1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
1YNNA 2YU9C 3PO2C 2CW0A 2E2IC 2R7ZK 3GTQC 2NVQC 5M5YK 4OINA 4Y7NC 4A3CC 3S2HC 4Q4ZA 1I6HK 2Y0SL 3HOXC 1YNJA 1BDFA 5C3EC 3I4NC 2E2JC 2R93C 2WAQD 4YFXA 5IP7C 4JK1A 2JA5C 3H0GC 3RZOC 4A3JK 1TWHK 4XSXA 3HOWC 1K83C 4MQ9A 1Y1VC 3HOVC 5IYCK 1R9TK 3S1MK 2PA8L 5C44C 1IW7A 1I50K 4BY1K 3GTOC 1TWFC 1HQMA 3CQZC 3GTJK 3PO3K 4KN7A 4C3IC 5FLMC 4YG2A 2R92C 1Y1WK 3S16C 4C2MC 3M4OC 4A3MK 3HOYK 1WCMC 1TWAK 5IP9K 1XPPA 3HOZK 3S2DK 2NVTK 4MEXA 2PMZL 4QJVA 3S1RC 4C3HC 3GTMC 3HKZL 4XLPA 2JA7C 4BBSK 4A3LC 3RZDK 4BY7K 4BXXC 3S15K 4BBRC 1SFOK 4A93C 3FKIC 4OIRA 2B63C 3S14C 2VUMK 2JA8C 2YU9K 4ZH4A 3PO2K 2NVYC 3K7AC 2E2HC 4NOIA 3S17C 4A3GC 5M5XK 3S1NK 2NVQK 5M3FK 2PPBA 2A6HA 4A3CK 2JA6C 4A3BC 3WODA 3S2HK 5IYBK 3I4MC 5C4XK 1TWCC 3GTKC 3GTPC 3HOXK 4A3IC 1I6VA 3GTLC 5C3EK 4A3EK 2E2JK 5IP7K 4OIQA 4QIWD 3RZOK 2R7ZC 2WB1D 4A3DK 3HOWK 2WAQL 1K83K 1Y1VK 4XSZA 4A3KK 1SMYA 2A69A 5FJ8K 3M3YC 4KMUA 4YFKA 2NVXC 4A3FK 4MEYA 4XLNA 5TMCA 3GTGK 4C2MK 4A3JC 3M4OK 1TWHC 4LLGA 1WCMK 3S1MC 4AYBD 1TWGK 3S1QK 4Y52C 4C3JK 1I50C 3S1RK 3HOUK 5M5WK 3GTMK 1I3QK 5IYDC 2JA7K 4LK0A 2E2IK 4X6AC 3GTQK 5C4JC 1Y1WC 4YFNA 2O5JA 4A3MC 3FKIK 3S14K 4Y7NK 2B63K 3S2DC 2JA8K 2NVYK 3K7AK 4G7HA 2E2HK 3S17K 4A3GK 3HOUC 2A68A 5TMFA 5D4DA 2A6EA 3I4NK 3DXJA 3RZDC 2JA5K 4BY7C 2R93K 3H0GK 2BE5A 4A3BK 3HOVK 4LK1A 1SFOC 4QJVB 3I4MK 5C44K 2Y0SD 2VUMC 4A3IK 2O5IA 3GTLK 3GTOK 1TWFK 3CQZK 1I6HC 5M3MK 4C3IK 4KN4A 3S1NC 4QIWL 5FLMK 2R92K 2WB1L 3S16K 3EQLA 3M3YK 5IYBC 2PA8D 3H3VD 5IYCC 1R9TC 5C4XC 2NVXK 4C3HK 4A3EC 4BY1C 3GTJC 3PO3C 4A3DC 4A3LK 4BXXK 4A3KC 4OIPA 4BBRK 1ZYRA 4Y52K 3H3VL 4A93K 3HOYC 4AYBL 2PMZD 3HOZC 1TWAC 5IP9C 5IYDK 2NVTC 4Q5SA 3HKZD 4A3FC 4X6AK 4G7OA 5C4JK 3GTGC 4BBSC 4G7ZA 4GZYA 2JA6K 1TWGC 3S1QC 3S15C 4C3JC 4OIOA 4LJZA 1TWCK 3GTKK 3GTPK 1I3QC
chains in the Genus database with same CATH superfamily
2CW0A 3HXAA 2NVQC 3OPFA 4OINA 3SZZA 2Y3PA 4Q4ZA 1IL2A 1J6WA 2V6TA 3HOXC 1YNJA 1DCOA 3FOFA 3I4NC 2E2JC 4YFXA 5IP7C 4JK1A 4C45A 1K83C 4MQ9A 3HOVC 1K83A 4BY1K 1J6VA 1HQMA 2GAGC 1WQGA 2L3UA 5HL7S 1V5VA 4GTFA 1Y1WK 4C2MC 3HOYK 1WCMC 1RU0A 1XPPA 4MEXA 1O25A 1WCMA 3HKZL 1I3QA 3FKIC 2JA8C 3Q3QA 3FKIA 4NOIA 4A3GC 5M3FK 2PPBA 2A6HA 1O27A 4FZBA 2RGRA 2R93A 2KWAA 3H0GA 3GTKC 5L46A 4A3IC 1I6VA 3GTLC 