3WODA

Rna polymerase-gp39 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
225
Chain Sequence
LKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promoter specificity switching of RNA polymerase by a phage factor.
pubmed doi rcsb
source organism Thermus phage p23-45
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2013-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3wodA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3wodA01
3PO2K 2NVTK 4A3MC 4LJZA 4A3BK 3S1QK 5TMFA 3S2HK 4X6AK 4BY1C 4A3DC 4A3IK 5IP9K 5IP7K 2VUMC 2NVYC 3HOXK 2O5JA 3I4NC 3S1MC 3RZDC 4BBSC 4Y7NK 3HOWK 5C3EC 3K7AC 4C3HK 3S1NC 2A6HA 2JA5K 3HOYK 4NOIA 4QJVA 5IYDK 4OIQA 3M3YK 3RZOC 1Y1VC 4Y52K 4G7HA 1R9TC 4LK1A 1IW7A 2R7ZC 4C2MK 5M3MK 5C4JK 2A69A 4A3EC 3I4MK 3GTGC 4BXXC 2PMZD 4KN7A 2B63K 4C3JC 4BY7K 5FJ8K 2R93C 4A93K 4A3LC 2E2JC 5D4DA 5C4XK 3FKIC 4Q4ZA 4Q5SA 4A3CK 2NVXC 1Y1WK 4Y52C 1BDFA 3HOUK 2R92C 4A3LK 3M4OC 3S17C 3S15C 1I50K 5IYBK 4A3FK 5C3EK 3GTPC 4C3JK 4LK0A 4G7ZA 2E2HC 3GTKC 2NVYK 4QIWL 4A3JK 3GTLC 5IYBC 3WODA 4A3FC 4C3IK 1I50C 5M3FK 3GTPK 3S15K 3S17K 3S2HC 4X6AC 3HKZL 4OINA 3S1NK 3GTJC 1SFOC 3HOUC 2NVTC 4QJVB 3PO2C 1ZYRA 4A3JC 3I4NK 4A93C 4LLGA 3GTLK 3GTOC 3S2DC 5C4XC 2E2HK 3GTKK 4BY7C 1TWHC 3EQLA 5TMCA 2YU9C 1TWHK 2YU9K 1TWCK 3S14C 3CQZK 4KMUA 2NVQK 2R93K 4YFKA 3GTOK 3M4OK 4C2MC 2WB1D 4QIWD 2R7ZK 3I4MC 2PPBA 4YFXA 1Y1WC 3GTJK 1SFOK 4A3CC 2JA5C 4JK1A 3CQZC 2WAQD 4Y7NC 4OIOA 4C3IC 3HOWC 3RZDK 3K7AK 3GTGK 4MQ9A 4A3EK 2A68A 3DXJA 5IP9C 1Y1VK 5C4JC 4YG2A 3M3YC 2Y0SL 5IYCC 4OIPA 4A3BC 4AYBL 1I6HK 4C3HC 2JA7C 3HOYC 3S1RC 2NVXK 3HOXC 1YNNA 3H3VD 4G7OA 5IP7C 4XLPA 3GTQK 4XSXA 2E2JK 4A3DK 4BY1K 2BE5A 3PO3K 2B63C 2JA6K 3S16K 4BBRK 5C44K 5C44C 2R92K 1YNJA 5FLMK 3PO3C 1R9TK 1K83C 3FKIK 5IYDC 2A6EA 3GTQC 2E2IC 3H3VL 2PMZL 5M5WK 4A3GK 3S1MK 4BBSK 3HOZK 4GZYA 3HOVC 1I6HC 4BXXK 1TWAK 2JA6C 3S16C 4A3KC 1I3QK 3H0GK 4AYBD 2O5IA 4A3IC 5M5XK 1I6VA 3RZOK 2JA8C 5M5YK 4MEYA 3S1QC 4A3GC 4MEXA 3HOVK 3HOZC 3S1RK 2WAQL 2CW0A 2PA8D 1TWFC 4KN4A 1HQMA 2JA7K 2VUMK 4YFNA 5IYCK 1SMYA 3GTMK 4XSZA 5FLMC 2JA8K 4XLNA 1XPPA 2PA8L 4OIRA 1TWAC 4BBRC 1I3QC 3H0GC 1TWGK 1TWGC 2WB1L 4A3KK 4ZH4A 1TWCC 2NVQC 4A3MK 2E2IK 3S14K 3GTMC 3HKZD 3S2DK 1WCMK 1WCMC 2Y0SD 1K83K 1TWFK
chains in the Genus database with same CATH superfamily
