1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
5D4DA 4A3FK 3DXJA 2JA6K 3I4NK 2NVYC 4A3MK 3S14C 1I6HC 5IP7K 1BDFA 5IYDC 4OINA 2R92K 3RZOK 4YG2A 4OIOA 3I4MC 3S17C 3S2DC 1Y1VK 3H3VL 2Y0SD 2PMZL 2NVQK 4AYBD 4YFXA 2E2JC 3HOXK 4MQ9A 3PO2C 3GTGC 3M4OK 1WCMC 3HOVC 4XLPA 4A3KC 4A93C 1TWGK 3GTOC 3HKZL 5C44K 4A3GC 2VUMK 4C2MC 1I3QK 4A3DC 1TWAC 4C3IC 4QJVB 4BY7K 1TWHC 3S16C 4QIWD 5C4JC 3GTQC 5M5YK 5FJ8K 3S1RK 1SFOK 3S1NK 2NVTC 3HOYK 1YNNA 2E2IC 4A3EC 3HOZC 4C3HK 5M5XK 5FLMC 4YFNA 4G7HA 4KN4A 3K7AK 5M3MK 1HQMA 5IYCC 1K83C 1SMYA 4A3IC 2JA5C 1TWCC 2YU9K 3GTJK 3S15C 4Y52C 4JK1A 4BBRC 2WAQD 3RZDK 1TWFC 1R9TC 3CQZK 5M3FK 2WB1D 4A3JC 2R7ZK 4QJVA 3I4NC 4X6AK 2B63K 5IP7C 5IP9K 3RZOC 4XLNA 4Y7NK 1Y1VC 4A3BK 2PPBA 4KMUA 4C3JC 2CW0A 4BXXK 3H3VD 5C3EC 3PO3C 2PMZD 4GZYA 2JA7K 2R93K 2NVYK 3FKIC 3S1MC 4G7ZA 3HOUC 4LK0A 2O5JA 2Y0SL 4A3LK 5IYBK 5IYDK 4LK1A 4BY7C 3S2DK 3S17K 1XPPA 2E2HK 1SFOC 1Y1WC 3S1RC 3S1QC 5M5WK 2E2JK 3HOYC 4LLGA 4OIQA 3PO2K 4C3HC 3GTGK 4OIRA 3HOVK 4A3KK 5C4XK 4A93K 3GTOK 3S2HK 4BY1C 3HOWK 4XSXA 2A6HA 3GTPC 4Q4ZA 4C2MK 2A6EA 4BBSC 2JA8K 4A3CK 4C3IK 1TWHK 4A3FC 2JA6C 5C4JK 3GTQK 4A3MC 3RZDC 2NVTK 1IW7A 3GTMK 1YNJA 5TMCA 2E2IK 2R92C 2PA8L 3HOZK 5FLMK 1I50K 2NVQC 4X6AC 1ZYRA 3HOXC 3H0GK 5IYCK 3GTLK 3M3YK 2NVXK 1TWCK 3M4OC 3GTKK 3S15K 1TWGC 1I6VA 2BE5A 5C44C 2VUMC 1TWFK 1R9TK 3S14K 3HKZD 1I3QC 4Q5SA 3WODA 1I6HK 4AYBL 2JA7C 3I4MK 2R93C 3S1NC 4MEYA 2A69A 5TMFA 4G7OA 4A3LC 4ZH4A 5IYBC 1WCMK 3K7AC 2E2HC 4OIPA 2O5IA 4C3JK 4A3GK 4QIWL 4MEXA 2A68A 4NOIA 3GTJC 2YU9C 5C3EK 3PO3K 1TWAK 4A3DK 5C4XC 3S2HC 3S16K 4XSZA 3HOWC 3FKIK 3S1MK 3CQZC 3HOUK 4A3CC 2JA8C 4A3EK 2R7ZC 1Y1WK 3S1QK 2B63C 1K83K 3GTMC 4A3IK 2WAQL 2JA5K 5IP9C 4Y7NC 1I50C 4A3BC 4Y52K 4BBRK 4KN7A 4BY1K 2WB1L 2PA8D 3H0GC 4BXXC 3GTLC 3GTPK 3M3YC 4YFKA 2NVXC 3GTKC 4BBSK 4A3JK 3EQLA 4LJZA
chains in the Genus database with same CATH superfamily
1EFWA 1BDFA 2R92K 2ZFZA 1IQ0A 4GTLA 3GTKA 4MQ9A 1YCLA 3GTGC 1EH1A 5DM6S 3HOVC 1R9TA 1TWGK 3GTOC 2ZJRS 1TWAC 4QIWD 1IBAA 2E2IC 2ZJPS 3GEIA 5FLMC 3Q3QA 3K7AK 1HQMA 1WORA 2KPUA 3PIPS 4BBRC 4KC6A 2WAQD 3TFJA 1SFOA 2WB1D 1Y1WA 1KQ4A 4X6AK 1ZQ1C 4XLNA 3N3YA 5JVOA 2PPBA 4C45A 4BXXK 5C3EC 3LYWA 1USOA 3GEHA 3LAPA 3FKIC 4BLAA 4G7ZA 2O5JA 5IYBK 2E2HK 4J3NA 3NUHA 1B4BA 5C4XK 4GTCA 4XSXA 3GTPC 4BLBA 