1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
b'LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
4A3KC 4XSXA 4BBRC 3S1QC 4A3BK 5TMFA 5C3EC 1ZYRA 2NVQK 5C4XC 4QJVB 1R9TK 4BBSK 5TMCA 4A3CK 4YFKA 3GTLK 4KMUA 2JA7C 2E2HK 4A3CC 2JA8K 3M4OC 2PPBA 3S2DK 4BY7C 4NOIA 2PA8D 2E2HC 2JA8C 1I6HC 2E2JC 3I4MC 3S2DC 5IYDC 2B63K 1TWAK 4A3FK 1I3QK 3GTMC 5M5XK 4A3EK 1TWFK 3GTOK 4QJVA 3CQZC 3S14K 4XLNA 4YG2A 4KN7A 1TWFC 5IP7C 1TWGK 2E2IK 2PMZD 4KN4A 1TWHC 5M5WK 4ZH4A 4C2MC 3HOXC 3HOYC 4A3GK 1TWGC 5C44C 3HOWC 4A3GC 4C3HK 4QIWL 3H0GC 4Q5SA 1K83K 5FLMK 4A3MC 3GTKK 3K7AK 3HKZL 4BXXC 4XLPA 1K83C 4MEXA 5FJ8K 4Y7NK 3GTKC 5IYBK 1Y1VK 2A6HA 4C3IC 4X6AK 5D4DA 2R7ZK 4A3BC 4G7HA 3S15K 4X6AC 2NVQC 2O5JA 4LLGA 2R7ZC 3S17K 4YFNA 1R9TC 4OINA 4BBSC 2NVYK 2WB1L 3RZDK 3GTLC 3RZDC 4A3DK 4AYBL 3M3YK 1TWCK 2A6EA 2CW0A 4A3DC 3GTQK 3S1NK 5M5YK 3M3YC 3I4NK 4MEYA 4MQ9A 2Y0SD 2B63C 3S1NC 1TWAC 4A3FC 1I3QC 4JK1A 4A3EC 3I4NC 2A68A 3GTOC 3S14C 4QIWD 2E2IC 4LK1A 1YNJA 4C3JK 4AYBD 2BE5A 2NVTK 4G7OA 1I50K 4OIOA 4C3HC 5IP9K 4LJZA 2NVTC 5IYCK 3S1RK 3PO2K 5FLMC 3S1MK 5IYCC 3K7AC 5C4JK 3GTGK 1I6VA 3FKIK 2VUMK 2R93K 4Y7NC 5IYBC 3GTPK 3GTGC 1Y1VC 3DXJA 4OIQA 2O5IA 1WCMK 4A3JK 3HOUK 3GTPC 3S15C 3HOUC 2YU9K 3S17C 3PO3K 2NVYC 2YU9C 4G7ZA 3HOZK 1HQMA 3HOVK 1TWCC 3GTQC 4Q4ZA 1SMYA 3M4OK 4A3KK 3EQLA 1Y1WK 4BBRK 3H3VL 4A3IK 4A93K 4OIPA 5C3EK 1Y1WC 2WAQL 4A3IC 3HKZD 4C3JC 4A93C 5C4XK 1YNNA 3RZOK 1BDFA 4XSZA 1I50C 1XPPA 4Y52K 5IP9C 3RZOC 2JA7K 4A3LK 3PO2C 4YFXA 3S1RC 1SFOK 4BY7K 1IW7A 4Y52C 5M3FK 4A3LC 1I6HK 3S1MC 2E2JK 2NVXK 5C4JC 1SFOC 3I4MK 3FKIC 2VUMC 5IYDK 2WB1D 2R93C 3GTMK 2NVXC 3S2HK 4BY1K 4GZYA 1WCMC 4A3JC 2PA8L 3WODA 2JA6K 3CQZK 2A69A 4BY1C 3S2HC 4LK0A 5IP7K 4OIRA 2JA6C 3S16K 1TWHK 3GTJK 3HOXK 4C2MK 3HOYK 3PO3C 5C44K 2Y0SL 3S16C 3HOWK 3GTJC 5M3MK 3H0GK 2R92K 2PMZL 3HOZC 4A3MK 2JA5K 3H3VD 3HOVC 2R92C 4BXXK 2WAQD 2JA5C 3S1QK 4C3IK
chains in the Genus database with same CATH superfamily
4A3KC 2W7VA 2CFAA 1EFWA 5C3EC 3PIOS 2V6TA 4A3CK 3GTLK 4NOIA 3MMLB 1I6HC 2RH6A 2B63K 1I3QK 1WSVA 3T01A 1TWFK 1VRQC 1X31C 1XZQB 2E2IK 2KPUA 4A3GK 1TWHC 1TWGA 3HOWC 5HL8A 3OPFA 4C3HK 4KAWX 4WF9S 4A3MC 4BXXC 1INNA 2KQ1A 2GSNA 5IYBK 3LAJA 2A6HA 1IBAA 5D4DA 4X6AC 2NVQC 1GE9A 4LLGA 2R7ZC 4YFNA 2NVYK 3GIRA 4A3DK 1TWCK 3S1NK 5M5YK 1TWAC 3GTOA 5JFEA 