3PIPS 3RZOK 4XSZA 3CQZA 4A3KK 4KMUA 4A3FK 3M4OK 4A3JC 4WF9S 3JSTA 3LAPA 4C3JK 1I50C 3S1RK 5M5WK 2JA7K 2E2IK 1IE0A 3LYWA 4X6AC 3GTQK 4YFNA 4A3MC 4Y7NK 1KQ4A 2B63K 4WJ4A 3MMLB 4G7HA 4WFNS 2A68A 2JA5K 1XXCA 1TWCA 4A3BK 1L0WA 1ZXOA 4WFAS 4QJVB 1EK8A 4P9SA 2R7ZA 2VUMC 4WFBS 4C3IK 2JH3A 5FLMK 1C0AA 5IYBC 2PA8D 2FQTA 5IYCC 5JVGS 1X31C 2NVXK 1TWHA 1EI6A 1F93A 5HQHA 3GTJC 2KQ1A 3TFJA 4A3DC 2CFAB 3GTJA 4OIPA 4A93K 3HOZC 1TWAC 4KASA 2NVTC 5DM6S 4G7OA 1TWAA 5C4JK 1O2FB 4KAWX 1USMA 1TWGC 3S1QC 4WILA 3S15C 3QX3A 3GTPK 3DLLS 2YU9C 3PO2C 1SFOA 1EQRA 1XZQA 5M5YK 4A3CC 1O28A 3PIOS 3S2HC 1O26A 3T02A 1VJEA 2ZUFA 3GIRA 2PA8L 5C44C 3N0CA 3GTOC 1TWFC 3VA7A 3GEHA 3PO3K 1USOA 3CAGA 2R92C 3S16C 1YX2A 5IP9K 1WSRA 3S2DK 3GTGA 1O29A 4BBSK 4A3LC 3RZDK 4BXXC 2FQOA 1JOEA 3AD7C 3S14C 3TFIA 2NVYC 3K7AC 3S17C 3S1NK 3T00A 2NVQK 2NVYA 1B4BA 2JA6C 3WODA 4GTBA 4LR2A 2GSUA 3I4MC 3HOXK 1YCLA 2E2JK 5IP7K 4QIWD 1K83K 2A69A 5JFEA 3M3YC 1JVIA 2ZUEA 1VLOA 1IS1A 4XLNA 2ZJRS 4C2MK 4U67S 1WCMK 1WIHA 4BLBA 1I3QK 3AD8C 5JVHS 4KB2A 1Y1WC 4GT9A 3FKIK 1BJTA 1F7VA 2JA8K 4KB4A 4A3GK 5D4DA 1F9NA 2R93K 3H0GK 3GTKA 3GTLA 1PJ5A 4ILDA 4GTEA 1IQ0A 2Y0SD 2P5MA 4A3IK 3GTLK 3SZYA 1ZVUA 3CQZK 3FHZA 1I6HC 3BP8C 4QIWL 4G0UA 1J98A 3GEEA 3EQLA 2GSNA 4GFQA 2L5NA 1R9TC 3GDZA 4C3HK 3L4KA 1R9TA 3AH5A 1I50A 4KC6A 2ZJQS 4A3KC 4BBRK 3H3VL 1IBAA 4GTCA 4A3FC 1XXBA 4X6AK 1DD5A 4BLAA 4G7ZA 4LQYA 4C3JC 4WCES 1TWCK 1ISEA 2E2IC 2R7ZK 3GTQC 2VUMA 4KARA 1WQFA 4Y7NC 5TJ3A 1JQWA 2PHCB 2Y0SL 3TTGA 5C3EC 2WAQD 2JA5C 1J6XA 2KXYA 1WOPA 1TWHK 1WSVA 4XSXA 3HOWC 1XXAA 5IYCK 1Y1VC 3S1MK 2ZJPS 3GEIA 5CHPA 1Y1VA 3GTJK 4O2DA 4KN7A 4C3IC 5FLMC 4YG2A 1B4AA 3HOZK 1TWAK 1XZQB 2NVTK 1PJ7A 3G4CA 4QJVA 3GTMC 1UV7A 5DM7S 1TWGA 4BY7K 1BGWA 1O24A 3GTMA 2XCRB 4WJ3M 2YU9A 3S15K 1SFOK 4A93C 4IOAS 3N0BA 2YU9K 3PO2K 2E2HC 1O2AA 1EH1A 1INNA 5IOTA 2E2HA 4A3CK 5IOQA 1WOSA 3S2HK 5C4XK 4KM9A 3GTPC 4A3EK 3TFHA 3AQPA 2WAQL 3OEPA 3G4AA 1TWFA 3GTOA 5FJ8K 2R92A 4YFKA 3GTGK 4LLGA 1ZQ1C 3BUEA 4LOWA 4Y52C 5IYDC 2V6SA 2V6UA 2O5JA 1XZPA 2GSOA 3S14K 3S2DC 2NVYK 3K7AK 3S17K 3HOUC 2JA6A 5TMFA 3I4NK 3RZDC 2RH6A 2BE5A 2XCQA 4PAAA 3OREA 3HOVK 3I4MK 5E68A 2ZFZA 1G51A 2KPUA 4KN4A 3S1NC 5IOSA 4GTDA 3M3YK 3H3VD 4BY1C 4KM8A 4M1XA 2W7VA 3HOYC 2PMZD 5IORA 1Y1WA 4GTAA 4Q5SA 1VGXA 3ADAC 1GE9A 4GZYA 5JVOA 4OIOA 