4KMHA 4KM8A 2JA8K 4A3CK 3A8KA 1TWHK 4A3FC 2JA6C 1VGXA 1VJEA 4GTDA 1F93A 4GTFA 1DCPA 4WJ4A 4X6AC 1ZYRA 5IYCK 3GTKK 3BP3A 2CFAB 5C44C 2VUMC 1R9TK 1WSRA 1BGWA 3GTMA 2KQ1A 5IYBC 5CHPA 1B4AA 2E2HC 4C3JK 4XCHA 2RGRA 2GSUA 2A68A 2R93A 2CFAA 5C4XC 3PIOS 3AD8C 3CQZC 4A3CC 2JA8C 2ZUFA 4A3EK 1AB4A 1Y1WK 3S1QK 2B63C 1JQWA 4KB4A 5IP9C 4Y7NC 2V6SA 3S0XA 5IOSA 3MMLB 1FEUA 2L3UA 3OPFA 3GTKC 4BBSK 3DXJA 2NVYC 4A3MK 3L4JA 1I50A 5IYDC 1O28A 4OINA 3RZOK 4YG2A 4OIOA 3GTLA 2NVXA 1XXAA 3PO2C 3VA7A 4A3KC 2EBBA 3A8IA 4C2MC 4C3IC 4BY7K 5C4JC 1VLOA 3GTQC 1WCMA 3HOYK 1YNNA 4A3EC 3GEEA 4IOCS 1EI6A 1J98A 1TWCC 5JVGS 1F9NA 4RMFA 3S15C 1VH2A 4JK1A 1J6WA 4LQYA 3RZDK 1TWFC 5HL7S 5M3FK 2JA5A 4KB2A 3TFHA 3G4AA 3RZOC 4GTAA 3GSIA 3G4CA 4KMUA 2CW0A 1ISEA 5DM7S 4WJ3M 2R93K 4G0UA 3HOUC 2Y0SL 4A3LK 4BY7C 3S2DK 3S17K 2E2JK 3HOYC 4LLGA 4GFQA 4OIRA 2XCQA 4A93K 1I3QA 4G0VA 5IOTA 1HI9A 2JA7A 2A6EA 4BKWA 3T00A 1O2FB 3RZDC 2NVTK 5TMCA 3HOZK 2R92C 1IL2A 1I50K 2YU9A 2ZUEA 3GTJA 3H0GK 3GTLK 1DCOA 3M3YK 2NVXK 3HXAA 1TWGC 1I6VA 2BE5A 1C0AA 3AH5A 1WOSA 3S14K 2R7ZA 2P5MA 3WODA 1WSVA 2R93C 3V4GA 4MEYA 4KDDA 3FHZA 2A69A 4A3LC 1WCMK 3K7AC 1YX2A 4A3GK 4NOIA 3ERED 3PO3K 1IE0A 4GTEA 4XSZA 3S1MK 1XZQB 3GTGA 2JA5K 3GTOA 1I50C 3ADAC 2L5NA 2GAGC 4BY1K 3H0GC 4BXXC 3DLLS 3GTLC 3M3YC 4YFKA 2NVXC 3CF5S 4LJZA 3BUEA 2E2IA 3S14C 5EGHA 1XZQA 3H3VL 1ZXOA 2NVQK 3HOXK 3M4OK 1WCMC 1INNA 3HKZL 3LPXA 4A3GC 4KAWX 1I3QK 1DD5A 2FQTA 1TWHC 5FJ8K 5M5YK 1SFOK 3S1NK 3S1RK 4C3HK 2RH6A 1ZBSA 5M5XK 4YFNA 4KN4A 4U67S 1J6VA 5M3MK 5JVHS 5IYCC 2JA5C 2YU9K 1V5VA 3GTJK 1O24A 3FKIA 1R9TC 2R7ZK 1K83A 2JH3A 3GTPA 4A3BK 2W7VA 4C3JC 2GSOA 2PHCB 3H3VD 5TJ3A 2JA6A 3A8JA 1RU0A 4WFBS 1XZPB 1Y1VA 3OEPA 4KASA 1SFOC 1Y1WC 3S1RC 3S1QC 2P8TA 4OIQA 1O2AA 4C3HC 3GTGK 3HOVK 1EQRA 2VUMA 3GTOK 3S2HK 4IOAS 1PJ6A 4Q4ZA 1WIHA 4BBSC 4WFNS 4WFAS 4A3MC 3GTMK 1YNJA 1XZPA 2E2IK 2E2HA 5FLMK 4KMDA 2FQOA 3N0BA 3CQZA 4Q5SA 1VRQC 2GSNA 4P5AA 1I6HK 3AQPA 4AYBL 3I4MK 2B63A 1J6XA 3FOEA 4G7OA 1XXCA 4GTBA 5HQHA 5C3EK 4A3DK 2NVYA 3GDZA 2XCRB 3S2HC 3S16K 3FKIK 4KARA 5IOQA 3CAGA 2ZJQS 4M1XA 3SZYA 1K83K 3GTMC 1BJTA 4A3IK 1GE9A 4Y52K 3GTPK 4O2DA 3GTQA 4A3JK 5D4DA 4A3FK 2JA6K 3I4NK 1L0WA 1O29A 1I6HC 5IP7K 5E68A 3JSTA 3I4MC 3S17C 3S2DC 1Y1VK 3AQOA 3OREA 2Y0SD 1WQGA 2PMZL 1TWCA 4WILA 4AYBD 4YFXA 2E2JC 3SZZA 