3PO2K 3Q3QA 1USMA 4LJZA 1WQFA 3S1QK 5TMFA 3GEHA 4A3IK 5IP9K 3G4AA 5IP7K 1X31C 3I4NC 4Y7NK 3HOWK 1ZXOA 1O27A 1ZVUA 3L4JA 4OIQA 1EI6A 1Y1VC 4Y52K 5C4JK 5M3MK 1TWAA 1WOPA 3L4KA 4DDQA 4P9SA 5L46A 2R93C 4J3NA 3AQPA 5EGHA 4A3LC 2E2JC 5D4DA 4Q4ZA 3OEPA 4Q5SA 1YCLA 4BLAA 1I50K 1JQWA 1GE9A 3AH5A 2NVYK 1EH1A 1XZQA 5IYBC 4C3IK 2KXYA 2CFAB 3S2HC 3GTKA 3HKZL 2E2HA 4OINA 4GTEA 4FM9A 1SFOC 4QJVB 3PO2C 4A3JC 4U67S 1WOSA 1ISEA 5C4XC 2E2HK 3GTKK 2L5NA 4BY7C 2R92A 3S14C 4KMUA 4YFKA 1O2BA 2WB1D 3IPJA 3I4MC 2PPBA 1WORA 3LPXA 1V5VA 1SFOA 1WCMA 4Y7NC 3HOWC 4KB2A 2W7VA 1Y1VK 2Y0SL 4KASA 4A3BC 3A8IA 4AYBL 4C3HC 3HOXC 3H3VD 3T00A 3GTQK 1TWHA 1VH2A 4A3DK 3PO3K 4LQYA 3DLLS 2XCQA 5C44K 3PIPS 1YNJA 1WIHA 5FLMK 4LOWA 1G51A 4BKWA 3GTQC 1B4BA 2E2IC 1XZQB 1DCHA 4BBSK 1I6HC 3LAPA 4A3KC 1I3QK 4A3IC 1L0WA 3RZOK 3AD9C 1JVIA 4MEYA 3S1QC 5JVOA 3HOVK 2JA7A 3S1RK 4WF9S 2V6UA 2WAQL 4KN4A 2JA8K 2PA8L 1J6VA 1O2FB 1I3QC 4A3KK 4G0VA 1TWGC 3S14K 1TWCC 3FOEA 3S2DK 1WCMC 2P8TA 4KAWX 4KARA 1WQGA 1TWFA 4A3MC 1PJ7A 4A3BK 4X6AK 4A3DC 1XXCA 2Y3PA 2NVYC 3HXAA 5DM7S 2O5JA 3GTQA 4C3HK 4PABA 4QJVA 3HOYK 4PAAA 1F93A 4G7HA 1R9TC 2ZUEA 4LK1A 3JSTA 4A3EC 2CFAA 3GTGC 4BXXC 4KN7A 5HL8A 2B63K 4C3JC 4BY7K 5FJ8K 3SZYA 2XCRB 5C4XK 3FKIC 2KWAA 2NVXC 4Y52C 1O28A 1BDFA 5CHPA 3HOUK 2R92C 4A3LK 4A3FK 1PJ6A 4GTFA 3GTPC 4IO9S 1VJEA 3BP8C 3CAGA 1VGXA 4A93K 1EQRA 3S15K 3S17K 1I50A 4O2DA 3S1NK 3HOUC 2JA5A 5IOTA 2B63A 1YX2A 3GTOC 3S2DC 3EQLA 2YU9C 3N0CA 3TTGA 1TWCK 3GDZA 2R93A 3M4OK 4C2MC 5IORA 2R7ZK 2GAGC 1SFOK 1RU0A 3CQZC 2P5MA 4GTDA 4OIOA 3T01A 4A3EK 2ZJQS 1Y1VA 1JOEA 1FEUA 2A68A 3LYWA 3DXJA 2PHCB 1KQ4A 5C4JC 4YG2A 4OIPA 1I6HK 2D6FC 2VUMA 3HOYC 3TFHA 3S1RC 2NVXK 4WFNS 1YNNA 4G7OA 1O2AA 1IS1A 2E2JK 3GIRA 4BY1K 2BE5A 1J98A 1USOA 2B63C 2JA6K 5C44C 2R92K 2V6TA 1BS2A 3PO3C 3FKIK 4WFBS 4KATA 3N3YA 5IYDC 4KDDA 1XXAA 3T02A 1O24A 3HOZK 1C0AA 4WJ3M 3H0GK 5M5XK 4AYBD 2O5IA 2FQOA 4A3GC 4GT9A 3LAJA 4WILA 2CW0A 2PA8D 1TWFC 3ADAC 1EFWA 4YFNA 3A8JA 5IYCK 3GTMK 4XSZA 1O29A 4OIRA 3FOFA 3H0GC 2ZUFA 1INNA 2ZJPS 1Y1WA 2XCOA 3OREA 1VLOA 1K83K 3AD7C 4P5BA 4GTBA 5TJ3A 2NVTK 4C45A 2ZJRS 3S2HK 3G4CA 2VUMC 4WCES 1WSRA 3HOXK 3S1MC 4GFQA 3GTMA 3S1NC 2A6HA 4NOIA 2E2IA 3M3YK 1IW7A 2A69A 3I4MK 3V4GA 3CQZA 5E68A 4KM9A 5EGEA 3FHZA 3VA7A 3ERED 4KM8A 1O26A 3FKIA 3M4OC 4AH6A 5C3EK 4C3JK 3PIOS 4G7ZA 4QIWL 3GTLC 4A3FC 3WODA 1I50C 3GTPK 1IBAA 1R9TA 3GTJC 2L3UA 1ZYRA 3I4NK 