1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
3GTQC 4KMUA 3HKZL 4BY1K 1Y1WC 4QJVB 1TWCC 5D4DA 5IP7C 4OIPA 4Q4ZA 3HOUC 4A3LC 4QIWL 1R9TC 4A3KK 5C3EC 3S1RC 4LK0A 3HOYC 5IYCC 2R93C 3GTOK 2E2HC 3GTKK 2O5JA 3S16C 3PO3K 4C3HC 4A3MC 3HOVK 3H3VD 1K83C 4YFNA 4Y7NC 5M5XK 2YU9K 4A3LK 1I50K 4JK1A 5IYDK 3FKIK 2B63K 3PO2K 3H0GC 2R92C 3GTMC 3RZOC 2PA8D 4G7OA 2WB1L 2R7ZC 3I4NC 5FLMC 1I6VA 4QJVA 2VUMK 3RZDC 1SFOK 3S1NK 3S1QK 1Y1WK 3K7AK 4BBRC 5IP9K 3HOWC 3I4MK 4A3JC 5TMCA 3GTPC 4BXXC 5C4XK 3S1MK 5M5YK 3WODA 4ZH4A 2E2IC 3S14C 2PMZL 1R9TK 4C2MK 3I4MC 3HOWK 4A3BK 1TWGC 4YFKA 4XLNA 4C3IK 3S1NC 5M3MK 5IYBC 4BY1C 4BBRK 3M4OK 4AYBL 4BY7C 2A68A 3S2DC 4Y7NK 1XPPA 1TWAK 2VUMC 4GZYA 2E2HK 3S2HC 3HOXK 4C3JC 5M5WK 2YU9C 4XSZA 4YG2A 4C3IC 1I3QK 3S17K 3FKIC 3S1QC 4G7ZA 1TWAC 4NOIA 1Y1VK 3GTGC 4A3BC 4A3JK 4C3JK 4QIWD 2NVTK 3GTQK 4A3IC 4A3FK 4OINA 3S2DK 4LK1A 2WAQL 3RZDK 4A93K 4Y52K 1I50C 5IYDC 2PPBA 5TMFA 2E2JC 2JA5C 4A3MK 3H0GK 4BBSC 1BDFA 1YNNA 4C2MC 2O5IA 5FLMK 1IW7A 2JA7C 2CW0A 4OIOA 3PO2C 1SFOC 2Y0SD 3M3YC 2JA6K 4A3GK 4BY7K 3S15K 3GTGK 3GTOC 3S1RK 2NVYC 2NVXC 5FJ8K 4LJZA 4OIQA 5C4XC 2JA8C 2JA6C 4YFXA 4A3GC 5C44K 3M3YK 2E2IK 4A3DC 1TWFK 5C3EK 5IP9C 5C4JC 3GTLC 1HQMA 1I3QC 3HOYK 2R93K 4X6AK 2B63C 4C3HK 4KN7A 5M3FK 2JA8K 3DXJA 2E2JK 4XLPA 2JA5K 4OIRA 3GTJK 4A3EK 4Q5SA 1WCMC 5IYCK 2WB1D 4MEYA 2NVQC 3I4NK 2R7ZK 4A3FC 3K7AC 3EQLA 5C4JK 4A3IK 5IP7K 3GTLK 1K83K 2A69A 4MEXA 3H3VL 3GTKC 3HOXC 4AYBD 3S14K 4LLGA 3S2HK 1TWHC 2BE5A 1I6HC 4Y52C 4A93C 1TWFC 3GTPK 4A3CK 4BXXK 2A6EA 4XSXA 3S17C 1ZYRA 1WCMK 4A3DK 2JA7K 5IYBK 2PMZD 3HKZD 4A3KC 2NVTC 1TWCK 3M4OC 3HOVC 1TWHK 3HOUK 1I6HK 3S15C 1Y1VC 1YNJA 3PO3C 2NVYK 4X6AC 2NVXK 4KN4A 4A3EC 2Y0SL 3HOZK 2R92K 3GTMK 3RZOK 2NVQK 3CQZC 4A3CC 4BBSK 4MQ9A 2A6HA 1TWGK 3HOZC 2PA8L 5C44C 4G7HA 3CQZK 3S16K 3GTJC 1SMYA 2WAQD 3S1MC
chains in the Genus database with same CATH superfamily
3AD8C 5D4DA 3HOUC 5C3EC 3S1RC 4GTBA 3PO3K 2E2HC 3S16C 4A3MC 1O24A 1K83C 1I50K 3GEHA 1DCOA 3SZYA 3FKIK 4WF9S 1ISEA 2R92C 3GTMC 3I4NC 2EBBA 4WJ3M 3RZDC 1SFOK 3TFIA 4WJ4A 3AH5A 4BBRC 3HOWC 2V6SA 3GSIA 4BXXC 5C4XK 4PABA 3L4KA 1IE0A 1PJ7A 4IO9S 4KDDA 4KMDA 1VH2A 5IYBC 4BY1C 4BBRK 4BY7C 2A68A 3S2DC 1TWAK 2E2HK 5M5WK 2YU9C 4IOAS 1I3QK 3FKIC 1TWFA 2FQOA 3BP3A 3GTPA 3T01A 3S1QC 2ZUEA 3GTJA 2NVYA 