1O25A 4WFNS 3DLLS 4C3JK 1YNJA 2RGRA 1I50K 3A8KA 4P5BA 5IORA 1I6VA 2VUMK 1EI6A 1WORA 3GTPK 4GTLA 4KM8A 2YU9K 3N0BA 1JQWA 1USMA 2V6UA 3L4KA 3HOZK 3GTQC 4KATA 4Q4ZA 1SMYA 1O2AA 4IOCS 4RMFA 4A3IK 1Y1WC 2WAQL 4G0WA 5C4XK 3HKZD 3RZOK 1BJTA 1BDFA 4XSZA 3PO2C 4A3LC 1DCPA 2NVXK 3I4MK 1SFOC 1DD5A 4WCES 1J98A 5DM7S 4A3JC 3S0XA 3S2HC 4LK0A 5IP7K 4OIRA 2JA6C 3BP8C 3PO3C 3GTJA 1ISEA 2JH3A 5M3MK 4KMDA 2PMZL 4G0VA 3H3VD 3HOVC 2R92C 2JA5A 3G4CA 3M4OC 4C3IK 4BBRC 3S1QC 4WJ3M 4QJVB 1J6WA 4BBSK 4PAAA 3GEHA 2E2HK 2JA8K 4A3CC 4BY7C 4P9SA 2E2JC 5IYDC 3GTMC 3A8JA 3GTOK 4QJVA 4J3NA 1TWFC 1TWHA 4KN4A 3CF5S 4ZH4A 3HOXC 4GFQA 4A3GC 1EK8A 3FOFA 4QIWL 1YCLA 1BGWA 1K83K 5FLMK 3GTKK 2ZUEA 3HKZL 2KXYA 1J6VA 4GTCA 4Y7NK 1WQGA 4A3BC 4KM9A 5CJ9A 3S15K 1EQRA 2R7ZA 2O5JA 4PABA 1R9TC 3GEEA 3AD7C 3A8IA 3M3YK 4A3DC 3I4NK 4MEYA 4MQ9A 1TWAA 3S1NC 4A3FC 4JK1A 4A3EC 3S14C 1C0AA 4AYBD 4G7OA 4XCHA 2GSUA 3K7AC 3GTGK 1XZQA 3VA7A 1Y1VC 4OIQA 1XXBA 3HOUK 3GTPC 3JSTA 3S17C 4WJ4A 2YU9C 1HQMA 3N0CA 3V4GA 3GTQA 2XCRB 2ZJQS 2GAGC 4A3KK 3EQLA 1Y1WA 5C3EK 1WOSA 1IS1A 4A3IC 1JVIA 1F93A 4C45A 5IP9C 3RZOC 3S1RC 1WQFA 1IW7A 4KMHA 5JVGS 1I6HK 2ZJPS 3S1MC 1SFOA 1AB4A 5C4JC 1XXCA 3FKIC 2R93C 2KWAA 2NVXC 1WCMC 2ZFZA 4GT9A 1B4BA 2JA6A 3S16K 1TWHK 1WIHA 1WOPA 5CHPA 3HOWK 4WILA 1YX2A 4KASA 4A3MK 2R92A 4BXXK 4AYBL 5HQHA 4LR2A 5TMFA 1ZYRA 2NVQK 1KQ4A 5TMCA 5EGHA 5EGEA 1PJ6A 2JA7C 1HI9A 3GDZA 3S2DK 2ZJRS 2PA8D 2E2HC 2JA8C 1ZBSA 3GTMA 1TWAK 1J6XA 5M5XK 3T02A 3CQZC 1TWFA 4YG2A 4KN7A 1TWGK 3IPJA 3HXAA 3HOYC 4C2MC 5C44C 5DM6S 4GTFA 3TFHA 2V6SA 1ZXOA 3H0GC 4Q5SA 3FHZA 5IOSA 4XLPA 3SZYA 1K83C 4MEXA 5FJ8K 3GTKC 1WQHA 5IOTA 1R9TA 3PIPS 3RZDK 2D6FC 3GTLC 3FOEA 1VJEA 3GTQK 4O2DA 4GTBA 3M3YC 2B63C 5IOQA 1I3QC 1WSRA 3I4NC 5HL7S 2E2IC 4LK1A 1V5VA 1IL2A 3AQPA 2NVTK 4C3HC 3PO2K 5IYCK 3ADAC 4BLBA 1WOOA 2XCQA 1Y1VA 5IYBC 3GTGC 4A3JK 3GTPA 3HOUC 3PO3K 2NVYC 3BP3A 2YU9A 1L0WA 2L5NA 4G7ZA 1O2BA 4GTEA 3HOVK 1TWCC 3M4OK 4BBRK 3H3VL 4A93K 3ERED 4OIPA 1G51A 1F9NA 1O28A 4C3JC 4IO9S 1I50C 2XCOA 4Y52K 1ZVUA 4BY7K 2GSOA 2E2JK 3FKIA 2R93A 5IYDK 2VUMC 2WB1D 2NVXA 3GTMK 1WCMA 1UV7A 4BY1K 4GZYA 3GEIA 2A69A 2L3UA 1VH2A 3GTJK 3HOXK 4U67S 4LQYA 3S16C 1O26A 1ZQ1C 2FQTA 1RU0A 3HOZC 4WFAS 4KB2A 2JA5K 2WAQD 2ZUFA 4XSXA 4A3BK 5C4XC 3BUEA 1R9TK 1VGXA 3OREA 4YFKA 2JA7A 3TFIA 4KMUA 3N3YA 