4LLGA 3QX3A 1TWHC 5TMCA 2YU9K 5JFEA 2NVQK 2NVXA 4IOAS 4G0UA 3GTOK 2FQTA 4QIWD 4YFXA 1F7VA 1Y1WC 4A3CC 2KQ1A 4JK1A 1AB4A 3GTJA 2WAQD 1XZPA 2R7ZA 3GTGK 4MQ9A 3GEIA 3GTPA 1TWGA 1ZQ1C 2NVYA 3AQOA 4XCHA 4GTCA 4LR2A 4GTAA 4XLPA 4P5AA 4ILDA 1IE0A 3S16K 3BUEA 1K83C 3H3VL 5HL7S 3HOVC 1TWAK 2JA6C 1EK8A 5IOSA 3A8KA 4MEXA 1XXBA 3HOZC 3CF5S 2JA7K 1HQMA 2VUMK 1VRQC 1SMYA 4KB4A 4XLNA 1TWAC 1I3QA 3BP3A 4BBRC 4FZBA 2WB1L 4ZH4A 2NVQC 4A3MK 2GAHC 1BJTA 1K83A 5HQHA 3GTMC 1PJ5A 1WSVA 1TWFK 4BLBA 5DM6S 4KMAA 4BY1C 4KC6A 1O25A 4BBSC 3RZDC 1J6WA 5C3EC 3K7AC 3S0XA 2JA5K 3AD8C 5IYDK 1IL2A 3SZZA 3RZOC 1ZBSA 2R7ZC 4C2MK 2GSNA 3GEEA 3MMLB 4WJ4A 2PMZD 2V6SA 4A3CK 1Y1WK 1XZPB 3S17C 3S15C 2KPUA 5IYBK 4KMDA 4G0WA 5CJ9A 4LK0A 2E2HC 3GTKC 4A3JK 1TWCA 1F9NA 5M3FK 4X6AC 2ZFZA 4IOCS 5IOQA 2NVTC 4GTLA 4A93C 3GTLK 1IQ0A 1DCPA 1TWHK 2R93K 2RH6A 3CQZK 2GSUA 3OPFA 3GSIA 3GTJK 2JA5C 1DD5A 5JVHS 3RZDK 4C3IC 3TFJA 3K7AK 4RMFA 5IP9C 2GSOA 3M3YC 5IYCC 1BGWA 1DCOA 2JA7C 4WFAS 5IP7C 2YU9A 4XSXA 2EBBA 1UV7A 2JH3A 3GTOA 2JA6A 1WQHA 4BBRK 1R9TK 3TFIA 2A6EA 1B4AA 3N0BA 2PMZL 5M5WK 4A3GK 3S1MK 1WOOA 4KMHA 4GZYA 4BXXK 3S16C 1I6VA 1F7UA 2JA8C 5M5YK 5JVGS 4M1XA 2RGRA 1HI9A 3NUHA 5FLMC 3GTGA 1XPPA 3H0GA 1TWGK 3GTLA 2E2IK 1J6XA 3HKZD 1WCMK 2Y0SD
chains in the Genus database with same CATH topology
3PO2K 2NVTK 4A3MC 4LJZA 4A3BK 3S1QK 5TMFA 3S2HK 4X6AK 4BY1C 4A3DC 4A3IK 5IP9K 5IP7K 2VUMC 2NVYC 3HOXK 2O5JA 3I4NC 3S1MC 3RZDC 4BBSC 4Y7NK 3HOWK 5C3EC 3K7AC 4C3HK 3S1NC 2A6HA 2JA5K 3HOYK 4NOIA 4QJVA 5IYDK 4OIQA 3M3YK 3RZOC 1Y1VC 4Y52K 4G7HA 1R9TC 4LK1A 1IW7A 2R7ZC 4C2MK 5M3MK 5C4JK 2A69A 4A3EC 3I4MK 3GTGC 4BXXC 2PMZD 4KN7A 2B63K 4C3JC 4BY7K 5FJ8K 2R93C 4A93K 4A3LC 2E2JC 5D4DA 5C4XK 3FKIC 4Q4ZA 4Q5SA 4A3CK 2NVXC 1Y1WK 4Y52C 1BDFA 3HOUK 2R92C 4A3LK 3M4OC 3S17C 3S15C 1I50K 5IYBK 4A3FK 5C3EK 3GTPC 4C3JK 4LK0A 4G7ZA 2E2HC 3GTKC 2NVYK 4QIWL 4A3JK 3GTLC 5IYBC 3WODA 4A3FC 4C3IK 1I50C 5M3FK 3GTPK 3S15K 3S17K 3S2HC 4X6AC 3HKZL 4OINA 3S1NK 3GTJC 1SFOC 3HOUC 2NVTC 4QJVB 3PO2C 1ZYRA 4A3JC 3I4NK 4A93C 4LLGA 3GTLK 3GTOC 3S2DC 5C4XC 2E2HK 3GTKK 4BY7C 1TWHC 3EQLA 5TMCA 2YU9C 1TWHK 2YU9K 1TWCK 3S14C 3CQZK 4KMUA 2NVQK 2R93K 4YFKA 3GTOK 3M4OK 4C2MC 2WB1D 4QIWD 2R7ZK 3I4MC 2PPBA 4YFXA 1Y1WC 3GTJK 1SFOK 4A3CC 2JA5C 4JK1A 3CQZC 2WAQD 4Y7NC 4OIOA 4C3IC 3HOWC 3RZDK 3K7AK 3GTGK 4MQ9A 4A3EK 2A68A 3DXJA 5IP9C 