4XLPA 1TWFA 4A93C 4P5BA 5C44K 2VUMK 4A3DC 4QJVB 3S16C 3TTGA 2NVTC 3HOZC 1JVIA 1G51A 4G7HA 1WQFA 1DCHA 3T01A 2GAHC 1TWAA 1K83C 1SMYA 4A3IC 2D6FC 1ZVUA 4Y52C 1X31C 3TFIA 3CQZK 3LAJA 1O2BA 4A3JC 4QJVA 3I4NC 4PABA 3GIRA 1IS1A 2B63K 5IP7C 4WCES 5IP9K 4Y7NK 1O25A 1Y1VC 5EGEA 4FZBA 1PJ5A 3PO3C 2PMZD 4GZYA 4LOWA 2JA7K 2NVYK 2R92A 3S1MC 4LK0A 5IYDK 4WF9S 4LK1A 2Y3PA 1XPPA 5M5WK 4PAAA 1TWGA 3PO2K 3AD7C 5JFEA 4FM9A 4KM9A 4A3KK 4BY1C 3HOWK 2A6HA 4C2MK 1EK8A 4C3IK 1USMA 5C4JK 1PJ7A 3GTQK 1UV7A 4AH6A 1IW7A 3BP8C 1XXBA 3FOFA 2PA8L 1F7VA 5HL8A 4P9SA 2NVQC 2KWAA 3HOXC 2KXYA 1TWCK 3M4OC 4KMAA 3S15K 2XCOA 1WOOA 3T02A 3AD9C 1TWFK 3HKZD 1I3QC 1JOEA 5IORA 3N0CA 2JA7C 4LR2A 3S1NC 3IPJA 4DDQA 1WQHA 1WOPA 5TMFA 4GT9A 4ZH4A 3H0GA 5CJ9A 4G0WA 4OIPA 2O5IA 4QIWL 4MEXA 2YU9C 4KATA 3GTJC 1TWAK 3L4KA 3HOWC 4IO9S 3HOUK 1BS2A 3QX3A 2R7ZC 1F7UA 5L46A 1O27A 2WAQL 1O26A 4A3BC 4BBRK 4KN7A 4ILDA 2WB1L 2PA8D 2V6UA 2V6TA 1TWHA 3EQLA
chains in the Genus database with same CATH topology
5D4DA 4A3FK 3DXJA 2JA6K 3I4NK 2NVYC 4A3MK 3S14C 1I6HC 5IP7K 1BDFA 5IYDC 4OINA 2R92K 3RZOK 4YG2A 4OIOA 3I4MC 3S17C 3S2DC 1Y1VK 3H3VL 2Y0SD 2PMZL 2NVQK 4AYBD 4YFXA 2E2JC 3HOXK 4MQ9A 3PO2C 3GTGC 3M4OK 1WCMC 3HOVC 4XLPA 4A3KC 4A93C 1TWGK 3GTOC 3HKZL 5C44K 4A3GC 2VUMK 4C2MC 1I3QK 4A3DC 1TWAC 4C3IC 4QJVB 4BY7K 1TWHC 3S16C 4QIWD 5C4JC 3GTQC 5M5YK 5FJ8K 3S1RK 1SFOK 3S1NK 2NVTC 3HOYK 1YNNA 2E2IC 4A3EC 3HOZC 4C3HK 5M5XK 5FLMC 4YFNA 4G7HA 4KN4A 3K7AK 5M3MK 1HQMA 5IYCC 1K83C 1SMYA 4A3IC 2JA5C 1TWCC 2YU9K 3GTJK 3S15C 4Y52C 4JK1A 4BBRC 2WAQD 3RZDK 1TWFC 1R9TC 3CQZK 5M3FK 2WB1D 4A3JC 2R7ZK 4QJVA 3I4NC 4X6AK 2B63K 5IP7C 5IP9K 3RZOC 4XLNA 4Y7NK 1Y1VC 4A3BK 2PPBA 4KMUA 4C3JC 2CW0A 4BXXK 3H3VD 5C3EC 3PO3C 2PMZD 4GZYA 2JA7K 2R93K 2NVYK 3FKIC 3S1MC 4G7ZA 3HOUC 4LK0A 2O5JA 2Y0SL 4A3LK 5IYBK 5IYDK 4LK1A 4BY7C 3S2DK 3S17K 1XPPA 2E2HK 1SFOC 1Y1WC 3S1RC 3S1QC 5M5WK 2E2JK 3HOYC 4LLGA 4OIQA 3PO2K 4C3HC 3GTGK 4OIRA 3HOVK 4A3KK 5C4XK 4A93K 3GTOK 3S2HK 4BY1C 3HOWK 4XSXA 2A6HA 3GTPC 4Q4ZA 4C2MK 2A6EA 4BBSC 2JA8K 4A3CK 4C3IK 1TWHK 4A3FC 2JA6C 5C4JK 3GTQK 4A3MC 3RZDC 2NVTK 1IW7A 3GTMK 1YNJA 5TMCA 2E2IK 2R92C 2PA8L 3HOZK 5FLMK 1I50K 2NVQC 4X6AC 1ZYRA 3HOXC 3H0GK 5IYCK 3GTLK 3M3YK 2NVXK 1TWCK 3M4OC 3GTKK 3S15K 1TWGC 1I6VA 2BE5A 5C44C 2VUMC 1TWFK 1R9TK 3S14K 3HKZD 