1DCPA 3GTKK 3CF5S 1YNNA 1I3QC 1PJ6A 3A8IA 2P8TA 4J3NA 1I6HK 1BDFA 2R93C 3T01A 3RZOC 3H0GC 4A3JK 1R9TK 5EGHA 1I50K 1IW7A 4P5AA 3CQZC 1WORA 3LAJA 3M4OC 3FOEA 4A3MK 1HI9A 4FM9A 2PMZL 3S1RC 4C3HC 4XLPA 2JA7C 1F7UA 2GAHC 2JA7A 2EBBA 4BBRC 2E2IA 4OIRA 2B63C 3N3YA 3GTQA 4PABA 2VUMK 4ZH4A 3A8KA 2B63A 5M5XK 1O2BA 4A3BC 3AD9C 5IYBK 4DDQA 2JA5A 1TWCC 5C3EK 5HL8A 4OIQA 2R7ZC 2WB1D 4A3DK 3HOWK 1AB4A 1Y1VK 1SMYA 3V4GA 1FEUA 4AH6A 4IO9S 2NVXC 1VRQC 4MEYA 4G0WA 5TMCA 2NVXA 1TWHC 3S1MC 4AYBD 3AQOA 1TWGK 3S1QK 3HOUK 3GTMK 4KMDA 3BP3A 4LK0A 2XCOA 5C4JC 1ZBSA 4P5BA 5EGEA 2CFAA 1BS2A 2E2HK 2A6EA 3DXJA 1EFWA 4BY7C 3NUHA 3GTPA 4LK1A 1SFOC 1WQHA 4KATA 5C44K 4BKWA 2O5IA 3GTOK 1TWFK 1VH2A 5M3MK 5CJ9A 2R92K 2WB1L 4KMHA 3S16K 3L4JA 4G0VA 1WOOA 3IPJA 5C4XC 1XZPB 4A3EC 3PO3C 4A3LK 4BXXK 4RMFA 4XCHA 3LPXA 4Y52K 1ZYRA 4AYBL 4KDDA 5IP9C 5IYDK 4IOCS 3ERED 3A8JA 3HKZD 1DCHA 3GTGC 4BBSC 4GTLA 2JA6K 3GSIA 2D6FC 3S0XA 4LJZA 4KMAA
chains in the Genus database with same CATH topology
1YNNA 2YU9C 3PO2C 2CW0A 2E2IC 2R7ZK 3GTQC 2NVQC 5M5YK 4OINA 4Y7NC 4A3CC 3S2HC 4Q4ZA 1I6HK 2Y0SL 3HOXC 1YNJA 1BDFA 5C3EC 3I4NC 2E2JC 2R93C 2WAQD 4YFXA 5IP7C 4JK1A 2JA5C 3H0GC 3RZOC 4A3JK 1TWHK 4XSXA 3HOWC 1K83C 4MQ9A 1Y1VC 3HOVC 5IYCK 1R9TK 3S1MK 2PA8L 5C44C 1IW7A 1I50K 4BY1K 3GTOC 1TWFC 1HQMA 3CQZC 3GTJK 3PO3K 4KN7A 4C3IC 5FLMC 4YG2A 2R92C 1Y1WK 3S16C 4C2MC 3M4OC 4A3MK 3HOYK 1WCMC 1TWAK 5IP9K 1XPPA 3HOZK 3S2DK 2NVTK 4MEXA 2PMZL 4QJVA 3S1RC 4C3HC 3GTMC 3HKZL 4XLPA 2JA7C 4BBSK 4A3LC 3RZDK 4BY7K 4BXXC 3S15K 4BBRC 1SFOK 4A93C 3FKIC 4OIRA 2B63C 3S14C 2VUMK 2JA8C 2YU9K 4ZH4A 3PO2K 2NVYC 3K7AC 2E2HC 4NOIA 3S17C 4A3GC 5M5XK 3S1NK 2NVQK 5M3FK 2PPBA 2A6HA 4A3CK 2JA6C 4A3BC 3WODA 3S2HK 5IYBK 3I4MC 5C4XK 1TWCC 3GTKC 3GTPC 3HOXK 4A3IC 1I6VA 3GTLC 5C3EK 4A3EK 2E2JK 5IP7K 4OIQA 4QIWD 3RZOK 2R7ZC 2WB1D 4A3DK 3HOWK 2WAQL 1K83K 1Y1VK 4XSZA 4A3KK 1SMYA 2A69A 5FJ8K 3M3YC 4KMUA 4YFKA 2NVXC 4A3FK 4MEYA 4XLNA 5TMCA 3GTGK 4C2MK 4A3JC 3M4OK 1TWHC 4LLGA 1WCMK 3S1MC 4AYBD 1TWGK 3S1QK 4Y52C 4C3JK 1I50C 3S1RK 3HOUK 5M5WK 3GTMK 1I3QK 5IYDC 2JA7K 4LK0A 2E2IK 4X6AC 3GTQK 5C4JC 1Y1WC 4YFNA 2O5JA 4A3MC 3FKIK 3S14K 4Y7NK 2B63K 3S2DC 2JA8K 2NVYK 3K7AK 4G7HA 2E2HK 3S17K 4A3GK 3HOUC 2A68A 5TMFA 5D4DA 2A6EA 3I4NK 3DXJA 3RZDC 2JA5K 4BY7C 2R93K 3H0GK 2BE5A 4A3BK 3HOVK 