1ZVUA 3GTQK 1F7VA 4AH6A 4G0UA 3GEEA 3S2DK 2PPBA 5HL7S 2JA5C 3CF5S 3H0GK 4P9SA 1F93A 2CFAA 2GSOA 2KXYA 3PO2C 1HI9A 1WQHA 1XZPA 3LYWA 2ZJPS 3S1RK 2P8TA 5FJ8K 2JA6C 4A3GC 3M3YK 1VRQC 5C44K 5C3EK 3GTLC 4C3HK 4KN7A 4KAWX 1WIHA 1BS2A 1XZQA 4Q5SA 1VLOA 3T00A 4A3FC 4A3IK 1AB4A 3GTLK 1K83K 5JVHS 5TJ3A 4MEXA 3GTKC 1WOOA 1TWHC 1I6HC 4Y52C 1ZYRA 1XZQB 3VA7A 3HKZD 4GTCA 2NVYK 4XCHA 4A3CC 4O2DA 4PAAA 1TWGK 1JVIA 3HOZC 4FZBA 1O2AA 2PA8L 3LAPA 5EGEA 1TWAA 1SMYA 5DM6S 3S1MC 1R9TK 3GTQC 3AD9C 3HKZL 1Y1WC 1TWCC 4A3KK 4OIPA 3HOYC 3FOFA 3CAGA 3GTKK 4LOWA 1F7UA 3H3VD 4A3LK 4JK1A 3Q3QA 5IOSA 4WFBS 3PO2K 5JVOA 1SFOA 4GTEA 3S1NK 2XCRB 1Y1WK 3K7AK 3FKIA 1XZPB 4WFNS 5DM7S 4A3JC 3S1MK 3GTPC 1R9TA 5M5YK 2CFAB 3WODA 3FOEA 1RU0A 2PMZL 4C2MK 3HOWK 4XLNA 3PIPS 3S1NC 4WILA 4J3NA 4AYBL 3HXAA 4BLAA 4Y7NK 1C0AA 4GZYA 1WSVA 2JA5A 3BUEA 4XSZA 1PJ5A 2NVXA 2XCOA 3N3YA 4A3BC 4QIWD 2GSNA 3GIRA 3GTLA 4OINA 2R93A 2WAQL 4Y52K 1I50C 1JOEA 1EK8A 4A3MK 4U67S 1BDFA 1YNNA 3OEPA 2P5MA 5HQHA 4OIOA 2R7ZA 3M3YC 2JA6K 4M1XA 4A3GK 3GTOC 4LJZA 4OIQA 5C4XC 5IOQA 2E2IK 2R93K 5C4JC 4KB2A 1HQMA 2V6UA 2B63C 3H0GA 3S0XA 1WORA 1WCMC 2NVQC 3EQLA 5IP7K 5IORA 3QX3A 2A69A 2FQTA 3H3VL 1J6WA 4WFAS 5JVGS 1VGXA 3GTPK 1TWFC 5CHPA 1I3QA 3HOVC 2KPUA 1USOA 3OPFA 3S15C 2E2HA 1IBAA 4X6AC 4KN4A 3RZOK 2NVQK 3T02A 2A6HA 2YU9A 1O28A 3TTGA 5C44C 4G7HA 1BGWA 4GTFA 3GTGA 4KMUA 4BY1K 4G0WA 1V5VA 4QJVB 3GTGK 5IP7C 4Q4ZA 4QIWL 4A3LC 1R9TC 5IYCC 1G51A 4C3HC 3BP8C 3HOVK 4YFNA 2YU9K 4KM9A 2XCQA 3RZOC 2WB1L 2PA8D 4QJVA 1VJEA 1IL2A 2VUMK 1F9NA 1ZBSA 3S1QK 3LPXA 3I4MK 5TMCA 4P5AA 1WOSA 4ZH4A 2ZJQS 2E2IC 2L3UA 2ZFZA 4GFQA 4LR2A 1TWGC 5JFEA 4YFKA 4C3IK 1IQ0A 5M3MK 3V4GA 3GTMA 2R92A 3DLLS 2L5NA 2VUMC 1O26A 4C3JC 3CQZA 1TWHA 4C3IC 1PJ6A 4KARA 4G0VA 3GDZA 1TWAC 4NOIA 3A8KA 4C3JK 3NUHA 2JA6A 3G4CA 1TWCA 3LAJA 4A3IC 4A3FK 3JSTA 1UV7A 1XXAA 3N0BA 4GTLA 5IYDC 2ZJRS 1XXBA 2O5IA 1WSRA 4KC6A 5FLMK 5E68A 2JA7C 2CW0A 1XXCA 2Y0SD 4BY7K 1YX2A 3G4AA 3PIOS 2NVYC 2KQ1A 1GE9A 1KQ4A 4A3DC 5IP9C 1I3QC 5L46A 2KWAA 2JA8K 3DXJA 2JA5K 4XLPA 5HL8A 3GTJK 1J6XA 4A3EK 1X31C 5IYCK 4MEYA 3I4NK 3N0CA 4C45A 2W7VA 3HOXC 4AYBD 3S2HK 1IS1A 2BE5A 4GTAA 4A93C 4BXXK 4A3DK 4A3CK 2A6EA 3S17C 1Y1WA 2JA7K 5IYBK 3ERED 2PMZD 4A3KC 2NVTC 1TWCK 1O29A 4GT9A 1Y1VC 1B4BA 1EI6A 1WQFA 2Y0SL 3GEIA 4BBSK 4MQ9A 3SZZA 