1I3QC 4Q5SA 3WODA 1I6HK 4AYBL 2JA7C 3I4MK 2R93C 3S1NC 4MEYA 2A69A 5TMFA 4G7OA 4A3LC 4ZH4A 5IYBC 1WCMK 3K7AC 2E2HC 4OIPA 2O5IA 4C3JK 4A3GK 4QIWL 4MEXA 2A68A 4NOIA 3GTJC 2YU9C 5C3EK 3PO3K 1TWAK 4A3DK 5C4XC 3S2HC 3S16K 4XSZA 3HOWC 3FKIK 3S1MK 3CQZC 3HOUK 4A3CC 2JA8C 4A3EK 2R7ZC 1Y1WK 3S1QK 2B63C 1K83K 3GTMC 4A3IK 2WAQL 2JA5K 5IP9C 4Y7NC 1I50C 4A3BC 4Y52K 4BBRK 4KN7A 4BY1K 2WB1L 2PA8D 3H0GC 4BXXC 3GTLC 3GTPK 3M3YC 4YFKA 2NVXC 3GTKC 4BBSK 4A3JK 3EQLA 4LJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D4D A;  4A3F K;  3DXJ A;  2JA6 K;  3I4N K;  2NVY C;  4A3M K;  3S14 C;  1I6H C;  5IP7 K;  1BDF A;  5IYD C;  4OIN A;  2R92 K;  3RZO K;  4YG2 A;  4OIO A;  3I4M C;  3S17 C;  3S2D C;  1Y1V K;  3H3V L;  2Y0S D;  2PMZ L;  2NVQ K;  4AYB D;  4YFX A;  2E2J C;  3HOX K;  4MQ9 A;  3PO2 C;  3GTG C;  3M4O K;  1WCM C;  3HOV C;  4XLP A;  4A3K C;  4A93 C;  1TWG K;  3GTO C;  3HKZ L;  5C44 K;  4A3G C;  2VUM K;  4C2M C;  1I3Q K;  4A3D C;  1TWA C;  4C3I C;  4QJV B;  4BY7 K;  1TWH C;  3S16 C;  4QIW D;  5C4J C;  3GTQ C;  5M5Y K;  5FJ8 K;  3S1R K;  1SFO K;  3S1N K;  2NVT C;  3HOY K;  1YNN A;  2E2I C;  4A3E C;  3HOZ C;  4C3H K;  5M5X K;  5FLM C;  4YFN A;  4G7H A;  4KN4 A;  3K7A K;  5M3M K;  1HQM A;  5IYC C;  1K83 C;  1SMY A;  4A3I C;  2JA5 C;  1TWC C;  2YU9 K;  3GTJ K;  3S15 C;  4Y52 C;  4JK1 A;  4BBR C;  2WAQ D;  3RZD K;  1TWF C;  1R9T C;  3CQZ K;  5M3F K;  2WB1 D;  4A3J C;  2R7Z K;  4QJV A;  3I4N C;  4X6A K;  2B63 K;  5IP7 C;  5IP9 K;  3RZO C;  4XLN A;  4Y7N K;  1Y1V C;  4A3B K;  2PPB A;  4KMU A;  4C3J C;  2CW0 A;  4BXX K;  3H3V D;  5C3E C;  3PO3 C;  2PMZ D;  4GZY A;  2JA7 K;  2R93 K;  2NVY K;  3FKI C;  3S1M C;  4G7Z A;  3HOU C;  4LK0 A;  2O5J A;  2Y0S L;  4A3L K;  5IYB K;  5IYD K;  4LK1 A;  4BY7 C;  3S2D K;  3S17 K;  1XPP A;  2E2H K;  1SFO C;  1Y1W C;  3S1R C;  3S1Q C;  5M5W K;  2E2J K;  3HOY C;  4LLG A;  4OIQ A;  3PO2 K;  4C3H C;  3GTG K;  4OIR A;  3HOV K;  4A3K K;  5C4X K;  4A93 K;  3GTO K;  3S2H K;  4BY1 C;  3HOW K;  4XSX A;  2A6H A;  3GTP C;  4Q4Z A;  4C2M K;  2A6E A;  4BBS C;  2JA8 K;  4A3C K;  4C3I K;  1TWH K;  4A3F C;  2JA6 C;  5C4J K;  3GTQ K;  4A3M C;  3RZD C;  2NVT K;  1IW7 A;  3GTM K;  1YNJ A;  5TMC A;  2E2I K;  2R92 C;  2PA8 L;  3HOZ K;  5FLM K;  1I50 K;  2NVQ C;  4X6A C;  1ZYR A;  