4LK1A 1SFOC 4QJVB 3I4MK 5C44K 2Y0SD 2VUMC 4A3IK 2O5IA 3GTLK 3GTOK 1TWFK 3CQZK 1I6HC 5M3MK 4C3IK 4KN4A 3S1NC 4QIWL 5FLMK 2R92K 2WB1L 3S16K 3EQLA 3M3YK 5IYBC 2PA8D 3H3VD 5IYCC 1R9TC 5C4XC 2NVXK 4C3HK 4A3EC 4BY1C 3GTJC 3PO3C 4A3DC 4A3LK 4BXXK 4A3KC 4OIPA 4BBRK 1ZYRA 4Y52K 3H3VL 4A93K 3HOYC 4AYBL 2PMZD 3HOZC 1TWAC 5IP9C 5IYDK 2NVTC 4Q5SA 3HKZD 4A3FC 4X6AK 4G7OA 5C4JK 3GTGC 4BBSC 4G7ZA 4GZYA 2JA6K 1TWGC 3S1QC 3S15C 4C3JC 4OIOA 4LJZA 1TWCK 3GTKK 3GTPK 1I3QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNN A;  2YU9 C;  3PO2 C;  2CW0 A;  2E2I C;  2R7Z K;  3GTQ C;  2NVQ C;  5M5Y K;  4OIN A;  4Y7N C;  4A3C C;  3S2H C;  4Q4Z A;  1I6H K;  2Y0S L;  3HOX C;  1YNJ A;  1BDF A;  5C3E C;  3I4N C;  2E2J C;  2R93 C;  2WAQ D;  4YFX A;  5IP7 C;  4JK1 A;  2JA5 C;  3H0G C;  3RZO C;  4A3J K;  1TWH K;  4XSX A;  3HOW C;  1K83 C;  4MQ9 A;  1Y1V C;  3HOV C;  5IYC K;  1R9T K;  3S1M K;  2PA8 L;  5C44 C;  1IW7 A;  1I50 K;  4BY1 K;  3GTO C;  1TWF C;  1HQM A;  3CQZ C;  3GTJ K;  3PO3 K;  4KN7 A;  4C3I C;  5FLM C;  4YG2 A;  2R92 C;  1Y1W K;  3S16 C;  4C2M C;  3M4O C;  4A3M K;  3HOY K;  1WCM C;  1TWA K;  5IP9 K;  1XPP A;  3HOZ K;  3S2D K;  2NVT K;  4MEX A;  2PMZ L;  4QJV A;  3S1R C;  4C3H C;  3GTM C;  3HKZ L;  4XLP A;  2JA7 C;  4BBS K;  4A3L C;  3RZD K;  4BY7 K;  4BXX C;  3S15 K;  4BBR C;  1SFO K;  4A93 C;  3FKI C;  4OIR A;  2B63 C;  3S14 C;  2VUM K;  2JA8 C;  2YU9 K;  4ZH4 A;  3PO2 K;  2NVY C;  3K7A C;  2E2H C;  4NOI A;  3S17 C;  4A3G C;  5M5X K;  3S1N K;  2NVQ K;  5M3F K;  2PPB A;  2A6H A;  4A3C K;  2JA6 C;  4A3B C;  3WOD A;  3S2H K;  5IYB K;  3I4M C;  5C4X K;  1TWC C;  3GTK C;  3GTP C;  3HOX K;  4A3I C;  1I6V A;  3GTL C;  5C3E K;  4A3E K;  2E2J K;  5IP7 K;  4OIQ A;  4QIW D;  3RZO K;  2R7Z C;  2WB1 D;  4A3D K;  3HOW K;  2WAQ L;  1K83 K;  1Y1V K;  4XSZ A;  4A3K K;  1SMY A;  2A69 A;  5FJ8 K;  3M3Y C;  4KMU A;  4YFK A;  2NVX C;  4A3F K;  4MEY A;  4XLN A;  5TMC A;  3GTG K;  4C2M K;  4A3J C;  3M4O K;  1TWH C;  4LLG A;  1WCM K;  3S1M C;  4AYB D;  1TWG K;  3S1Q K;  4Y52 C;  4C3J K;  1I50 C;  3S1R K;  3HOU K;  5M5W K;  3GTM K;  1I3Q K;  5IYD C;  2JA7 K;  4LK0 A;  2E2I K;  4X6A C;  3GTQ K;  5C4J C;  1Y1W C;  4YFN A;  2O5J A;  4A3M C;  3FKI K;  3S14 K;  4Y7N K;  2B63 K;  3S2D C;  2JA8 K;  2NVY K;  3K7A K;  