3Q3QA 2PPBA 3LAPA 1PJ7A 2E2HA 4KARA 4IOAS 5JVOA 3I4MC 4KDDA 3S2DC 2GAHC 4WFBS 4A3FK 4A3EK 3CQZA 3S14K 4FM9A 2P5MA 4XLNA 3L4JA 5IP7C 2PMZD 2P8TA 5M5WK 1TWGC 3S1QK 4KC6A 3LPXA 1XZPB 3H0GA 4FZBA 1XXAA 3K7AK 1K83A 3GTKA 1Y1VK 4C3IC 3AD9C 4BLAA 4X6AK 2R7ZK 4G7HA 4KB4A 1IQ0A 1PJ5A 1XZPA 3S17K 1BS2A 4OINA 4BBSC 2WB1L 3GTLA 1O24A 3RZDC 2EBBA 3QX3A 2A6EA 2CW0A 2B63A 5JVHS 2Y0SD 1I3QA 2A68A 1O29A 3GTOC 4QIWD 2E2IA 2BE5A 2FQOA 3LYWA 4P5AA 4DDQA 4OIOA 5IP9K 4LJZA 2NVTC 4ILDA 3S1RK 4GTAA 5FLMC 3S1MK 5IYCC 5C4JK 3FKIK 2R93K 4Y7NC 3GTGA 1VLOA 1DCOA 3DXJA 2O5IA 1WCMK 3S15C 2NVYA 3G4AA 3SZZA 5TJ3A 1B4AA 5L46A 1TWCA 4GTDA 1F7VA 1O2FB 4M1XA 3AQOA 4G0UA 1DCHA 1Y1WK 4A93C 3OEPA 1IE0A 1YNNA 1I50A 1FEUA 1EH1A 1XPPA 3NUHA 3T00A 1O27A 2JA7K 4A3LK 4YFXA 3TFJA 1SFOK 4Y52C 1JOEA 5M3FK 3GSIA 2VUMA 4BKWA 4KMAA 3S2HK 2JA6K 2PA8L 3WODA 1USOA 3CQZK 4BY1C 2CFAB 3HOYK 4C2MK 3CAGA 5C44K 2Y0SL 3GTJC 3AH5A 1F7UA 2PHCB 5E68A 3H0GK 2R92K 2Y3PA 4AH6A 4LOWA 2JA5C 3AD8C 3TTGA
chains in the Genus database with same CATH topology
4A3KC 4XSXA 4BBRC 3S1QC 4A3BK 5TMFA 5C3EC 1ZYRA 2NVQK 5C4XC 4QJVB 1R9TK 4BBSK 5TMCA 4A3CK 4YFKA 3GTLK 4KMUA 2JA7C 2E2HK 4A3CC 2JA8K 3M4OC 2PPBA 3S2DK 4BY7C 4NOIA 2PA8D 2E2HC 2JA8C 1I6HC 2E2JC 3I4MC 3S2DC 5IYDC 2B63K 1TWAK 4A3FK 1I3QK 3GTMC 5M5XK 4A3EK 1TWFK 3GTOK 4QJVA 3CQZC 3S14K 4XLNA 4YG2A 4KN7A 1TWFC 5IP7C 1TWGK 2E2IK 2PMZD 4KN4A 1TWHC 5M5WK 4ZH4A 4C2MC 3HOXC 3HOYC 4A3GK 1TWGC 5C44C 3HOWC 4A3GC 4C3HK 4QIWL 3H0GC 4Q5SA 1K83K 5FLMK 4A3MC 3GTKK 3K7AK 3HKZL 4BXXC 4XLPA 1K83C 4MEXA 5FJ8K 4Y7NK 3GTKC 5IYBK 1Y1VK 2A6HA 4C3IC 4X6AK 5D4DA 2R7ZK 4A3BC 4G7HA 3S15K 4X6AC 2NVQC 2O5JA 4LLGA 2R7ZC 3S17K 4YFNA 1R9TC 4OINA 4BBSC 2NVYK 2WB1L 3RZDK 3GTLC 3RZDC 4A3DK 4AYBL 3M3YK 1TWCK 2A6EA 2CW0A 4A3DC 3GTQK 3S1NK 5M5YK 3M3YC 3I4NK 4MEYA 4MQ9A 2Y0SD 2B63C 3S1NC 1TWAC 4A3FC 1I3QC 4JK1A 4A3EC 3I4NC 2A68A 3GTOC 3S14C 4QIWD 2E2IC 4LK1A 1YNJA 4C3JK 4AYBD 2BE5A 2NVTK 4G7OA 1I50K 4OIOA 4C3HC 5IP9K 4LJZA 2NVTC 5IYCK 3S1RK 3PO2K 5FLMC 3S1MK 5IYCC 3K7AC 5C4JK 3GTGK 1I6VA 3FKIK 2VUMK 2R93K 4Y7NC 5IYBC 3GTPK 3GTGC 1Y1VC 3DXJA 4OIQA 2O5IA 1WCMK 4A3JK 3HOUK 3GTPC 3S15C 3HOUC 2YU9K 3S17C 3PO3K 2NVYC 2YU9C 4G7ZA 3HOZK 1HQMA 3HOVK 1TWCC 3GTQC 4Q4ZA 1SMYA 3M4OK 4A3KK 3EQLA 1Y1WK 4BBRK 3H3VL 4A3IK 4A93K 4OIPA 5C3EK 1Y1WC 2WAQL 