3HOX C;  3H0G K;  5IYC K;  3GTL K;  3M3Y K;  2NVX K;  1TWC K;  3M4O C;  3GTK K;  3S15 K;  1TWG C;  1I6V A;  2BE5 A;  5C44 C;  2VUM C;  1TWF K;  1R9T K;  3S14 K;  3HKZ D;  1I3Q C;  4Q5S A;  3WOD A;  1I6H K;  4AYB L;  2JA7 C;  3I4M K;  2R93 C;  3S1N C;  4MEY A;  2A69 A;  5TMF A;  4G7O A;  4A3L C;  4ZH4 A;  5IYB C;  1WCM K;  3K7A C;  2E2H C;  4OIP A;  2O5I A;  4C3J K;  4A3G K;  4QIW L;  4MEX A;  2A68 A;  4NOI A;  3GTJ C;  2YU9 C;  5C3E K;  3PO3 K;  1TWA K;  4A3D K;  5C4X C;  3S2H C;  3S16 K;  4XSZ A;  3HOW C;  3FKI K;  3S1M K;  3CQZ C;  3HOU K;  4A3C C;  2JA8 C;  4A3E K;  2R7Z C;  1Y1W K;  3S1Q K;  2B63 C;  1K83 K;  3GTM C;  4A3I K;  2WAQ L;  2JA5 K;  5IP9 C;  4Y7N C;  1I50 C;  4A3B C;  4Y52 K;  4BBR K;  4KN7 A;  4BY1 K;  2WB1 L;  2PA8 D;  3H0G C;  4BXX C;  3GTL C;  3GTP K;  3M3Y C;  4YFK A;  2NVX C;  3GTK C;  4BBS K;  4A3J K;  3EQL A;  4LJZ A; 
#chains in the Genus database with same CATH topology
 1EFW A;  1BDF A;  2R92 K;  2ZFZ A;  1IQ0 A;  4GTL A;  3GTK A;  4MQ9 A;  1YCL A;  3GTG C;  1EH1 A;  5DM6 S;  3HOV C;  1R9T A;  1TWG K;  3GTO C;  2ZJR S;  1TWA C;  4QIW D;  1IBA A;  2E2I C;  2ZJP S;  3GEI A;  5FLM C;  3Q3Q A;  3K7A K;  1HQM A;  1WOR A;  2KPU A;  3PIP S;  4BBR C;  4KC6 A;  2WAQ D;  3TFJ A;  1SFO A;  2WB1 D;  1Y1W A;  1KQ4 A;  4X6A K;  1ZQ1 C;  4XLN A;  3N3Y A;  5JVO A;  2PPB A;  4C45 A;  4BXX K;  5C3E C;  3LYW A;  1USO A;  3GEH A;  3LAP A;  3FKI C;  4BLA A;  4G7Z A;  2O5J A;  5IYB K;  2E2H K;  4J3N A;  3NUH A;  1B4B A;  5C4X K;  4GTC A;  4XSX A;  3GTP C;  4BLB A;  4KMH A;  4KM8 A;  2JA8 K;  4A3C K;  3A8K A;  1TWH K;  4A3F C;  2JA6 C;  1VGX A;  1VJE A;  4GTD A;  1F93 A;  4GTF A;  1DCP A;  4WJ4 A;  4X6A C;  1ZYR A;  5IYC K;  3GTK K;  3BP3 A;  2CFA B;  5C44 C;  2VUM C;  1R9T K;  1WSR A;  1BGW A;  3GTM A;  2KQ1 A;  5IYB C;  5CHP A;  1B4A A;  2E2H C;  4C3J K;  4XCH A;  2RGR A;  2GSU A;  2A68 A;  2R93 A;  2CFA A;  5C4X C;  3PIO S;  3AD8 C;  3CQZ C;  4A3C C;  2JA8 C;  2ZUF A;  4A3E K;  1AB4 A;  1Y1W K;  3S1Q K;  2B63 C;  1JQW A;  4KB4 A;  5IP9 C;  4Y7N C;  2V6S A;  3S0X A;  5IOS A;  3MML B;  1FEU A;  2L3U A;  3OPF A;  3GTK C;  4BBS K;  3DXJ A;  2NVY C;  4A3M K;  3L4J A;  1I50 A;  5IYD C;  1O28 A;  4OIN A;  3RZO K;  4YG2 A;  4OIO A;  3GTL A;  2NVX A;  1XXA A;  3PO2 C;  