ C;  2KPU A;  2CFA B;  4P5A A;  4AH6 A;  4G7O A;  2R7Z K;  4C3J C;  1BS2 A;  2L5N A;  1B4A A;  4WFB S;  5C44 C;  3S17 C;  1ZQ1 C;  1EFW A;  3GTQ K;  1TWA C;  3IPJ A;  1I50 A;  1O2B A;  5JFE A;  4A3G K;  3S2D C;  1YX2 A;  4A3I C;  4OIQ A;  3HXA A;  5IP7 C;  3GTM C;  4LK1 A;  4KC6 A;  4A3C K;  5JVH S;  4FZB A;  5EGE A;  3HOW K;  2NVQ K;  5M5X K;  1TWF A;  3S2H C;  4A93 K;  3LAP A;  4A3E C;  3TFI A;  1XZP A;  1C0A A;  4QJV A;  4WCE S;  2WB1 L;  3RZD K;  5JVG S;  4OIN A;  1Y1W A;  3H0G C;  1TWH K;  4YFX A;  3FOF A;  1SFO A;  3S15 K;  4A3K C;  4FM9 A;  1IQ0 A;  1VJE A;  3GTP K;  2NVX K;  1TWG A;  3GTL C;  1O29 A;  4OIR A;  3PIP S;  3GTO K;  4GTA A;  3SZY A;  3TFH A;  3N3Y A;  3S1M C;  5IYD C;  3H3V D;  4A3L C;  4C3I K;  5C4J K;  5C4X C;  3GEH A;  1KQ4 A;  1XXA A;  1R9T C;  3S1Q C;  3AD8 C;  3GTK K;  3AD9 C;  3M3Y C;  3AD7 C;  1HI9 A;  2NVY A;  3JST A;  3BP3 A;  4A3F C;  4YFK A;  4ZH4 A;  2B63 C;  1JVI A;  1YCL A;  4GTC A;  1O2F B;  4P9S A;  5IP9 K;  3HOZ C; 
#chains in the Genus database with same CATH homology
 3HKZ D;  1HQM A;  4C3H C;  4Y7N C;  2JA5 K;  5C44 K;  2R92 K;  4C2M C;  1TWF K;  3HOU K;  2WAQ L;  4BXX K;  3GTK C;  3PO3 K;  3DXJ A;  1I50 C;  1I6V A;  3I4M C;  4A3G K;  2Y0S L;  4X6A K;  4YG2 A;  1Y1V K;  2WAQ D;  2R93 C;  1I6H C;  1I3Q C;  5M3F K;  5FJ8 K;  4BY1 C;  3EQL A;  5IYC K;  2O5J A;  2Y0S D;  4Q5S A;  3HOY K;  4Q4Z A;  4AYB L;  3M4O K;  3S1R K;  2A6E A;  4GZY A;  1TWG K;  2A69 A;  2A6H A;  2JA5 C;  2R92 C;  3WOD A;  5M3M K;  1TWF C;  2CW0 A;  3HOU C;  4AYB D;  4A3E K;  4KMU A;  2E2I K;  3GTG K;  3PO3 C;  2A68 A;  4BBR C;  3HKZ L;  4LK0 A;  4OIO A;  4BY7 K;  2JA8 K;  4X6A C;  3I4N K;  4C3I C;  1Y1V C;  4C3J K;  1YNJ A;  5M5Y K;  1YNN A;  3S17 K;  1TWA K;  5IYC C;  4Y52 K;  3HOY C;  2NVY K;  3PO2 K;  4LJZ A;  3M4O C;  4A3J K;  4XSZ A;  3S1R C;  4MEY A;  1TWG C;  2E2J K;  4LLG A;  2PA8 D;  3HOV K;  3RZO K;  1ZYR A;  4XSX A;  4BBS K;  5C3E K;  5IYB K;  2E2H K;  4A3I K;  3S2D K;  2E2I C;  3GTG C;  4JK1 A;  2VUM C;  5IP7 K;  3GTM K;  4QIW D;  4BY7 C;  2PPB A;  2JA8 C;  3I4N C;  4G7O A;  2PMZ D;  2R7Z K;  2YU9 K;  3S1Q K;  4C3J C;  4A3B K;  5IP9 C;  5FLM K;  4KN7 A;  5C44 C;  3S17 C;  3S2H K;  3GTQ K;  1TWA C;  4Y52 C;  2JA6 K;  4A3D K;  4BXX C;  2NVY C;  2O5I A;  4A3J C;  3FKI K;  4NOI A;  2E2J C;  3H0G K;  5C3E C;  5IYB C;  2E2H C;  4A3I C;  5TMF A;  4OIQ A;  3S2D C;  1K83 K;  4A3K K;  3S1N K;  3K7A K;  5IP7 C;  3GTM C;  4LK1 A;  2PA8 L;  3S14 K;  4A3C K;  4C3H K;  2YU9 C;  5D4D A;  4A3B C;  3GTL K;  3HOW K;  4OIP A;  4QIW L;  4G7Z A;  5M5X K;  2NVQ K;  1IW7 A;  3S2H C;  4A3D C;  3GTQ C;  1I50 K;  2PMZ L;  4A93 K;  4A3E C;  3CQZ K;  3S1M K;  3FKI C;  4QJV A;  2WB1 L;  3RZD K;  4A3L K;  2R93 K;  5TMC A;  5C4X K;  5IYD K;  4OIN A;  4A3M K;  3H0G C;  1R9T K;  1TWC K;  4YFX A;  4A3G C;  1TWH K;  3S15 K;  1K83 C;  4A3K C;  3S1N C;  4G7H A;  2WB1 D;  4MQ9 A;  4A3C C;  3M3Y K;  3PO2 C;  4A3F K;  3HOZ C;  3HOX K;  3GTP K;  2NVX K;  3HOW C;  3GTL C;  3H3V L;  4OIR A;  3HOV C;  2NVQ C;  3RZO C;  4BBS C;  4BBR K;  1WCM K;  2B63 K;  4A93 C;  3GTO K;  3GTJ K;  1SMY A;  5M5W K;  3CQZ C;  1Y1W K;  3S1M C;  3S16 K;  5IYD C;  4XLN A;  3RZD C;  3H3V D;  4A3L C;  5C4X C;  4C3I K;  5C4J K;  1SFO K;  2JA7 K;  3HOZ K;  4A3M C;  4Y7N K;  4QJV B;  2R7Z C;  1R9T C;  1TWC C;  1TWH C;  3S15 C;  3S1Q C;  5FLM C;  4C2M K;  4XLP A;  3GTK K;  4KN4 A;  3M3Y C;  3I4M K;  2JA6 C;  4YFN A;  4A3F C;  3HOX C;  3GTP C;  2NVX C;  4YFK A;  1BDF A;  1I6H K;  4ZH4 A;  2B63 C;  1I3Q K;  2VUM K;  4BY1 K;  1WCM C;  3GTO C;  3GTJ C;  4MEX A;  3K7A C;  1Y1W C;  3S14 C;  3S16 C;  2NVT C;  1XPP A;  5C4J C;  1SFO C;  5IP9 K;  2JA7 C;  2NVT K;  2BE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...