4A3IC 3HKZD 4C3JC 4A93C 5C4XK 1YNNA 3RZOK 1BDFA 4XSZA 1I50C 1XPPA 4Y52K 5IP9C 3RZOC 2JA7K 4A3LK 3PO2C 4YFXA 3S1RC 1SFOK 4BY7K 1IW7A 4Y52C 5M3FK 4A3LC 1I6HK 3S1MC 2E2JK 2NVXK 5C4JC 1SFOC 3I4MK 3FKIC 2VUMC 5IYDK 2WB1D 2R93C 3GTMK 2NVXC 3S2HK 4BY1K 4GZYA 1WCMC 4A3JC 2PA8L 3WODA 2JA6K 3CQZK 2A69A 4BY1C 3S2HC 4LK0A 5IP7K 4OIRA 2JA6C 3S16K 1TWHK 3GTJK 3HOXK 4C2MK 3HOYK 3PO3C 5C44K 2Y0SL 3S16C 3HOWK 3GTJC 5M3MK 3H0GK 2R92K 2PMZL 3HOZC 4A3MK 2JA5K 3H3VD 3HOVC 2R92C 4BXXK 2WAQD 2JA5C 3S1QK 4C3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K C;  4XSX A;  4BBR C;  3S1Q C;  4A3B K;  5TMF A;  5C3E C;  1ZYR A;  2NVQ K;  5C4X C;  4QJV B;  1R9T K;  4BBS K;  5TMC A;  4A3C K;  4YFK A;  3GTL K;  4KMU A;  2JA7 C;  2E2H K;  4A3C C;  2JA8 K;  3M4O C;  2PPB A;  3S2D K;  4BY7 C;  4NOI A;  2PA8 D;  2E2H C;  2JA8 C;  1I6H C;  2E2J C;  3I4M C;  3S2D C;  5IYD C;  2B63 K;  1TWA K;  4A3F K;  1I3Q K;  3GTM C;  5M5X K;  4A3E K;  1TWF K;  3GTO K;  4QJV A;  3CQZ C;  3S14 K;  4XLN A;  4YG2 A;  4KN7 A;  1TWF C;  5IP7 C;  1TWG K;  2E2I K;  2PMZ D;  4KN4 A;  1TWH C;  5M5W K;  4ZH4 A;  4C2M C;  3HOX C;  3HOY C;  4A3G K;  1TWG C;  5C44 C;  3HOW C;  4A3G C;  4C3H K;  4QIW L;  3H0G C;  4Q5S A;  1K83 K;  5FLM K;  4A3M C;  3GTK K;  3K7A K;  3HKZ L;  4BXX C;  4XLP A;  1K83 C;  4MEX A;  5FJ8 K;  4Y7N K;  3GTK C;  5IYB K;  1Y1V K;  2A6H A;  4C3I C;  4X6A K;  5D4D A;  2R7Z K;  4A3B C;  4G7H A;  3S15 K;  4X6A C;  2NVQ C;  2O5J A;  4LLG A;  2R7Z C;  3S17 K;  4YFN A;  1R9T C;  4OIN A;  4BBS C;  2NVY K;  2WB1 L;  3RZD K;  3GTL C;  3RZD C;  4A3D K;  4AYB L;  3M3Y K;  1TWC K;  2A6E A;  2CW0 A;  4A3D C;  3GTQ K;  3S1N K;  5M5Y K;  3M3Y C;  3I4N K;  4MEY A;  4MQ9 A;  2Y0S D;  2B63 C;  3S1N C;  1TWA C;  4A3F C;  1I3Q C;  4JK1 A;  4A3E C;  3I4N C;  2A68 A;  3GTO C;  3S14 C;  4QIW D;  2E2I C;  4LK1 A;  1YNJ A;  4C3J K;  4AYB D;  2BE5 A;  2NVT K;  4G7O A;  1I50 K;  4OIO A;  4C3H C;  5IP9 K;  4LJZ A;  2NVT C;  5IYC K;  3S1R K;  3PO2 K;  5FLM C;  3S1M K;  5IYC C;  3K7A C;  5C4J K;  3GTG K;  1I6V A;  3FKI K;  2VUM K;  2R93 K;  4Y7N C;  5IYB C;  3GTP K;  3GTG C;  1Y1V C;  3DXJ A;  4OIQ A;  2O5I A;  1WCM K;  4A3J K;  3HOU K;  3GTP C;  3S15 C;  3HOU C;  2YU9 K;  3S17 C;  3PO3 K;  2NVY C;  2YU9 C;  4G7Z A;  3HOZ K;  1HQM A;  3HOV K;  