4G7H A;  2E2H K;  3S17 K;  4A3G K;  3HOU C;  2A68 A;  5TMF A;  5D4D A;  2A6E A;  3I4N K;  3DXJ A;  3RZD C;  2JA5 K;  4BY7 C;  2R93 K;  3H0G K;  2BE5 A;  4A3B K;  3HOV K;  4LK1 A;  1SFO C;  4QJV B;  3I4M K;  5C44 K;  2Y0S D;  2VUM C;  4A3I K;  2O5I A;  3GTL K;  3GTO K;  1TWF K;  3CQZ K;  1I6H C;  5M3M K;  4C3I K;  4KN4 A;  3S1N C;  4QIW L;  5FLM K;  2R92 K;  2WB1 L;  3S16 K;  3EQL A;  3M3Y K;  5IYB C;  2PA8 D;  3H3V D;  5IYC C;  1R9T C;  5C4X C;  2NVX K;  4C3H K;  4A3E C;  4BY1 C;  3GTJ C;  3PO3 C;  4A3D C;  4A3L K;  4BXX K;  4A3K C;  4OIP A;  4BBR K;  1ZYR A;  4Y52 K;  3H3V L;  4A93 K;  3HOY C;  4AYB L;  2PMZ D;  3HOZ C;  1TWA C;  5IP9 C;  5IYD K;  2NVT C;  4Q5S A;  3HKZ D;  4A3F C;  4X6A K;  4G7O A;  5C4J K;  3GTG C;  4BBS C;  4G7Z A;  4GZY A;  2JA6 K;  1TWG C;  3S1Q C;  3S15 C;  4C3J C;  4OIO A;  4LJZ A;  1TWC K;  3GTK K;  3GTP K;  1I3Q C; 
#chains in the Genus database with same CATH topology
 2CW0 A;  3HXA A;  2NVQ C;  3OPF A;  4OIN A;  3SZZ A;  2Y3P A;  4Q4Z A;  1IL2 A;  1J6W A;  2V6T A;  3HOX C;  1YNJ A;  1DCO A;  3FOF A;  3I4N C;  2E2J C;  4YFX A;  5IP7 C;  4JK1 A;  4C45 A;  1K83 C;  4MQ9 A;  3HOV C;  1K83 A;  4BY1 K;  1J6V A;  1HQM A;  2GAG C;  1WQG A;  2L3U A;  5HL7 S;  1V5V A;  4GTF A;  1Y1W K;  4C2M C;  3HOY K;  1WCM C;  1RU0 A;  1XPP A;  4MEX A;  1O25 A;  1WCM A;  3HKZ L;  1I3Q A;  3FKI C;  2JA8 C;  3Q3Q A;  3FKI A;  4NOI A;  4A3G C;  5M3F K;  2PPB A;  2A6H A;  1O27 A;  4FZB A;  2RGR A;  2R93 A;  2KWA A;  3H0G A;  3GTK C;  5L46 A;  4A3I C;  1I6V A;  3GTL C;  3PIP S;  3RZO K;  4XSZ A;  3CQZ A;  4A3K K;  4KMU A;  4A3F K;  3M4O K;  4A3J C;  4WF9 S;  3JST A;  3LAP A;  4C3J K;  1I50 C;  3S1R K;  5M5W K;  2JA7 K;  2E2I K;  1IE0 A;  3LYW A;  4X6A C;  3GTQ K;  4YFN A;  4A3M C;  4Y7N K;  1KQ4 A;  2B63 K;  4WJ4 A;  3MML B;  4G7H A;  4WFN S;  2A68 A;  2JA5 K;  1XXC A;  1TWC A;  4A3B K;  1L0W A;  1ZXO A;  4WFA S;  4QJV B;  1EK8 A;  4P9S A;  2R7Z A;  2VUM C;  4WFB S;  4C3I K;  2JH3 A;  5FLM K;  1C0A A;  5IYB C;  2PA8 D;  2FQT A;  5IYC C;  5JVG S;  1X31 C;  2NVX K;  1TWH A;  1EI6 A;  1F93 A;  5HQH A;  3GTJ C;  2KQ1 A;  3TFJ A;  4A3D C;  2CFA B;  3GTJ A;  4OIP A;  4A93 K;  3HOZ C;  1TWA C;  4KAS A;  2NVT C;  5DM6 S;  4G7O A;  1TWA A;  5C4J K;  1O2F B;  4KAW X;  1USM A;  