1Y1VK 5C4JC 4YG2A 3M3YC 2Y0SL 5IYCC 4OIPA 4A3BC 4AYBL 1I6HK 4C3HC 2JA7C 3HOYC 3S1RC 2NVXK 3HOXC 1YNNA 3H3VD 4G7OA 5IP7C 4XLPA 3GTQK 4XSXA 2E2JK 4A3DK 4BY1K 2BE5A 3PO3K 2B63C 2JA6K 3S16K 4BBRK 5C44K 5C44C 2R92K 1YNJA 5FLMK 3PO3C 1R9TK 1K83C 3FKIK 5IYDC 2A6EA 3GTQC 2E2IC 3H3VL 2PMZL 5M5WK 4A3GK 3S1MK 4BBSK 3HOZK 4GZYA 3HOVC 1I6HC 4BXXK 1TWAK 2JA6C 3S16C 4A3KC 1I3QK 3H0GK 4AYBD 2O5IA 4A3IC 5M5XK 1I6VA 3RZOK 2JA8C 5M5YK 4MEYA 3S1QC 4A3GC 4MEXA 3HOVK 3HOZC 3S1RK 2WAQL 2CW0A 2PA8D 1TWFC 4KN4A 1HQMA 2JA7K 2VUMK 4YFNA 5IYCK 1SMYA 3GTMK 4XSZA 5FLMC 2JA8K 4XLNA 1XPPA 2PA8L 4OIRA 1TWAC 4BBRC 1I3QC 3H0GC 1TWGK 1TWGC 2WB1L 4A3KK 4ZH4A 1TWCC 2NVQC 4A3MK 2E2IK 3S14K 3GTMC 3HKZD 3S2DK 1WCMK 1WCMC 2Y0SD 1K83K 1TWFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 K;  2NVT K;  4A3M C;  4LJZ A;  4A3B K;  3S1Q K;  5TMF A;  3S2H K;  4X6A K;  4BY1 C;  4A3D C;  4A3I K;  5IP9 K;  5IP7 K;  2VUM C;  2NVY C;  3HOX K;  2O5J A;  3I4N C;  3S1M C;  3RZD C;  4BBS C;  4Y7N K;  3HOW K;  5C3E C;  3K7A C;  4C3H K;  3S1N C;  2A6H A;  2JA5 K;  3HOY K;  4NOI A;  4QJV A;  5IYD K;  4OIQ A;  3M3Y K;  3RZO C;  1Y1V C;  4Y52 K;  4G7H A;  1R9T C;  4LK1 A;  1IW7 A;  2R7Z C;  4C2M K;  5M3M K;  5C4J K;  2A69 A;  4A3E C;  3I4M K;  3GTG C;  4BXX C;  2PMZ D;  4KN7 A;  2B63 K;  4C3J C;  4BY7 K;  5FJ8 K;  2R93 C;  4A93 K;  4A3L C;  2E2J C;  5D4D A;  5C4X K;  3FKI C;  4Q4Z A;  4Q5S A;  4A3C K;  2NVX C;  1Y1W K;  4Y52 C;  1BDF A;  3HOU K;  2R92 C;  4A3L K;  3M4O C;  3S17 C;  3S15 C;  1I50 K;  5IYB K;  4A3F K;  5C3E K;  3GTP C;  4C3J K;  4LK0 A;  4G7Z A;  2E2H C;  3GTK C;  2NVY K;  4QIW L;  4A3J K;  3GTL C;  5IYB C;  3WOD A;  4A3F C;  4C3I K;  1I50 C;  5M3F K;  3GTP K;  3S15 K;  3S17 K;  3S2H C;  4X6A C;  3HKZ L;  4OIN A;  3S1N K;  3GTJ C;  1SFO C;  3HOU C;  2NVT C;  4QJV B;  3PO2 C;  1ZYR A;  4A3J C;  3I4N K;  4A93 C;  4LLG A;  3GTL K;  3GTO C;  3S2D C;  5C4X C;  2E2H K;  3GTK K;  4BY7 C;  1TWH C;  3EQL A;  5TMC A;  2YU9 C;  1TWH K;  2YU9 K;  1TWC K;  3S14 C;  3CQZ K;  4KMU A;  2NVQ K;  2R93 K;  4YFK A;  3GTO K;  3M4O K;  4C2M C;  2WB1 D;  4QIW D;  2R7Z K;  3I4M C;  2PPB A;  4YFX A;  1Y1W C;  3GTJ K;  1SFO K;  4A3C C;  2JA5 C;  4JK1 A;  3CQZ C;  2WAQ D;  4Y7N C;  4OIO A;  4C3I C;  3HOW C;  3RZD K;  3K7A K;  3GTG K;  4MQ9 A;  4A3E K;  2A68 A;  3DXJ A;  5IP9 C;  1Y1V K;  