3VA7 A;  4A3K C;  2EBB A;  3A8I A;  4C2M C;  4C3I C;  4BY7 K;  5C4J C;  1VLO A;  3GTQ C;  1WCM A;  3HOY K;  1YNN A;  4A3E C;  3GEE A;  4IOC S;  1EI6 A;  1J98 A;  1TWC C;  5JVG S;  1F9N A;  4RMF A;  3S15 C;  1VH2 A;  4JK1 A;  1J6W A;  4LQY A;  3RZD K;  1TWF C;  5HL7 S;  5M3F K;  2JA5 A;  4KB2 A;  3TFH A;  3G4A A;  3RZO C;  4GTA A;  3GSI A;  3G4C A;  4KMU A;  2CW0 A;  1ISE A;  5DM7 S;  4WJ3 M;  2R93 K;  4G0U A;  3HOU C;  2Y0S L;  4A3L K;  4BY7 C;  3S2D K;  3S17 K;  2E2J K;  3HOY C;  4LLG A;  4GFQ A;  4OIR A;  2XCQ A;  4A93 K;  1I3Q A;  4G0V A;  5IOT A;  1HI9 A;  2JA7 A;  2A6E A;  4BKW A;  3T00 A;  1O2F B;  3RZD C;  2NVT K;  5TMC A;  3HOZ K;  2R92 C;  1IL2 A;  1I50 K;  2YU9 A;  2ZUE A;  3GTJ A;  3H0G K;  3GTL K;  1DCO A;  3M3Y K;  2NVX K;  3HXA A;  1TWG C;  1I6V A;  2BE5 A;  1C0A A;  3AH5 A;  1WOS A;  3S14 K;  2R7Z A;  2P5M A;  3WOD A;  1WSV A;  2R93 C;  3V4G A;  4MEY A;  4KDD A;  3FHZ A;  2A69 A;  4A3L C;  1WCM K;  3K7A C;  1YX2 A;  4A3G K;  4NOI A;  3ERE D;  3PO3 K;  1IE0 A;  4GTE A;  4XSZ A;  3S1M K;  1XZQ B;  3GTG A;  2JA5 K;  3GTO A;  1I50 C;  3ADA C;  2L5N A;  2GAG C;  4BY1 K;  3H0G C;  4BXX C;  3DLL S;  3GTL C;  3M3Y C;  4YFK A;  2NVX C;  3CF5 S;  4LJZ A;  3BUE A;  2E2I A;  3S14 C;  5EGH A;  1XZQ A;  3H3V L;  1ZXO A;  2NVQ K;  3HOX K;  3M4O K;  1WCM C;  1INN A;  3HKZ L;  3LPX A;  4A3G C;  4KAW X;  1I3Q K;  1DD5 A;  2FQT A;  1TWH C;  5FJ8 K;  5M5Y K;  1SFO K;  3S1N K;  3S1R K;  4C3H K;  2RH6 A;  1ZBS A;  5M5X K;  4YFN A;  4KN4 A;  4U67 S;  1J6V A;  5M3M K;  5JVH S;  5IYC C;  2JA5 C;  2YU9 K;  1V5V A;  3GTJ K;  1O24 A;  3FKI A;  1R9T C;  2R7Z K;  1K83 A;  2JH3 A;  3GTP A;  4A3B K;  2W7V A;  4C3J C;  2GSO A;  2PHC B;  3H3V D;  5TJ3 A;  2JA6 A;  3A8J A;  1RU0 A;  4WFB S;  1XZP B;  1Y1V A;  3OEP A;  4KAS A;  1SFO C;  1Y1W C;  3S1R C;  3S1Q C;  2P8T A;  4OIQ A;  1O2A A;  4C3H C;  3GTG K;  3HOV K;  1EQR A;  2VUM A;  3GTO K;  3S2H K;  4IOA S;  1PJ6 A;  4Q4Z A;  1WIH A;  4BBS C;  4WFN S;  4WFA S;  4A3M C;  3GTM K;  1YNJ A;  1XZP A;  2E2I K;  2E2H A;  5FLM K;  4KMD A;  2FQO A;  3N0B A;  3CQZ A;  4Q5S A;  1VRQ C;  2GSN A;  4P5A A;  1I6H K;  3AQP A;  4AYB L;  3I4M K;  2B63 A;  1J6X A;  3FOE A;  4G7O A;  1XXC A;  4GTB A;  5HQH A;  5C3E K;  4A3D K;  2NVY A;  3GDZ A;  2XCR B;  3S2H