1ZQ1C 4GTDA 3CQZK 3GTKA 5EGHA 1WQGA 4A3EC 3GTJC 3AD7C 1DD5A 1EFWA 2R93C 3GTOK 4LK0A 4ILDA 2O5JA 1DCPA 1TWGA 4Y7NC 5M5XK 5IYDK 2B63A 1INNA 2B63K 3H0GC 4KMHA 4G7OA 4IOCS 2R7ZC 5FLMC 1I6VA 2VUMA 3GTOA 2RH6A 5IP9K 1O27A 4KATA 1J6VA 3S14C 1YCLA 2RGRA 3I4MC 4A3BK 3AQPA 1K83A 3OREA 1L0WA 1O2FB 3AQOA 1WCMA 1XPPA 1ZXOA 3A8IA 3S2HC 3HOXK 4KMAA 2GAGC 4YG2A 2V6TA 2JA7A 3S17K 1USMA 4G7ZA 1B4AA 1Y1VK 3GTGC 4A3JK 1BJTA 2NVTK 4LK1A 3RZDK 2GSUA 4A93K 3A8JA 5TMFA 2E2JC 4RMFA 4KB4A 4FM9A 4BBSC 4C2MC 4LQYA 2GAHC 1IW7A 4WCES 1SFOC 3GTQA 3MMLB 4KASA 3S15K 1FEUA 2ZUFA 2NVXC 3TFHA 2D6FC 2JA8C 4YFXA 3M4OK 3FHZA 1TWFK 3HOYK 4X6AK 2E2IA 4BKWA 5M3FK 2E2JK 1Y1VA 4OIRA 1O2BA 2WB1D 2R7ZK 3K7AC 5C4JK 3L4JA 2Y3PA 1EH1A 1O25A 3ADAC 3S14K 4LLGA 3TFJA 4DDQA 5IOTA 1WCMK 4XSXA 5CJ9A 1J98A 4P5BA 1TWHK 3HOUK 1I6HK 3M4OC 1WOPA 4KM8A 1YNJA 3PO3C 2NVXK 2JH3A 3HOZK 3IPJA 2R92K 3GTMK 3CQZC 1DCHA 1I50A 1EQRA 1JQWA 2PHCB 3S16K 4BLBA 2WAQD
chains in the Genus database with same CATH topology
3GTQC 4KMUA 3HKZL 4BY1K 1Y1WC 4QJVB 1TWCC 5D4DA 5IP7C 4OIPA 4Q4ZA 3HOUC 4A3LC 4QIWL 1R9TC 4A3KK 5C3EC 3S1RC 4LK0A 3HOYC 5IYCC 2R93C 3GTOK 2E2HC 3GTKK 2O5JA 3S16C 3PO3K 4C3HC 4A3MC 3HOVK 3H3VD 1K83C 4YFNA 4Y7NC 5M5XK 2YU9K 4A3LK 1I50K 4JK1A 5IYDK 3FKIK 2B63K 3PO2K 3H0GC 2R92C 3GTMC 3RZOC 2PA8D 4G7OA 2WB1L 2R7ZC 3I4NC 5FLMC 1I6VA 4QJVA 2VUMK 3RZDC 1SFOK 3S1NK 3S1QK 1Y1WK 3K7AK 4BBRC 5IP9K 3HOWC 3I4MK 4A3JC 5TMCA 3GTPC 4BXXC 5C4XK 3S1MK 5M5YK 3WODA 4ZH4A 2E2IC 3S14C 2PMZL 1R9TK 4C2MK 3I4MC 3HOWK 4A3BK 1TWGC 4YFKA 4XLNA 4C3IK 3S1NC 5M3MK 5IYBC 4BY1C 4BBRK 3M4OK 4AYBL 4BY7C 2A68A 3S2DC 4Y7NK 1XPPA 1TWAK 2VUMC 4GZYA 2E2HK 3S2HC 3HOXK 4C3JC 5M5WK 2YU9C 4XSZA 4YG2A 4C3IC 1I3QK 3S17K 3FKIC 3S1QC 4G7ZA 1TWAC 4NOIA 1Y1VK 3GTGC 4A3BC 4A3JK 4C3JK 4QIWD 2NVTK 3GTQK 4A3IC 4A3FK 4OINA 3S2DK 4LK1A 2WAQL 3RZDK 4A93K 4Y52K 1I50C 5IYDC 2PPBA 5TMFA 2E2JC 2JA5C 4A3MK 3H0GK 4BBSC 1BDFA 1YNNA 4C2MC 2O5IA 5FLMK 1IW7A 2JA7C 2CW0A 4OIOA 3PO2C 1SFOC 2Y0SD 3M3YC 2JA6K 4A3GK 4BY7K 3S15K 3GTGK 3GTOC 3S1RK 2NVYC 2NVXC 5FJ8K 4LJZA 4OIQA 5C4XC 2JA8C 2JA6C 4YFXA 4A3GC 5C44K 3M3YK 2E2IK 4A3DC 1TWFK 5C3EK 5IP9C 5C4JC 3GTLC 1HQMA 1I3QC 3HOYK 2R93K 4X6AK 2B63C 4C3HK 4KN7A 5M3FK 2JA8K 3DXJA 2E2JK 4XLPA 2JA5K 4OIRA 3GTJK 4A3EK 4Q5SA 1WCMC 5IYCK 2WB1D 4MEYA 2NVQC 3I4NK 