5C4J C;  4YG2 A;  3M3Y C;  2Y0S L;  5IYC C;  4OIP A;  4A3B C;  4AYB L;  1I6H K;  4C3H C;  2JA7 C;  3HOY C;  3S1R C;  2NVX K;  3HOX C;  1YNN A;  3H3V D;  4G7O A;  5IP7 C;  4XLP A;  3GTQ K;  4XSX A;  2E2J K;  4A3D K;  4BY1 K;  2BE5 A;  3PO3 K;  2B63 C;  2JA6 K;  3S16 K;  4BBR K;  5C44 K;  5C44 C;  2R92 K;  1YNJ A;  5FLM K;  3PO3 C;  1R9T K;  1K83 C;  3FKI K;  5IYD C;  2A6E A;  3GTQ C;  2E2I C;  3H3V L;  2PMZ L;  5M5W K;  4A3G K;  3S1M K;  4BBS K;  3HOZ K;  4GZY A;  3HOV C;  1I6H C;  4BXX K;  1TWA K;  2JA6 C;  3S16 C;  4A3K C;  1I3Q K;  3H0G K;  4AYB D;  2O5I A;  4A3I C;  5M5X K;  1I6V A;  3RZO K;  2JA8 C;  5M5Y K;  4MEY A;  3S1Q C;  4A3G C;  4MEX A;  3HOV K;  3HOZ C;  3S1R K;  2WAQ L;  2CW0 A;  2PA8 D;  1TWF C;  4KN4 A;  1HQM A;  2JA7 K;  2VUM K;  4YFN A;  5IYC K;  1SMY A;  3GTM K;  4XSZ A;  5FLM C;  2JA8 K;  4XLN A;  1XPP A;  2PA8 L;  4OIR A;  1TWA C;  4BBR C;  1I3Q C;  3H0G C;  1TWG K;  1TWG C;  2WB1 L;  4A3K K;  4ZH4 A;  1TWC C;  2NVQ C;  4A3M K;  2E2I K;  3S14 K;  3GTM C;  3HKZ D;  3S2D K;  1WCM K;  1WCM C;  2Y0S D;  1K83 K;  1TWF K; 
#chains in the Genus database with same CATH topology
 3PO2 K;  3Q3Q A;  1USM A;  4LJZ A;  1WQF A;  3S1Q K;  5TMF A;  3GEH A;  4A3I K;  5IP9 K;  3G4A A;  5IP7 K;  1X31 C;  3I4N C;  4Y7N K;  3HOW K;  1ZXO A;  1O27 A;  1ZVU A;  3L4J A;  4OIQ A;  1EI6 A;  1Y1V C;  4Y52 K;  5C4J K;  5M3M K;  1TWA A;  1WOP A;  3L4K A;  4DDQ A;  4P9S A;  5L46 A;  2R93 C;  4J3N A;  3AQP A;  5EGH A;  4A3L C;  2E2J C;  5D4D A;  4Q4Z A;  3OEP A;  4Q5S A;  1YCL A;  4BLA A;  1I50 K;  1JQW A;  1GE9 A;  3AH5 A;  2NVY K;  1EH1 A;  1XZQ A;  5IYB C;  4C3I K;  2KXY A;  2CFA B;  3S2H C;  3GTK A;  3HKZ L;  2E2H A;  4OIN A;  4GTE A;  4FM9 A;  1SFO C;  4QJV B;  3PO2 C;  4A3J C;  4U67 S;  1WOS A;  1ISE A;  5C4X C;  2E2H K;  3GTK K;  2L5N A;  4BY7 C;  2R92 A;  3S14 C;  4KMU A;  4YFK A;  1O2B A;  2WB1 D;  3IPJ A;  3I4M C;  2PPB A;  1WOR A;  3LPX A;  1V5V A;  1SFO A;  1WCM A;  4Y7N C;  3HOW C;  4KB2 A;  2W7V A;  1Y1V K;  2Y0S L;  4KAS A;  4A3B C;  3A8I A;  4AYB L;  4C3H C;  3HOX C;  3H3V D;  3T00 A;  3GTQ K;  1TWH A;  1VH2 A;  4A3D K;  3PO3 K;  4LQY A;  3DLL S;  2XCQ A;  5C44 K;  3PIP S;  1YNJ A;  1WIH A;  5FLM K;  4LOW A;  1G51 A;  4BKW A;  3GTQ C;  1B4B A;  2E2I C;  1XZQ B;  1DCH A;  4BBS K;  1I6H C;  3LAP A;  4A3K C;  1I3Q