1TWG C;  3S1Q C;  4WIL A;  3S15 C;  3QX3 A;  3GTP K;  3DLL S;  2YU9 C;  3PO2 C;  1SFO A;  1EQR A;  1XZQ A;  5M5Y K;  4A3C C;  1O28 A;  3PIO S;  3S2H C;  1O26 A;  3T02 A;  1VJE A;  2ZUF A;  3GIR A;  2PA8 L;  5C44 C;  3N0C A;  3GTO C;  1TWF C;  3VA7 A;  3GEH A;  3PO3 K;  1USO A;  3CAG A;  2R92 C;  3S16 C;  1YX2 A;  5IP9 K;  1WSR A;  3S2D K;  3GTG A;  1O29 A;  4BBS K;  4A3L C;  3RZD K;  4BXX C;  2FQO A;  1JOE A;  3AD7 C;  3S14 C;  3TFI A;  2NVY C;  3K7A C;  3S17 C;  3S1N K;  3T00 A;  2NVQ K;  2NVY A;  1B4B A;  2JA6 C;  3WOD A;  4GTB A;  4LR2 A;  2GSU A;  3I4M C;  3HOX K;  1YCL A;  2E2J K;  5IP7 K;  4QIW D;  1K83 K;  2A69 A;  5JFE A;  3M3Y C;  1JVI A;  2ZUE A;  1VLO A;  1IS1 A;  4XLN A;  2ZJR S;  4C2M K;  4U67 S;  1WCM K;  1WIH A;  4BLB A;  1I3Q K;  3AD8 C;  5JVH S;  4KB2 A;  1Y1W C;  4GT9 A;  3FKI K;  1BJT A;  1F7V A;  2JA8 K;  4KB4 A;  4A3G K;  5D4D A;  1F9N A;  2R93 K;  3H0G K;  3GTK A;  3GTL A;  1PJ5 A;  4ILD A;  4GTE A;  1IQ0 A;  2Y0S D;  2P5M A;  4A3I K;  3GTL K;  3SZY A;  1ZVU A;  3CQZ K;  3FHZ A;  1I6H C;  3BP8 C;  4QIW L;  4G0U A;  1J98 A;  3GEE A;  3EQL A;  2GSN A;  4GFQ A;  2L5N A;  1R9T C;  3GDZ A;  4C3H K;  3L4K A;  1R9T A;  3AH5 A;  1I50 A;  4KC6 A;  2ZJQ S;  4A3K C;  4BBR K;  3H3V L;  1IBA A;  4GTC A;  4A3F C;  1XXB A;  4X6A K;  1DD5 A;  4BLA A;  4G7Z A;  4LQY A;  4C3J C;  4WCE S;  1TWC K;  1ISE A;  2E2I C;  2R7Z K;  3GTQ C;  2VUM A;  4KAR A;  1WQF A;  4Y7N C;  5TJ3 A;  1JQW A;  2PHC B;  2Y0S L;  3TTG A;  5C3E C;  2WAQ D;  2JA5 C;  1J6X A;  2KXY A;  1WOP A;  1TWH K;  1WSV A;  4XSX A;  3HOW C;  1XXA A;  5IYC K;  1Y1V C;  3S1M K;  2ZJP S;  3GEI A;  5CHP A;  1Y1V A;  3GTJ K;  4O2D A;  4KN7 A;  4C3I C;  5FLM C;  4YG2 A;  1B4A A;  3HOZ K;  1TWA K;  1XZQ B;  2NVT K;  1PJ7 A;  3G4C A;  4QJV A;  3GTM C;  1UV7 A;  5DM7 S;  1TWG A;  4BY7 K;  1BGW A;  1O24 A;  3GTM A;  2XCR B;  4WJ3 M;  2YU9 A;  3S15 K;  1SFO K;  4A93 C;  4IOA S;  3N0B A;  2YU9 K;  3PO2 K;  2E2H C;  1O2A A;  1EH1 A;  1INN A;  5IOT A;  2E2H A;  4A3C K;  5IOQ A;  1WOS A;  3S2H K;  5C4X K;  4KM9 A;  3GTP C;  4A3E K;  3TFH A;  3AQP A;  2WAQ L;  3OEP A;  3G4A A;  1TWF A;  3GTO A;  5FJ8 K;  2R92 A;  4YFK A;  3GTG K;  4LLG A;  1ZQ1 C;  3BUE A;  4LOW A;  4Y52 C;  5IYD C;  2V6S A;  2V6U A;  2O5J A;  1XZP A;  2GSO