2R7ZK 4A3FC 3K7AC 3EQLA 5C4JK 4A3IK 5IP7K 3GTLK 1K83K 2A69A 4MEXA 3H3VL 3GTKC 3HOXC 4AYBD 3S14K 4LLGA 3S2HK 1TWHC 2BE5A 1I6HC 4Y52C 4A93C 1TWFC 3GTPK 4A3CK 4BXXK 2A6EA 4XSXA 3S17C 1ZYRA 1WCMK 4A3DK 2JA7K 5IYBK 2PMZD 3HKZD 4A3KC 2NVTC 1TWCK 3M4OC 3HOVC 1TWHK 3HOUK 1I6HK 3S15C 1Y1VC 1YNJA 3PO3C 2NVYK 4X6AC 2NVXK 4KN4A 4A3EC 2Y0SL 3HOZK 2R92K 3GTMK 3RZOK 2NVQK 3CQZC 4A3CC 4BBSK 4MQ9A 2A6HA 1TWGK 3HOZC 2PA8L 5C44C 4G7HA 3CQZK 3S16K 3GTJC 1SMYA 2WAQD 3S1MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTQ C;  4KMU A;  3HKZ L;  4BY1 K;  1Y1W C;  4QJV B;  1TWC C;  5D4D A;  5IP7 C;  4OIP A;  4Q4Z A;  3HOU C;  4A3L C;  4QIW L;  1R9T C;  4A3K K;  5C3E C;  3S1R C;  4LK0 A;  3HOY C;  5IYC C;  2R93 C;  3GTO K;  2E2H C;  3GTK K;  2O5J A;  3S16 C;  3PO3 K;  4C3H C;  4A3M C;  3HOV K;  3H3V D;  1K83 C;  4YFN A;  4Y7N C;  5M5X K;  2YU9 K;  4A3L K;  1I50 K;  4JK1 A;  5IYD K;  3FKI K;  2B63 K;  3PO2 K;  3H0G C;  2R92 C;  3GTM C;  3RZO C;  2PA8 D;  4G7O A;  2WB1 L;  2R7Z C;  3I4N C;  5FLM C;  1I6V A;  4QJV A;  2VUM K;  3RZD C;  1SFO K;  3S1N K;  3S1Q K;  1Y1W K;  3K7A K;  4BBR C;  5IP9 K;  3HOW C;  3I4M K;  4A3J C;  5TMC A;  3GTP C;  4BXX C;  5C4X K;  3S1M K;  5M5Y K;  3WOD A;  4ZH4 A;  2E2I C;  3S14 C;  2PMZ L;  1R9T K;  4C2M K;  3I4M C;  3HOW K;  4A3B K;  1TWG C;  4YFK A;  4XLN A;  4C3I K;  3S1N C;  5M3M K;  5IYB C;  4BY1 C;  4BBR K;  3M4O K;  4AYB L;  4BY7 C;  2A68 A;  3S2D C;  4Y7N K;  1XPP A;  1TWA K;  2VUM C;  4GZY A;  2E2H K;  3S2H C;  3HOX K;  4C3J C;  5M5W K;  2YU9 C;  4XSZ A;  4YG2 A;  4C3I C;  1I3Q K;  3S17 K;  3FKI C;  3S1Q C;  4G7Z A;  1TWA C;  4NOI A;  1Y1V K;  3GTG C;  4A3B C;  4A3J K;  4C3J K;  4QIW D;  2NVT K;  3GTQ K;  4A3I C;  4A3F K;  4OIN A;  3S2D K;  4LK1 A;  2WAQ L;  3RZD K;  4A93 K;  4Y52 K;  1I50 C;  5IYD C;  2PPB A;  5TMF A;  2E2J C;  2JA5 C;  4A3M K;  3H0G K;  4BBS C;  1BDF A;  1YNN A;  4C2M C;  2O5I A;  5FLM K;  1IW7 A;  2JA7 C;  2CW0 A;  4OIO A;  3PO2 C;  1SFO C;  2Y0S D;  3M3Y C;  2JA6 K;  4A3G K;  4BY7 K;  3S15 K;  3GTG K;  3GTO C;  3S1R K;  2NVY C;  2NVX C;  5FJ8 K;  4LJZ A;  4OIQ A;  5C4X C;  2JA8 C;  2JA6 C;  4YFX A;  4A3G C;  5C44 K;  3M3Y K;  2E2I K;  4A3D C;  1TWF K;  5C3E K;  5IP9 C;  5C4J C;  3GTL C;  1HQM A;  1I3Q C;  3HOY K;  2R93 K;  4X6A K;  