C;  3S16 K;  3FKI K;  4KAR A;  5IOQ A;  3CAG A;  2ZJQ S;  4M1X A;  3SZY A;  1K83 K;  3GTM C;  1BJT A;  4A3I K;  1GE9 A;  4Y52 K;  3GTP K;  4O2D A;  3GTQ A;  4A3J K;  5D4D A;  4A3F K;  2JA6 K;  3I4N K;  1L0W A;  1O29 A;  1I6H C;  5IP7 K;  5E68 A;  3JST A;  3I4M C;  3S17 C;  3S2D C;  1Y1V K;  3AQO A;  3ORE A;  2Y0S D;  1WQG A;  2PMZ L;  1TWC A;  4WIL A;  4AYB D;  4YFX A;  2E2J C;  3SZZ A;  4XLP A;  1TWF A;  4A93 C;  4P5B A;  5C44 K;  2VUM K;  4A3D C;  4QJV B;  3S16 C;  3TTG A;  2NVT C;  3HOZ C;  1JVI A;  1G51 A;  4G7H A;  1WQF A;  1DCH A;  3T01 A;  2GAH C;  1TWA A;  1K83 C;  1SMY A;  4A3I C;  2D6F C;  1ZVU A;  4Y52 C;  1X31 C;  3TFI A;  3CQZ K;  3LAJ A;  1O2B A;  4A3J C;  4QJV A;  3I4N C;  4PAB A;  3GIR A;  1IS1 A;  2B63 K;  5IP7 C;  4WCE S;  5IP9 K;  4Y7N K;  1O25 A;  1Y1V C;  5EGE A;  4FZB A;  1PJ5 A;  3PO3 C;  2PMZ D;  4GZY A;  4LOW A;  2JA7 K;  2NVY K;  2R92 A;  3S1M C;  4LK0 A;  5IYD K;  4WF9 S;  4LK1 A;  2Y3P A;  1XPP A;  5M5W K;  4PAA A;  1TWG A;  3PO2 K;  3AD7 C;  5JFE A;  4FM9 A;  4KM9 A;  4A3K K;  4BY1 C;  3HOW K;  2A6H A;  4C2M K;  1EK8 A;  4C3I K;  1USM A;  5C4J K;  1PJ7 A;  3GTQ K;  1UV7 A;  4AH6 A;  1IW7 A;  3BP8 C;  1XXB A;  3FOF A;  2PA8 L;  1F7V A;  5HL8 A;  4P9S A;  2NVQ C;  2KWA A;  3HOX C;  2KXY A;  1TWC K;  3M4O C;  4KMA A;  3S15 K;  2XCO A;  1WOO A;  3T02 A;  3AD9 C;  1TWF K;  3HKZ D;  1I3Q C;  1JOE A;  5IOR A;  3N0C A;  2JA7 C;  4LR2 A;  3S1N C;  3IPJ A;  4DDQ A;  1WQH A;  1WOP A;  5TMF A;  4GT9 A;  4ZH4 A;  3H0G A;  5CJ9 A;  4G0W A;  4OIP A;  2O5I A;  4QIW L;  4MEX A;  2YU9 C;  4KAT A;  3GTJ C;  1TWA K;  3L4K A;  3HOW C;  4IO9 S;  3HOU K;  1BS2 A;  3QX3 A;  2R7Z C;  1F7U A;  5L46 A;  1O27 A;  2WAQ L;  1O26 A;  4A3B C;  4BBR K;  4KN7 A;  4ILD A;  2WB1 L;  2PA8 D;  2V6U A;  2V6T A;  1TWH A;  3EQL A; 
#chains in the Genus database with same CATH homology
 5D4D A;  4A3F K;  3DXJ A;  2JA6 K;  3I4N K;  2NVY C;  4A3M K;  3S14 C;  1I6H C;  5IP7 K;  1BDF A;  5IYD C;  4OIN A;  2R92 K;  3RZO K;  4YG2 A;  4OIO A;  3I4M C;  3S17 C;  3S2D C;  1Y1V K;  3H3V L;  2Y0S D;  2PMZ L;  2NVQ K;  4AYB D;  4YFX A;  2E2J C;  3HOX K;  4MQ9 A;  3PO2 C;  3GTG C;  3M4O K;  1WCM C;  3HOV C;  4XLP A;  4A3K C;  4A93 C;  1TWG K;  3GTO C;  3HKZ L;  5C44 K;  4A3G C;  2VUM K;  4C2M