1TWC C;  3GTQ C;  4Q4Z A;  1SMY A;  3M4O K;  4A3K K;  3EQL A;  1Y1W K;  4BBR K;  3H3V L;  4A3I K;  4A93 K;  4OIP A;  5C3E K;  1Y1W C;  2WAQ L;  4A3I C;  3HKZ D;  4C3J C;  4A93 C;  5C4X K;  1YNN A;  3RZO K;  1BDF A;  4XSZ A;  1I50 C;  1XPP A;  4Y52 K;  5IP9 C;  3RZO C;  2JA7 K;  4A3L K;  3PO2 C;  4YFX A;  3S1R C;  1SFO K;  4BY7 K;  1IW7 A;  4Y52 C;  5M3F K;  4A3L C;  1I6H K;  3S1M C;  2E2J K;  2NVX K;  5C4J C;  1SFO C;  3I4M K;  3FKI C;  2VUM C;  5IYD K;  2WB1 D;  2R93 C;  3GTM K;  2NVX C;  3S2H K;  4BY1 K;  4GZY A;  1WCM C;  4A3J C;  2PA8 L;  3WOD A;  2JA6 K;  3CQZ K;  2A69 A;  4BY1 C;  3S2H C;  4LK0 A;  5IP7 K;  4OIR A;  2JA6 C;  3S16 K;  1TWH K;  3GTJ K;  3HOX K;  4C2M K;  3HOY K;  3PO3 C;  5C44 K;  2Y0S L;  3S16 C;  3HOW K;  3GTJ C;  5M3M K;  3H0G K;  2R92 K;  2PMZ L;  3HOZ C;  4A3M K;  2JA5 K;  3H3V D;  3HOV C;  2R92 C;  4BXX K;  2WAQ D;  2JA5 C;  3S1Q K;  4C3I K; 
#chains in the Genus database with same CATH topology
 4A3K C;  2W7V A;  2CFA A;  1EFW A;  5C3E C;  3PIO S;  2V6T A;  4A3C K;  3GTL K;  4NOI A;  3MML B;  1I6H C;  2RH6 A;  2B63 K;  1I3Q K;  1WSV A;  3T01 A;  1TWF K;  1VRQ C;  1X31 C;  1XZQ B;  2E2I K;  2KPU A;  4A3G K;  1TWH C;  1TWG A;  3HOW C;  5HL8 A;  3OPF A;  4C3H K;  4KAW X;  4WF9 S;  4A3M C;  4BXX C;  1INN A;  2KQ1 A;  2GSN A;  5IYB K;  3LAJ A;  2A6H A;  1IBA A;  5D4D A;  4X6A C;  2NVQ C;  1GE9 A;  4LLG A;  2R7Z C;  4YFN A;  2NVY K;  3GIR A;  4A3D K;  1TWC K;  3S1N K;  5M5Y K;  1TWA C;  3GTO A;  5JFE A;  1O25 A;  4WFN S;  3DLL S;  4C3J K;  1YNJ A;  2RGR A;  1I50 K;  3A8K A;  4P5B A;  5IOR A;  1I6V A;  2VUM K;  1EI6 A;  1WOR A;  3GTP K;  4GTL A;  4KM8 A;  2YU9 K;  3N0B A;  1JQW A;  1USM A;  2V6U A;  3L4K A;  3HOZ K;  3GTQ C;  4KAT A;  4Q4Z A;  1SMY A;  1O2A A;  4IOC S;  4RMF A;  4A3I K;  1Y1W C;  2WAQ L;  4G0W A;  5C4X K;  3HKZ D;  3RZO K;  1BJT A;  1BDF A;  4XSZ A;  3PO2 C;  4A3L C;  1DCP A;  2NVX K;  3I4M K;  1SFO C;  1DD5 A;  4WCE S;  1J98 A;  5DM7 S;  4A3J C;  3S0X A;  3S2H C;  4LK0 A;  5IP7 K;  4OIR A;  2JA6 C;  3BP8 C;  3PO3 C;  3GTJ A;  1ISE A;  2JH3 A;  5M3M K;  4KMD A;  2PMZ L;  4G0V A;  3H3V D;  3HOV C;  2R92 C;  2JA5 A;  3G4C A;  3M4O C;  4C3I K;  4BBR C;  3S1Q C;  4WJ3 M;  4QJV B;  1J6W A;  4BBS K;  4PAA A;  3GEH A;  2E2H K;  2JA8 K;  4A3C C;  