2B63 C;  4C3H K;  4KN7 A;  5M3F K;  2JA8 K;  3DXJ A;  2E2J K;  4XLP A;  2JA5 K;  4OIR A;  3GTJ K;  4A3E K;  4Q5S A;  1WCM C;  5IYC K;  2WB1 D;  4MEY A;  2NVQ C;  3I4N K;  2R7Z K;  4A3F C;  3K7A C;  3EQL A;  5C4J K;  4A3I K;  5IP7 K;  3GTL K;  1K83 K;  2A69 A;  4MEX A;  3H3V L;  3GTK C;  3HOX C;  4AYB D;  3S14 K;  4LLG A;  3S2H K;  1TWH C;  2BE5 A;  1I6H C;  4Y52 C;  4A93 C;  1TWF C;  3GTP K;  4A3C K;  4BXX K;  2A6E A;  4XSX A;  3S17 C;  1ZYR A;  1WCM K;  4A3D K;  2JA7 K;  5IYB K;  2PMZ D;  3HKZ D;  4A3K C;  2NVT C;  1TWC K;  3M4O C;  3HOV C;  1TWH K;  3HOU K;  1I6H K;  3S15 C;  1Y1V C;  1YNJ A;  3PO3 C;  2NVY K;  4X6A C;  2NVX K;  4KN4 A;  4A3E C;  2Y0S L;  3HOZ K;  2R92 K;  3GTM K;  3RZO K;  2NVQ K;  3CQZ C;  4A3C C;  4BBS K;  4MQ9 A;  2A6H A;  1TWG K;  3HOZ C;  2PA8 L;  5C44 C;  4G7H A;  3CQZ K;  3S16 K;  3GTJ C;  1SMY A;  2WAQ D;  3S1M C; 
#chains in the Genus database with same CATH topology
 3AD8 C;  5D4D A;  3HOU C;  5C3E C;  3S1R C;  4GTB A;  3PO3 K;  2E2H C;  3S16 C;  4A3M C;  1O24 A;  1K83 C;  1I50 K;  3GEH A;  1DCO A;  3SZY A;  3FKI K;  4WF9 S;  1ISE A;  2R92 C;  3GTM C;  3I4N C;  2EBB A;  4WJ3 M;  3RZD C;  1SFO K;  3TFI A;  4WJ4 A;  3AH5 A;  4BBR C;  3HOW C;  2V6S A;  3GSI A;  4BXX C;  5C4X K;  4PAB A;  3L4K A;  1IE0 A;  1PJ7 A;  4IO9 S;  4KDD A;  4KMD A;  1VH2 A;  5IYB C;  4BY1 C;  4BBR K;  4BY7 C;  2A68 A;  3S2D C;  1TWA K;  2E2H K;  5M5W K;  2YU9 C;  4IOA S;  1I3Q K;  3FKI C;  1TWF A;  2FQO A;  3BP3 A;  3GTP A;  3T01 A;  3S1Q C;  2ZUE A;  3GTJ A;  2NVY A;  1ZVU A;  3GTQ K;  1F7V A;  4AH6 A;  4G0U A;  3GEE A;  3S2D K;  2PPB A;  5HL7 S;  2JA5 C;  3CF5 S;  3H0G K;  4P9S A;  1F93 A;  2CFA A;  2GSO A;  2KXY A;  3PO2 C;  1HI9 A;  1WQH A;  1XZP A;  3LYW A;  2ZJP S;  3S1R K;  2P8T A;  5FJ8 K;  2JA6 C;  4A3G C;  3M3Y K;  1VRQ C;  5C44 K;  5C3E K;  3GTL C;  4C3H K;  4KN7 A;  4KAW X;  1WIH A;  1BS2 A;  1XZQ A;  4Q5S A;  1VLO A;  3T00 A;  4A3F C;  4A3I K;  1AB4 A;  3GTL K;  1K83 K;  5JVH S;  5TJ3 A;  4MEX A;  3GTK C;  1WOO A;  1TWH C;  1I6H C;  4Y52 C;  1ZYR A;  1XZQ B;  3VA7 A;  3HKZ D;  4GTC A;  2NVY K;  4XCH A;  4A3C C;  4O2D A;  4PAA A;  1TWG K;  1JVI A;  3HOZ C;  4FZB A;  1O2A A;  2PA8 L;  3LAP A;  5EGE A;  1TWA A;  1SMY A;  5DM6 S;  3S1M C;  1R9T K;  3GTQ C;  