C;  1I3Q K;  4A3D C;  1TWA C;  4C3I C;  4QJV B;  4BY7 K;  1TWH C;  3S16 C;  4QIW D;  5C4J C;  3GTQ C;  5M5Y K;  5FJ8 K;  3S1R K;  1SFO K;  3S1N K;  2NVT C;  3HOY K;  1YNN A;  2E2I C;  4A3E C;  3HOZ C;  4C3H K;  5M5X K;  5FLM C;  4YFN A;  4G7H A;  4KN4 A;  3K7A K;  5M3M K;  1HQM A;  5IYC C;  1K83 C;  1SMY A;  4A3I C;  2JA5 C;  1TWC C;  2YU9 K;  3GTJ K;  3S15 C;  4Y52 C;  4JK1 A;  4BBR C;  2WAQ D;  3RZD K;  1TWF C;  1R9T C;  3CQZ K;  5M3F K;  2WB1 D;  4A3J C;  2R7Z K;  4QJV A;  3I4N C;  4X6A K;  2B63 K;  5IP7 C;  5IP9 K;  3RZO C;  4XLN A;  4Y7N K;  1Y1V C;  4A3B K;  2PPB A;  4KMU A;  4C3J C;  2CW0 A;  4BXX K;  3H3V D;  5C3E C;  3PO3 C;  2PMZ D;  4GZY A;  2JA7 K;  2R93 K;  2NVY K;  3FKI C;  3S1M C;  4G7Z A;  3HOU C;  4LK0 A;  2O5J A;  2Y0S L;  4A3L K;  5IYB K;  5IYD K;  4LK1 A;  4BY7 C;  3S2D K;  3S17 K;  1XPP A;  2E2H K;  1SFO C;  1Y1W C;  3S1R C;  3S1Q C;  5M5W K;  2E2J K;  3HOY C;  4LLG A;  4OIQ A;  3PO2 K;  4C3H C;  3GTG K;  4OIR A;  3HOV K;  4A3K K;  5C4X K;  4A93 K;  3GTO K;  3S2H K;  4BY1 C;  3HOW K;  4XSX A;  2A6H A;  3GTP C;  4Q4Z A;  4C2M K;  2A6E A;  4BBS C;  2JA8 K;  4A3C K;  4C3I K;  1TWH K;  4A3F C;  2JA6 C;  5C4J K;  3GTQ K;  4A3M C;  3RZD C;  2NVT K;  1IW7 A;  3GTM K;  1YNJ A;  5TMC A;  2E2I K;  2R92 C;  2PA8 L;  3HOZ K;  5FLM K;  1I50 K;  2NVQ C;  4X6A C;  1ZYR A;  3HOX C;  3H0G K;  5IYC K;  3GTL K;  3M3Y K;  2NVX K;  1TWC K;  3M4O C;  3GTK K;  3S15 K;  1TWG C;  1I6V A;  2BE5 A;  5C44 C;  2VUM C;  1TWF K;  1R9T K;  3S14 K;  3HKZ D;  1I3Q C;  4Q5S A;  3WOD A;  1I6H K;  4AYB L;  2JA7 C;  3I4M K;  2R93 C;  3S1N C;  4MEY A;  2A69 A;  5TMF A;  4G7O A;  4A3L C;  4ZH4 A;  5IYB C;  1WCM K;  3K7A C;  2E2H C;  4OIP A;  2O5I A;  4C3J K;  4A3G K;  4QIW L;  4MEX A;  2A68 A;  4NOI A;  3GTJ C;  2YU9 C;  5C3E K;  3PO3 K;  1TWA K;  4A3D K;  5C4X C;  3S2H C;  3S16 K;  4XSZ A;  3HOW C;  3FKI K;  3S1M K;  3CQZ C;  3HOU K;  4A3C C;  2JA8 C;  4A3E K;  2R7Z C;  1Y1W K;  3S1Q K;  2B63 C;  1K83 K;  3GTM C;  4A3I K;  2WAQ L;  2JA5 K;  5IP9 C;  4Y7N C;  1I50 C;  4A3B C;  4Y52 K;  4BBR K;  4KN7 A;  4BY1 K;  2WB1 L;  2PA8 D;  3H0G C;  4BXX C;  3GTL C;  3GTP K;  3M3Y C;  4YFK A;  2NVX C;  3GTK C;  4BBS K;  4A3J K;  3EQL A;  4LJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...