A;  3S14 K;  3S2D C;  2NVY K;  3K7A K;  3S17 K;  3HOU C;  2JA6 A;  5TMF A;  3I4N K;  3RZD C;  2RH6 A;  2BE5 A;  2XCQ A;  4PAA A;  3ORE A;  3HOV K;  3I4M K;  5E68 A;  2ZFZ A;  1G51 A;  2KPU A;  4KN4 A;  3S1N C;  5IOS A;  4GTD A;  3M3Y K;  3H3V D;  4BY1 C;  4KM8 A;  4M1X A;  2W7V A;  3HOY C;  2PMZ D;  5IOR A;  1Y1W A;  4GTA A;  4Q5S A;  1VGX A;  3ADA C;  1GE9 A;  4GZY A;  5JVO A;  4OIO A;  1DCP A;  3GTK K;  3CF5 S;  1YNN A;  1I3Q C;  1PJ6 A;  3A8I A;  2P8T A;  4J3N A;  1I6H K;  1BDF A;  2R93 C;  3T01 A;  3RZO C;  3H0G C;  4A3J K;  1R9T K;  5EGH A;  1I50 K;  1IW7 A;  4P5A A;  3CQZ C;  1WOR A;  3LAJ A;  3M4O C;  3FOE A;  4A3M K;  1HI9 A;  4FM9 A;  2PMZ L;  3S1R C;  4C3H C;  4XLP A;  2JA7 C;  1F7U A;  2GAH C;  2JA7 A;  2EBB A;  4BBR C;  2E2I A;  4OIR A;  2B63 C;  3N3Y A;  3GTQ A;  4PAB A;  2VUM K;  4ZH4 A;  3A8K A;  2B63 A;  5M5X K;  1O2B A;  4A3B C;  3AD9 C;  5IYB K;  4DDQ A;  2JA5 A;  1TWC C;  5C3E K;  5HL8 A;  4OIQ A;  2R7Z C;  2WB1 D;  4A3D K;  3HOW K;  1AB4 A;  1Y1V K;  1SMY A;  3V4G A;  1FEU A;  4AH6 A;  4IO9 S;  2NVX C;  1VRQ C;  4MEY A;  4G0W A;  5TMC A;  2NVX A;  1TWH C;  3S1M C;  4AYB D;  3AQO A;  1TWG K;  3S1Q K;  3HOU K;  3GTM K;  4KMD A;  3BP3 A;  4LK0 A;  2XCO A;  5C4J C;  1ZBS A;  4P5B A;  5EGE A;  2CFA A;  1BS2 A;  2E2H K;  2A6E A;  3DXJ A;  1EFW A;  4BY7 C;  3NUH A;  3GTP A;  4LK1 A;  1SFO C;  1WQH A;  4KAT A;  5C44 K;  4BKW A;  2O5I A;  3GTO K;  1TWF K;  1VH2 A;  5M3M K;  5CJ9 A;  2R92 K;  2WB1 L;  4KMH A;  3S16 K;  3L4J A;  4G0V A;  1WOO A;  3IPJ A;  5C4X C;  1XZP B;  4A3E C;  3PO3 C;  4A3L K;  4BXX K;  4RMF A;  4XCH A;  3LPX A;  4Y52 K;  1ZYR A;  4AYB L;  4KDD A;  5IP9 C;  5IYD K;  4IOC S;  3ERE D;  3A8J A;  3HKZ D;  1DCH A;  3GTG C;  4BBS C;  4GTL A;  2JA6 K;  3GSI A;  2D6F C;  3S0X A;  4LJZ A;  4KMA A; 
#chains in the Genus database with same CATH homology
 1YNN A;  2YU9 C;  3PO2 C;  2CW0 A;  2E2I C;  2R7Z K;  3GTQ C;  2NVQ C;  5M5Y K;  4OIN A;  4Y7N C;  4A3C C;  3S2H C;  4Q4Z A;  1I6H K;  2Y0S L;  3HOX C;  1YNJ A;  1BDF A;  5C3E C;  3I4N C;  2E2J C;  2R93 C;  2WAQ D;  4YFX A;  5IP7 C;  4JK1 A;  2JA5 C;  3H0G C;  3RZO C;  4A3J K;  1TWH K;  4XSX A;  3HOW C;  1K83 C;  4MQ9 A;  1Y1V C;  3HOV C;  5IYC K;  1R9T K;  3S1M K;  2PA8 L;  5C44 C;  1IW7 A;  1I50 