3AD9 C;  3HKZ L;  1Y1W C;  1TWC C;  4A3K K;  4OIP A;  3HOY C;  3FOF A;  3CAG A;  3GTK K;  4LOW A;  1F7U A;  3H3V D;  4A3L K;  4JK1 A;  3Q3Q A;  5IOS A;  4WFB S;  3PO2 K;  5JVO A;  1SFO A;  4GTE A;  3S1N K;  2XCR B;  1Y1W K;  3K7A K;  3FKI A;  1XZP B;  4WFN S;  5DM7 S;  4A3J C;  3S1M K;  3GTP C;  1R9T A;  5M5Y K;  2CFA B;  3WOD A;  3FOE A;  1RU0 A;  2PMZ L;  4C2M K;  3HOW K;  4XLN A;  3PIP S;  3S1N C;  4WIL A;  4J3N A;  4AYB L;  3HXA A;  4BLA A;  4Y7N K;  1C0A A;  4GZY A;  1WSV A;  2JA5 A;  3BUE A;  4XSZ A;  1PJ5 A;  2NVX A;  2XCO A;  3N3Y A;  4A3B C;  4QIW D;  2GSN A;  3GIR A;  3GTL A;  4OIN A;  2R93 A;  2WAQ L;  4Y52 K;  1I50 C;  1JOE A;  1EK8 A;  4A3M K;  4U67 S;  1BDF A;  1YNN A;  3OEP A;  2P5M A;  5HQH A;  4OIO A;  2R7Z A;  3M3Y C;  2JA6 K;  4M1X A;  4A3G K;  3GTO C;  4LJZ A;  4OIQ A;  5C4X C;  5IOQ A;  2E2I K;  2R93 K;  5C4J C;  4KB2 A;  1HQM A;  2V6U A;  2B63 C;  3H0G A;  3S0X A;  1WOR A;  1WCM C;  2NVQ C;  3EQL A;  5IP7 K;  5IOR A;  3QX3 A;  2A69 A;  2FQT A;  3H3V L;  1J6W A;  4WFA S;  5JVG S;  1VGX A;  3GTP K;  1TWF C;  5CHP A;  1I3Q A;  3HOV C;  2KPU A;  1USO A;  3OPF A;  3S15 C;  2E2H A;  1IBA A;  4X6A C;  4KN4 A;  3RZO K;  2NVQ K;  3T02 A;  2A6H A;  2YU9 A;  1O28 A;  3TTG A;  5C44 C;  4G7H A;  1BGW A;  4GTF A;  3GTG A;  4KMU A;  4BY1 K;  4G0W A;  1V5V A;  4QJV B;  3GTG K;  5IP7 C;  4Q4Z A;  4QIW L;  4A3L C;  1R9T C;  5IYC C;  1G51 A;  4C3H C;  3BP8 C;  3HOV K;  4YFN A;  2YU9 K;  4KM9 A;  2XCQ A;  3RZO C;  2WB1 L;  2PA8 D;  4QJV A;  1VJE A;  1IL2 A;  2VUM K;  1F9N A;  1ZBS A;  3S1Q K;  3LPX A;  3I4M K;  5TMC A;  4P5A A;  1WOS A;  4ZH4 A;  2ZJQ S;  2E2I C;  2L3U A;  2ZFZ A;  4GFQ A;  4LR2 A;  1TWG C;  5JFE A;  4YFK A;  4C3I K;  1IQ0 A;  5M3M K;  3V4G A;  3GTM A;  2R92 A;  3DLL S;  2L5N A;  2VUM C;  1O26 A;  4C3J C;  3CQZ A;  1TWH A;  4C3I C;  1PJ6 A;  4KAR A;  4G0V A;  3GDZ A;  1TWA C;  4NOI A;  3A8K A;  4C3J K;  3NUH A;  2JA6 A;  3G4C A;  1TWC A;  3LAJ A;  4A3I C;  4A3F K;  3JST A;  1UV7 A;  1XXA A;  3N0B A;  4GTL A;  5IYD C;  2ZJR S;  1XXB A;  2O5I A;  1WSR A;  4KC6 A;  5FLM K;  5E68 A;  2JA7 C;  2CW0 A;  1XXC A;  2Y0S D;  4BY7 K;  1YX2 A;  3G4A A;  3PIO S;  2NVY C;  2KQ1 A;  1GE9 A;  1KQ4 A;  4A3D C;  5IP9 C;  1I3Q C;  5L46 A;  2KWA A;  2JA8 K;  3DXJ A;  2JA5 