4BY7 C;  4P9S A;  2E2J C;  5IYD C;  3GTM C;  3A8J A;  3GTO K;  4QJV A;  4J3N A;  1TWF C;  1TWH A;  4KN4 A;  3CF5 S;  4ZH4 A;  3HOX C;  4GFQ A;  4A3G C;  1EK8 A;  3FOF A;  4QIW L;  1YCL A;  1BGW A;  1K83 K;  5FLM K;  3GTK K;  2ZUE A;  3HKZ L;  2KXY A;  1J6V A;  4GTC A;  4Y7N K;  1WQG A;  4A3B C;  4KM9 A;  5CJ9 A;  3S15 K;  1EQR A;  2R7Z A;  2O5J A;  4PAB A;  1R9T C;  3GEE A;  3AD7 C;  3A8I A;  3M3Y K;  4A3D C;  3I4N K;  4MEY A;  4MQ9 A;  1TWA A;  3S1N C;  4A3F C;  4JK1 A;  4A3E C;  3S14 C;  1C0A A;  4AYB D;  4G7O A;  4XCH A;  2GSU A;  3K7A C;  3GTG K;  1XZQ A;  3VA7 A;  1Y1V C;  4OIQ A;  1XXB A;  3HOU K;  3GTP C;  3JST A;  3S17 C;  4WJ4 A;  2YU9 C;  1HQM A;  3N0C A;  3V4G A;  3GTQ A;  2XCR B;  2ZJQ S;  2GAG C;  4A3K K;  3EQL A;  1Y1W A;  5C3E K;  1WOS A;  1IS1 A;  4A3I C;  1JVI A;  1F93 A;  4C45 A;  5IP9 C;  3RZO C;  3S1R C;  1WQF A;  1IW7 A;  4KMH A;  5JVG S;  1I6H K;  2ZJP S;  3S1M C;  1SFO A;  1AB4 A;  5C4J C;  1XXC A;  3FKI C;  2R93 C;  2KWA A;  2NVX C;  1WCM C;  2ZFZ A;  4GT9 A;  1B4B A;  2JA6 A;  3S16 K;  1TWH K;  1WIH A;  1WOP A;  5CHP A;  3HOW K;  4WIL A;  1YX2 A;  4KAS A;  4A3M K;  2R92 A;  4BXX K;  4AYB L;  5HQH A;  4LR2 A;  5TMF A;  1ZYR A;  2NVQ K;  1KQ4 A;  5TMC A;  5EGH A;  5EGE A;  1PJ6 A;  2JA7 C;  1HI9 A;  3GDZ A;  3S2D K;  2ZJR S;  2PA8 D;  2E2H C;  2JA8 C;  1ZBS A;  3GTM A;  1TWA K;  1J6X A;  5M5X K;  3T02 A;  3CQZ C;  1TWF A;  4YG2 A;  4KN7 A;  1TWG K;  3IPJ A;  3HXA A;  3HOY C;  4C2M C;  5C44 C;  5DM6 S;  4GTF A;  3TFH A;  2V6S A;  1ZXO A;  3H0G C;  4Q5S A;  3FHZ A;  5IOS A;  4XLP A;  3SZY A;  1K83 C;  4MEX A;  5FJ8 K;  3GTK C;  1WQH A;  5IOT A;  1R9T A;  3PIP S;  3RZD K;  2D6F C;  3GTL C;  3FOE A;  1VJE A;  3GTQ K;  4O2D A;  4GTB A;  3M3Y C;  2B63 C;  5IOQ A;  1I3Q C;  1WSR A;  3I4N C;  5HL7 S;  2E2I C;  4LK1 A;  1V5V A;  1IL2 A;  3AQP A;  2NVT K;  4C3H C;  3PO2 K;  5IYC K;  3ADA C;  4BLB A;  1WOO A;  2XCQ A;  1Y1V A;  5IYB C;  3GTG C;  4A3J K;  3GTP A;  3HOU C;  3PO3 K;  2NVY C;  3BP3 A;  2YU9 A;  1L0W A;  2L5N A;  4G7Z A;  1O2B A;  4GTE A;  3HOV K;  1TWC C;  3M4O K;  4BBR K;  3H3V L;  4A93 K;  3ERE D;  4OIP A;  1G51 A;  1F9N A;  1O28 A;  4C3J C;  4IO9 S;  1I50 C;  2XCO A;  4Y52 K;  1ZVU A;  4BY7 K;  2GSO A;  2E2J K;  3FKI A;  2R93 A;  5IYD K;  2VUM