K;  4A3I C;  1L0W A;  3RZO K;  3AD9 C;  1JVI A;  4MEY A;  3S1Q C;  5JVO A;  3HOV K;  2JA7 A;  3S1R K;  4WF9 S;  2V6U A;  2WAQ L;  4KN4 A;  2JA8 K;  2PA8 L;  1J6V A;  1O2F B;  1I3Q C;  4A3K K;  4G0V A;  1TWG C;  3S14 K;  1TWC C;  3FOE A;  3S2D K;  1WCM C;  2P8T A;  4KAW X;  4KAR A;  1WQG A;  1TWF A;  4A3M C;  1PJ7 A;  4A3B K;  4X6A K;  4A3D C;  1XXC A;  2Y3P A;  2NVY C;  3HXA A;  5DM7 S;  2O5J A;  3GTQ A;  4C3H K;  4PAB A;  4QJV A;  3HOY K;  4PAA A;  1F93 A;  4G7H A;  1R9T C;  2ZUE A;  4LK1 A;  3JST A;  4A3E C;  2CFA A;  3GTG C;  4BXX C;  4KN7 A;  5HL8 A;  2B63 K;  4C3J C;  4BY7 K;  5FJ8 K;  3SZY A;  2XCR B;  5C4X K;  3FKI C;  2KWA A;  2NVX C;  4Y52 C;  1O28 A;  1BDF A;  5CHP A;  3HOU K;  2R92 C;  4A3L K;  4A3F K;  1PJ6 A;  4GTF A;  3GTP C;  4IO9 S;  1VJE A;  3BP8 C;  3CAG A;  1VGX A;  4A93 K;  1EQR A;  3S15 K;  3S17 K;  1I50 A;  4O2D A;  3S1N K;  3HOU C;  2JA5 A;  5IOT A;  2B63 A;  1YX2 A;  3GTO C;  3S2D C;  3EQL A;  2YU9 C;  3N0C A;  3TTG A;  1TWC K;  3GDZ A;  2R93 A;  3M4O K;  4C2M C;  5IOR A;  2R7Z K;  2GAG C;  1SFO K;  1RU0 A;  3CQZ C;  2P5M A;  4GTD A;  4OIO A;  3T01 A;  4A3E K;  2ZJQ S;  1Y1V A;  1JOE A;  1FEU A;  2A68 A;  3LYW A;  3DXJ A;  2PHC B;  1KQ4 A;  5C4J C;  4YG2 A;  4OIP A;  1I6H K;  2D6F C;  2VUM A;  3HOY C;  3TFH A;  3S1R C;  2NVX K;  4WFN S;  1YNN A;  4G7O A;  1O2A A;  1IS1 A;  2E2J K;  3GIR A;  4BY1 K;  2BE5 A;  1J98 A;  1USO A;  2B63 C;  2JA6 K;  5C44 C;  2R92 K;  2V6T A;  1BS2 A;  3PO3 C;  3FKI K;  4WFB S;  4KAT A;  3N3Y A;  5IYD C;  4KDD A;  1XXA A;  3T02 A;  1O24 A;  3HOZ K;  1C0A A;  4WJ3 M;  3H0G K;  5M5X K;  4AYB D;  2O5I A;  2FQO A;  4A3G C;  4GT9 A;  3LAJ A;  4WIL A;  2CW0 A;  2PA8 D;  1TWF C;  3ADA C;  1EFW A;  4YFN A;  3A8J A;  5IYC K;  3GTM K;  4XSZ A;  1O29 A;  4OIR A;  3FOF A;  3H0G C;  2ZUF A;  1INN A;  2ZJP S;  1Y1W A;  2XCO A;  3ORE A;  1VLO A;  1K83 K;  3AD7 C;  4P5B A;  4GTB A;  5TJ3 A;  2NVT K;  4C45 A;  2ZJR S;  3S2H K;  3G4C A;  2VUM C;  4WCE S;  1WSR A;  3HOX K;  3S1M C;  4GFQ A;  3GTM A;  3S1N C;  2A6H A;  4NOI A;  2E2I A;  3M3Y K;  1IW7 A;  2A69 A;  3I4M K;  3V4G A;  3CQZ A;  5E68 A;  4KM9 A;  5EGE A;  3FHZ A;  3VA7 A;  3ERE D;  4KM8 A;  1O26 A;  3FKI A;  3M4O C;  4AH6 A;  5C3E K;  4C3J K;  3PIO S;  4G7Z A;  4QIW L;  3GTL C;  4A3F C;  3WOD A;  1I50 C;  3GTP K;  1IBA A;  1R9T