K;  4XLP A;  5HL8 A;  3GTJ K;  1J6X A;  4A3E K;  1X31 C;  5IYC K;  4MEY A;  3I4N K;  3N0C A;  4C45 A;  2W7V A;  3HOX C;  4AYB D;  3S2H K;  1IS1 A;  2BE5 A;  4GTA A;  4A93 C;  4BXX K;  4A3D K;  4A3C K;  2A6E A;  3S17 C;  1Y1W A;  2JA7 K;  5IYB K;  3ERE D;  2PMZ D;  4A3K C;  2NVT C;  1TWC K;  1O29 A;  4GT9 A;  1Y1V C;  1B4B A;  1EI6 A;  1WQF A;  2Y0S L;  3GEI A;  4BBS K;  4MQ9 A;  3SZZ A;  1ZQ1 C;  4GTD A;  3CQZ K;  3GTK A;  5EGH A;  1WQG A;  4A3E C;  3GTJ C;  3AD7 C;  1DD5 A;  1EFW A;  2R93 C;  3GTO K;  4LK0 A;  4ILD A;  2O5J A;  1DCP A;  1TWG A;  4Y7N C;  5M5X K;  5IYD K;  2B63 A;  1INN A;  2B63 K;  3H0G C;  4KMH A;  4G7O A;  4IOC S;  2R7Z C;  5FLM C;  1I6V A;  2VUM A;  3GTO A;  2RH6 A;  5IP9 K;  1O27 A;  4KAT A;  1J6V A;  3S14 C;  1YCL A;  2RGR A;  3I4M C;  4A3B K;  3AQP A;  1K83 A;  3ORE A;  1L0W A;  1O2F B;  3AQO A;  1WCM A;  1XPP A;  1ZXO A;  3A8I A;  3S2H C;  3HOX K;  4KMA A;  2GAG C;  4YG2 A;  2V6T A;  2JA7 A;  3S17 K;  1USM A;  4G7Z A;  1B4A A;  1Y1V K;  3GTG C;  4A3J K;  1BJT A;  2NVT K;  4LK1 A;  3RZD K;  2GSU A;  4A93 K;  3A8J A;  5TMF A;  2E2J C;  4RMF A;  4KB4 A;  4FM9 A;  4BBS C;  4C2M C;  4LQY A;  2GAH C;  1IW7 A;  4WCE S;  1SFO C;  3GTQ A;  3MML B;  4KAS A;  3S15 K;  1FEU A;  2ZUF A;  2NVX C;  3TFH A;  2D6F C;  2JA8 C;  4YFX A;  3M4O K;  3FHZ A;  1TWF K;  3HOY K;  4X6A K;  2E2I A;  4BKW A;  5M3F K;  2E2J K;  1Y1V A;  4OIR A;  1O2B A;  2WB1 D;  2R7Z K;  3K7A C;  5C4J K;  3L4J A;  2Y3P A;  1EH1 A;  1O25 A;  3ADA C;  3S14 K;  4LLG A;  3TFJ A;  4DDQ A;  5IOT A;  1WCM K;  4XSX A;  5CJ9 A;  1J98 A;  4P5B A;  1TWH K;  3HOU K;  1I6H K;  3M4O C;  1WOP A;  4KM8 A;  1YNJ A;  3PO3 C;  2NVX K;  2JH3 A;  3HOZ K;  3IPJ A;  2R92 K;  3GTM K;  3CQZ C;  1DCH A;  1I50 A;  1EQR A;  1JQW A;  2PHC B;  3S16 K;  4BLB A;  2WAQ D; 
#chains in the Genus database with same CATH homology
 3GTQ C;  4KMU A;  3HKZ L;  4BY1 K;  1Y1W C;  4QJV B;  1TWC C;  5D4D A;  5IP7 C;  4OIP A;  4Q4Z A;  3HOU C;  4A3L C;  4QIW L;  1R9T C;  4A3K K;  5C3E C;  3S1R C;  4LK0 A;  3HOY C;  5IYC C;  2R93 C;  3GTO K;  2E2H C;  3GTK K;  2O5J A;  3S16 C;  3PO3 K;  4C3H C;  4A3M C;  3HOV K;  3H3V D;  1K83 C;  4YFN A;  4Y7N C;  5M5X K;  2YU9 K;  4A3L K;  1I50 K;  4JK1 A;  5IYD K;  3FKI K;  2B63 K;  3PO2 K;  3H0G