C;  2WB1 D;  2NVX A;  3GTM K;  1WCM A;  1UV7 A;  4BY1 K;  4GZY A;  3GEI A;  2A69 A;  2L3U A;  1VH2 A;  3GTJ K;  3HOX K;  4U67 S;  4LQY A;  3S16 C;  1O26 A;  1ZQ1 C;  2FQT A;  1RU0 A;  3HOZ C;  4WFA S;  4KB2 A;  2JA5 K;  2WAQ D;  2ZUF A;  4XSX A;  4A3B K;  5C4X C;  3BUE A;  1R9T K;  1VGX A;  3ORE A;  4YFK A;  2JA7 A;  3TFI A;  4KMU A;  3N3Y A;  3Q3Q A;  2PPB A;  3LAP A;  1PJ7 A;  2E2H A;  4KAR A;  4IOA S;  5JVO A;  3I4M C;  4KDD A;  3S2D C;  2GAH C;  4WFB S;  4A3F K;  4A3E K;  3CQZ A;  3S14 K;  4FM9 A;  2P5M A;  4XLN A;  3L4J A;  5IP7 C;  2PMZ D;  2P8T A;  5M5W K;  1TWG C;  3S1Q K;  4KC6 A;  3LPX A;  1XZP B;  3H0G A;  4FZB A;  1XXA A;  3K7A K;  1K83 A;  3GTK A;  1Y1V K;  4C3I C;  3AD9 C;  4BLA A;  4X6A K;  2R7Z K;  4G7H A;  4KB4 A;  1IQ0 A;  1PJ5 A;  1XZP A;  3S17 K;  1BS2 A;  4OIN A;  4BBS C;  2WB1 L;  3GTL A;  1O24 A;  3RZD C;  2EBB A;  3QX3 A;  2A6E A;  2CW0 A;  2B63 A;  5JVH S;  2Y0S D;  1I3Q A;  2A68 A;  1O29 A;  3GTO C;  4QIW D;  2E2I A;  2BE5 A;  2FQO A;  3LYW A;  4P5A A;  4DDQ A;  4OIO A;  5IP9 K;  4LJZ A;  2NVT C;  4ILD A;  3S1R K;  4GTA A;  5FLM C;  3S1M K;  5IYC C;  5C4J K;  3FKI K;  2R93 K;  4Y7N C;  3GTG A;  1VLO A;  1DCO A;  3DXJ A;  2O5I A;  1WCM K;  3S15 C;  2NVY A;  3G4A A;  3SZZ A;  5TJ3 A;  1B4A A;  5L46 A;  1TWC A;  4GTD A;  1F7V A;  1O2F B;  4M1X A;  3AQO A;  4G0U A;  1DCH A;  1Y1W K;  4A93 C;  3OEP A;  1IE0 A;  1YNN A;  1I50 A;  1FEU A;  1EH1 A;  1XPP A;  3NUH A;  3T00 A;  1O27 A;  2JA7 K;  4A3L K;  4YFX A;  3TFJ A;  1SFO K;  4Y52 C;  1JOE A;  5M3F K;  3GSI A;  2VUM A;  4BKW A;  4KMA A;  3S2H K;  2JA6 K;  2PA8 L;  3WOD A;  1USO A;  3CQZ K;  4BY1 C;  2CFA B;  3HOY K;  4C2M K;  3CAG A;  5C44 K;  2Y0S L;  3GTJ C;  3AH5 A;  1F7U A;  2PHC B;  5E68 A;  3H0G K;  2R92 K;  2Y3P A;  4AH6 A;  4LOW A;  2JA5 C;  3AD8 C;  3TTG A; 
#chains in the Genus database with same CATH homology
 4A3K C;  4XSX A;  4BBR C;  3S1Q C;  4A3B K;  5TMF A;  5C3E C;  1ZYR A;  2NVQ K;  5C4X C;  4QJV B;  1R9T K;  4BBS K;  5TMC A;  4A3C K;  4YFK A;  3GTL K;  4KMU A;  2JA7 C;  2E2H K;  4A3C C;  2JA8 K;  3M4O C;  2PPB A;  3S2D K;  4BY7 C;  4NOI A;  2PA8 D;  2E2H C;  2JA8 C;  1I6H C;  2E2J C;  3I4M C;  3S2D C;  5IYD C;  2B63 K;  1TWA K;  4A3F K;  1I3Q K;  3GTM C;  5M5X K;  4A3E K;  1TWF K;  3GTO