A;  3GTJ C;  2L3U A;  1ZYR A;  3I4N K;  4LLG A;  3QX3 A;  1TWH C;  5TMC A;  2YU9 K;  5JFE A;  2NVQ K;  2NVX A;  4IOA S;  4G0U A;  3GTO K;  2FQT A;  4QIW D;  4YFX A;  1F7V A;  1Y1W C;  4A3C C;  2KQ1 A;  4JK1 A;  1AB4 A;  3GTJ A;  2WAQ D;  1XZP A;  2R7Z A;  3GTG K;  4MQ9 A;  3GEI A;  3GTP A;  1TWG A;  1ZQ1 C;  2NVY A;  3AQO A;  4XCH A;  4GTC A;  4LR2 A;  4GTA A;  4XLP A;  4P5A A;  4ILD A;  1IE0 A;  3S16 K;  3BUE A;  1K83 C;  3H3V L;  5HL7 S;  3HOV C;  1TWA K;  2JA6 C;  1EK8 A;  5IOS A;  3A8K A;  4MEX A;  1XXB A;  3HOZ C;  3CF5 S;  2JA7 K;  1HQM A;  2VUM K;  1VRQ C;  1SMY A;  4KB4 A;  4XLN A;  1TWA C;  1I3Q A;  3BP3 A;  4BBR C;  4FZB A;  2WB1 L;  4ZH4 A;  2NVQ C;  4A3M K;  2GAH C;  1BJT A;  1K83 A;  5HQH A;  3GTM C;  1PJ5 A;  1WSV A;  1TWF K;  4BLB A;  5DM6 S;  4KMA A;  4BY1 C;  4KC6 A;  1O25 A;  4BBS C;  3RZD C;  1J6W A;  5C3E C;  3K7A C;  3S0X A;  2JA5 K;  3AD8 C;  5IYD K;  1IL2 A;  3SZZ A;  3RZO C;  1ZBS A;  2R7Z C;  4C2M K;  2GSN A;  3GEE A;  3MML B;  4WJ4 A;  2PMZ D;  2V6S A;  4A3C K;  1Y1W K;  1XZP B;  3S17 C;  3S15 C;  2KPU A;  5IYB K;  4KMD A;  4G0W A;  5CJ9 A;  4LK0 A;  2E2H C;  3GTK C;  4A3J K;  1TWC A;  1F9N A;  5M3F K;  4X6A C;  2ZFZ A;  4IOC S;  5IOQ A;  2NVT C;  4GTL A;  4A93 C;  3GTL K;  1IQ0 A;  1DCP A;  1TWH K;  2R93 K;  2RH6 A;  3CQZ K;  2GSU A;  3OPF A;  3GSI A;  3GTJ K;  2JA5 C;  1DD5 A;  5JVH S;  3RZD K;  4C3I C;  3TFJ A;  3K7A K;  4RMF A;  5IP9 C;  2GSO A;  3M3Y C;  5IYC C;  1BGW A;  1DCO A;  2JA7 C;  4WFA S;  5IP7 C;  2YU9 A;  4XSX A;  2EBB A;  1UV7 A;  2JH3 A;  3GTO A;  2JA6 A;  1WQH A;  4BBR K;  1R9T K;  3TFI A;  2A6E A;  1B4A A;  3N0B A;  2PMZ L;  5M5W K;  4A3G K;  3S1M K;  1WOO A;  4KMH A;  4GZY A;  4BXX K;  3S16 C;  1I6V A;  1F7U A;  2JA8 C;  5M5Y K;  5JVG S;  4M1X A;  2RGR A;  1HI9 A;  3NUH A;  5FLM C;  3GTG A;  1XPP A;  3H0G A;  1TWG K;  3GTL A;  2E2I K;  1J6X A;  3HKZ D;  1WCM K;  2Y0S D; 
#chains in the Genus database with same CATH homology
 3PO2 K;  2NVT K;  4A3M C;  4LJZ A;  4A3B K;  3S1Q K;  5TMF A;  3S2H K;  4X6A K;  4BY1 C;  4A3D C;  4A3I K;  5IP9 K;  5IP7 K;  2VUM C;  2NVY C;  3HOX K;  2O5J A;  3I4N C;  3S1M C;  3RZD C;  4BBS C;  4Y7N K;  3HOW K;  5C3E C;  3K7A C;  4C3H K;  3S1N C;  2A6H A;  2JA5 K;  3HOY K;  4NOI A;  4QJV A;  5IYD K;  4OIQ A;  3M3Y K;  3RZO C;  1Y1V C;  4Y52 K;  