K;  4BY1 K;  3GTO C;  1TWF C;  1HQM A;  3CQZ C;  3GTJ K;  3PO3 K;  4KN7 A;  4C3I C;  5FLM C;  4YG2 A;  2R92 C;  1Y1W K;  3S16 C;  4C2M C;  3M4O C;  4A3M K;  3HOY K;  1WCM C;  1TWA K;  5IP9 K;  1XPP A;  3HOZ K;  3S2D K;  2NVT K;  4MEX A;  2PMZ L;  4QJV A;  3S1R C;  4C3H C;  3GTM C;  3HKZ L;  4XLP A;  2JA7 C;  4BBS K;  4A3L C;  3RZD K;  4BY7 K;  4BXX C;  3S15 K;  4BBR C;  1SFO K;  4A93 C;  3FKI C;  4OIR A;  2B63 C;  3S14 C;  2VUM K;  2JA8 C;  2YU9 K;  4ZH4 A;  3PO2 K;  2NVY C;  3K7A C;  2E2H C;  4NOI A;  3S17 C;  4A3G C;  5M5X K;  3S1N K;  2NVQ K;  5M3F K;  2PPB A;  2A6H A;  4A3C K;  2JA6 C;  4A3B C;  3WOD A;  3S2H K;  5IYB K;  3I4M C;  5C4X K;  1TWC C;  3GTK C;  3GTP C;  3HOX K;  4A3I C;  1I6V A;  3GTL C;  5C3E K;  4A3E K;  2E2J K;  5IP7 K;  4OIQ A;  4QIW D;  3RZO K;  2R7Z C;  2WB1 D;  4A3D K;  3HOW K;  2WAQ L;  1K83 K;  1Y1V K;  4XSZ A;  4A3K K;  1SMY A;  2A69 A;  5FJ8 K;  3M3Y C;  4KMU A;  4YFK A;  2NVX C;  4A3F K;  4MEY A;  4XLN A;  5TMC A;  3GTG K;  4C2M K;  4A3J C;  3M4O K;  1TWH C;  4LLG A;  1WCM K;  3S1M C;  4AYB D;  1TWG K;  3S1Q K;  4Y52 C;  4C3J K;  1I50 C;  3S1R K;  3HOU K;  5M5W K;  3GTM K;  1I3Q K;  5IYD C;  2JA7 K;  4LK0 A;  2E2I K;  4X6A C;  3GTQ K;  5C4J C;  1Y1W C;  4YFN A;  2O5J A;  4A3M C;  3FKI K;  3S14 K;  4Y7N K;  2B63 K;  3S2D C;  2JA8 K;  2NVY K;  3K7A K;  4G7H A;  2E2H K;  3S17 K;  4A3G K;  3HOU C;  2A68 A;  5TMF A;  5D4D A;  2A6E A;  3I4N K;  3DXJ A;  3RZD C;  2JA5 K;  4BY7 C;  2R93 K;  3H0G K;  2BE5 A;  4A3B K;  3HOV K;  4LK1 A;  1SFO C;  4QJV B;  3I4M K;  5C44 K;  2Y0S D;  2VUM C;  4A3I K;  2O5I A;  3GTL K;  3GTO K;  1TWF K;  3CQZ K;  1I6H C;  5M3M K;  4C3I K;  4KN4 A;  3S1N C;  4QIW L;  5FLM K;  2R92 K;  2WB1 L;  3S16 K;  3EQL A;  3M3Y K;  5IYB C;  2PA8 D;  3H3V D;  5IYC C;  1R9T C;  5C4X C;  2NVX K;  4C3H K;  4A3E C;  4BY1 C;  3GTJ C;  3PO3 C;  4A3D C;  4A3L K;  4BXX K;  4A3K C;  4OIP A;  4BBR K;  1ZYR A;  4Y52 K;  3H3V L;  4A93 K;  3HOY C;  4AYB L;  2PMZ D;  3HOZ C;  1TWA C;  5IP9 C;  5IYD K;  2NVT C;  4Q5S A;  3HKZ D;  4A3F C;  4X6A K;  4G7O A;  5C4J K;  3GTG C;  4BBS C;  4G7Z A;  4GZY A;  2JA6 K;  1TWG C;  3S1Q C;  3S15 C;  4C3J C;  4OIO A;  4LJZ A;  1TWC K;  3GTK K;  3GTP K;  1I3Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...