C;  2R92 C;  3GTM C;  3RZO C;  2PA8 D;  4G7O A;  2WB1 L;  2R7Z C;  3I4N C;  5FLM C;  1I6V A;  4QJV A;  2VUM K;  3RZD C;  1SFO K;  3S1N K;  3S1Q K;  1Y1W K;  3K7A K;  4BBR C;  5IP9 K;  3HOW C;  3I4M K;  4A3J C;  5TMC A;  3GTP C;  4BXX C;  5C4X K;  3S1M K;  5M5Y K;  3WOD A;  4ZH4 A;  2E2I C;  3S14 C;  2PMZ L;  1R9T K;  4C2M K;  3I4M C;  3HOW K;  4A3B K;  1TWG C;  4YFK A;  4XLN A;  4C3I K;  3S1N C;  5M3M K;  5IYB C;  4BY1 C;  4BBR K;  3M4O K;  4AYB L;  4BY7 C;  2A68 A;  3S2D C;  4Y7N K;  1XPP A;  1TWA K;  2VUM C;  4GZY A;  2E2H K;  3S2H C;  3HOX K;  4C3J C;  5M5W K;  2YU9 C;  4XSZ A;  4YG2 A;  4C3I C;  1I3Q K;  3S17 K;  3FKI C;  3S1Q C;  4G7Z A;  1TWA C;  4NOI A;  1Y1V K;  3GTG C;  4A3B C;  4A3J K;  4C3J K;  4QIW D;  2NVT K;  3GTQ K;  4A3I C;  4A3F K;  4OIN A;  3S2D K;  4LK1 A;  2WAQ L;  3RZD K;  4A93 K;  4Y52 K;  1I50 C;  5IYD C;  2PPB A;  5TMF A;  2E2J C;  2JA5 C;  4A3M K;  3H0G K;  4BBS C;  1BDF A;  1YNN A;  4C2M C;  2O5I A;  5FLM K;  1IW7 A;  2JA7 C;  2CW0 A;  4OIO A;  3PO2 C;  1SFO C;  2Y0S D;  3M3Y C;  2JA6 K;  4A3G K;  4BY7 K;  3S15 K;  3GTG K;  3GTO C;  3S1R K;  2NVY C;  2NVX C;  5FJ8 K;  4LJZ A;  4OIQ A;  5C4X C;  2JA8 C;  2JA6 C;  4YFX A;  4A3G C;  5C44 K;  3M3Y K;  2E2I K;  4A3D C;  1TWF K;  5C3E K;  5IP9 C;  5C4J C;  3GTL C;  1HQM A;  1I3Q C;  3HOY K;  2R93 K;  4X6A K;  2B63 C;  4C3H K;  4KN7 A;  5M3F K;  2JA8 K;  3DXJ A;  2E2J K;  4XLP A;  2JA5 K;  4OIR A;  3GTJ K;  4A3E K;  4Q5S A;  1WCM C;  5IYC K;  2WB1 D;  4MEY A;  2NVQ C;  3I4N K;  2R7Z K;  4A3F C;  3K7A C;  3EQL A;  5C4J K;  4A3I K;  5IP7 K;  3GTL K;  1K83 K;  2A69 A;  4MEX A;  3H3V L;  3GTK C;  3HOX C;  4AYB D;  3S14 K;  4LLG A;  3S2H K;  1TWH C;  2BE5 A;  1I6H C;  4Y52 C;  4A93 C;  1TWF C;  3GTP K;  4A3C K;  4BXX K;  2A6E A;  4XSX A;  3S17 C;  1ZYR A;  1WCM K;  4A3D K;  2JA7 K;  5IYB K;  2PMZ D;  3HKZ D;  4A3K C;  2NVT C;  1TWC K;  3M4O C;  3HOV C;  1TWH K;  3HOU K;  1I6H K;  3S15 C;  1Y1V C;  1YNJ A;  3PO3 C;  2NVY K;  4X6A C;  2NVX K;  4KN4 A;  4A3E C;  2Y0S L;  3HOZ K;  2R92 K;  3GTM K;  3RZO K;  2NVQ K;  3CQZ C;  4A3C C;  4BBS K;  4MQ9 A;  2A6H A;  1TWG K;  3HOZ C;  2PA8 L;  5C44 C;  4G7H A;  3CQZ K;  3S16 K;  3GTJ C;  1SMY A;  2WAQ D;  3S1M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...