K;  4QJV A;  3CQZ C;  3S14 K;  4XLN A;  4YG2 A;  4KN7 A;  1TWF C;  5IP7 C;  1TWG K;  2E2I K;  2PMZ D;  4KN4 A;  1TWH C;  5M5W K;  4ZH4 A;  4C2M C;  3HOX C;  3HOY C;  4A3G K;  1TWG C;  5C44 C;  3HOW C;  4A3G C;  4C3H K;  4QIW L;  3H0G C;  4Q5S A;  1K83 K;  5FLM K;  4A3M C;  3GTK K;  3K7A K;  3HKZ L;  4BXX C;  4XLP A;  1K83 C;  4MEX A;  5FJ8 K;  4Y7N K;  3GTK C;  5IYB K;  1Y1V K;  2A6H A;  4C3I C;  4X6A K;  5D4D A;  2R7Z K;  4A3B C;  4G7H A;  3S15 K;  4X6A C;  2NVQ C;  2O5J A;  4LLG A;  2R7Z C;  3S17 K;  4YFN A;  1R9T C;  4OIN A;  4BBS C;  2NVY K;  2WB1 L;  3RZD K;  3GTL C;  3RZD C;  4A3D K;  4AYB L;  3M3Y K;  1TWC K;  2A6E A;  2CW0 A;  4A3D C;  3GTQ K;  3S1N K;  5M5Y K;  3M3Y C;  3I4N K;  4MEY A;  4MQ9 A;  2Y0S D;  2B63 C;  3S1N C;  1TWA C;  4A3F C;  1I3Q C;  4JK1 A;  4A3E C;  3I4N C;  2A68 A;  3GTO C;  3S14 C;  4QIW D;  2E2I C;  4LK1 A;  1YNJ A;  4C3J K;  4AYB D;  2BE5 A;  2NVT K;  4G7O A;  1I50 K;  4OIO A;  4C3H C;  5IP9 K;  4LJZ A;  2NVT C;  5IYC K;  3S1R K;  3PO2 K;  5FLM C;  3S1M K;  5IYC C;  3K7A C;  5C4J K;  3GTG K;  1I6V A;  3FKI K;  2VUM K;  2R93 K;  4Y7N C;  5IYB C;  3GTP K;  3GTG C;  1Y1V C;  3DXJ A;  4OIQ A;  2O5I A;  1WCM K;  4A3J K;  3HOU K;  3GTP C;  3S15 C;  3HOU C;  2YU9 K;  3S17 C;  3PO3 K;  2NVY C;  2YU9 C;  4G7Z A;  3HOZ K;  1HQM A;  3HOV K;  1TWC C;  3GTQ C;  4Q4Z A;  1SMY A;  3M4O K;  4A3K K;  3EQL A;  1Y1W K;  4BBR K;  3H3V L;  4A3I K;  4A93 K;  4OIP A;  5C3E K;  1Y1W C;  2WAQ L;  4A3I C;  3HKZ D;  4C3J C;  4A93 C;  5C4X K;  1YNN A;  3RZO K;  1BDF A;  4XSZ A;  1I50 C;  1XPP A;  4Y52 K;  5IP9 C;  3RZO C;  2JA7 K;  4A3L K;  3PO2 C;  4YFX A;  3S1R C;  1SFO K;  4BY7 K;  1IW7 A;  4Y52 C;  5M3F K;  4A3L C;  1I6H K;  3S1M C;  2E2J K;  2NVX K;  5C4J C;  1SFO C;  3I4M K;  3FKI C;  2VUM C;  5IYD K;  2WB1 D;  2R93 C;  3GTM K;  2NVX C;  3S2H K;  4BY1 K;  4GZY A;  1WCM C;  4A3J C;  2PA8 L;  3WOD A;  2JA6 K;  3CQZ K;  2A69 A;  4BY1 C;  3S2H C;  4LK0 A;  5IP7 K;  4OIR A;  2JA6 C;  3S16 K;  1TWH K;  3GTJ K;  3HOX K;  4C2M K;  3HOY K;  3PO3 C;  5C44 K;  2Y0S L;  3S16 C;  3HOW K;  3GTJ C;  5M3M K;  3H0G K;  2R92 K;  2PMZ L;  3HOZ C;  4A3M K;  2JA5 K;  3H3V D;  3HOV C;  2R92 C;  4BXX K;  2WAQ D;  2JA5 C;  3S1Q K;  4C3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...