4G7H A;  1R9T C;  4LK1 A;  1IW7 A;  2R7Z C;  4C2M K;  5M3M K;  5C4J K;  2A69 A;  4A3E C;  3I4M K;  3GTG C;  4BXX C;  2PMZ D;  4KN7 A;  2B63 K;  4C3J C;  4BY7 K;  5FJ8 K;  2R93 C;  4A93 K;  4A3L C;  2E2J C;  5D4D A;  5C4X K;  3FKI C;  4Q4Z A;  4Q5S A;  4A3C K;  2NVX C;  1Y1W K;  4Y52 C;  1BDF A;  3HOU K;  2R92 C;  4A3L K;  3M4O C;  3S17 C;  3S15 C;  1I50 K;  5IYB K;  4A3F K;  5C3E K;  3GTP C;  4C3J K;  4LK0 A;  4G7Z A;  2E2H C;  3GTK C;  2NVY K;  4QIW L;  4A3J K;  3GTL C;  5IYB C;  3WOD A;  4A3F C;  4C3I K;  1I50 C;  5M3F K;  3GTP K;  3S15 K;  3S17 K;  3S2H C;  4X6A C;  3HKZ L;  4OIN A;  3S1N K;  3GTJ C;  1SFO C;  3HOU C;  2NVT C;  4QJV B;  3PO2 C;  1ZYR A;  4A3J C;  3I4N K;  4A93 C;  4LLG A;  3GTL K;  3GTO C;  3S2D C;  5C4X C;  2E2H K;  3GTK K;  4BY7 C;  1TWH C;  3EQL A;  5TMC A;  2YU9 C;  1TWH K;  2YU9 K;  1TWC K;  3S14 C;  3CQZ K;  4KMU A;  2NVQ K;  2R93 K;  4YFK A;  3GTO K;  3M4O K;  4C2M C;  2WB1 D;  4QIW D;  2R7Z K;  3I4M C;  2PPB A;  4YFX A;  1Y1W C;  3GTJ K;  1SFO K;  4A3C C;  2JA5 C;  4JK1 A;  3CQZ C;  2WAQ D;  4Y7N C;  4OIO A;  4C3I C;  3HOW C;  3RZD K;  3K7A K;  3GTG K;  4MQ9 A;  4A3E K;  2A68 A;  3DXJ A;  5IP9 C;  1Y1V K;  5C4J C;  4YG2 A;  3M3Y C;  2Y0S L;  5IYC C;  4OIP A;  4A3B C;  4AYB L;  1I6H K;  4C3H C;  2JA7 C;  3HOY C;  3S1R C;  2NVX K;  3HOX C;  1YNN A;  3H3V D;  4G7O A;  5IP7 C;  4XLP A;  3GTQ K;  4XSX A;  2E2J K;  4A3D K;  4BY1 K;  2BE5 A;  3PO3 K;  2B63 C;  2JA6 K;  3S16 K;  4BBR K;  5C44 K;  5C44 C;  2R92 K;  1YNJ A;  5FLM K;  3PO3 C;  1R9T K;  1K83 C;  3FKI K;  5IYD C;  2A6E A;  3GTQ C;  2E2I C;  3H3V L;  2PMZ L;  5M5W K;  4A3G K;  3S1M K;  4BBS K;  3HOZ K;  4GZY A;  3HOV C;  1I6H C;  4BXX K;  1TWA K;  2JA6 C;  3S16 C;  4A3K C;  1I3Q K;  3H0G K;  4AYB D;  2O5I A;  4A3I C;  5M5X K;  1I6V A;  3RZO K;  2JA8 C;  5M5Y K;  4MEY A;  3S1Q C;  4A3G C;  4MEX A;  3HOV K;  3HOZ C;  3S1R K;  2WAQ L;  2CW0 A;  2PA8 D;  1TWF C;  4KN4 A;  1HQM A;  2JA7 K;  2VUM K;  4YFN A;  5IYC K;  1SMY A;  3GTM K;  4XSZ A;  5FLM C;  2JA8 K;  4XLN A;  1XPP A;  2PA8 L;  4OIR A;  1TWA C;  4BBR C;  1I3Q C;  3H0G C;  1TWG K;  1TWG C;  2WB1 L;  4A3K K;  4ZH4 A;  1TWC C;  2NVQ C;  4A3M K;  2E2I K;  3S14 K;  3GTM C;  3HKZ D;  3S2D K;  1WCM K;  1WCM C;  2Y0S D;  1K83 K;  1TWF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...