1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
3S1QC 2Y0SD 3HOVC 4YFKA 2R93K 3S2HC 2E2IK 1TWGK 1Y1VK 1TWAK 1HQMA 2NVQC 4Y7NK 2A6HA 1I50K 4A3GK 3HOYC 3GTPC 1IW7A 4A3IC 4BBRK 2PA8D 3HOUC 1I6HC 1K83K 3GTGK 4XLNA 4C2MK 4G7OA 4LJZA 2E2HC 2WAQD 4KN7A 5C4JC 4BY7K 4Y52C 3H0GC 4A3MC 5IYCK 3S1MK 3S1RC 3S15K 4BXXK 2A6EA 3RZDC 3HOXK 3H3VL 3GTQK 3S16C 1WCMK 2PMZD 4A3KC 3K7AK 5C44C 3GTJK 5IYDK 1SMYA 3S14K 1I3QC 4X6AK 3HOZC 4A3EC 2R7ZC 2E2JK 3GTLK 4Q4ZA 2JA6C 3PO2K 5FLMC 2JA5C 3I4NC 2NVYK 2R92K 4XSZA 5M3FK 4A3JK 2NVTK 2NVXK 4BY1K 4C3HC 4OIQA 3M4OC 2CW0A 4YG2A 4AYBL 1YNNA 1TWCC 4LK1A 5IP9K 3GTMK 2A68A 4KN4A 2E2IC 2R93C 3S1NK 1TWGC 1TWAC 3HKZD 4Y7NC 1YNJA 4JK1A 1TWHK 4G7ZA 1I50C 4A3GC 3FKIC 3RZOC 3S17K 4GZYA 2YU9K 3WODA 4KMUA 4BBRC 4OINA 3CQZC 2WAQL 3GTGC 4A3CK 4C2MC 1I6VA 5IYBC 3PO3K 2JA7C 3HOWK 3S1QK 5M5XK 4BY7C 5D4DA 4A3LC 5C3EK 2NVQK 3S1MC 1Y1WK 3EQLA 4LLGA 4G7HA 3S15C 4BXXC 3HOXC 4MEXA 2WB1D 1WCMC 4QIWL 5IYDC 3GTJC 3K7AC 2JA8C 4LK0A 3HOUK 4BBSK 5IP7C 3S14C 4A3DK 4X6AC 1R9TK 2Y0SL 5C4XK 1SFOK 3GTLC 3GTOK 5C4JK 3PO2C 2VUMK 2R92C 4C3JK 4A3JC 2PPBA 3S1RK 2NVXC 4BY1C 1Y1VC 4A93C 2O5IA 4C3IK 2PA8L 3S16K 4YFXA 2BE5A 5IP9C 1TWFK 4OIOA 3GTMC 3S2DK 4A3BK 2B63K 5M3MK 5TMCA 3I4MK 3H3VD 2O5JA 4MQ9A 4A3FK 4OIRA 1K83C 2JA6K 3GTKK 4ZH4A 3S17C 4NOIA 2A69A 3M3YK 4Y52K 3HOVK 4A3CC 3S2HK 2PMZL 5IYCC 1TWCK 3HOWC 3HOYK 4XLPA 3GTPK 3GTQC 2WB1L 4OIPA 4A3IK 4AYBD 5C3EC 1Y1WC 1I6HK 4XSXA 3FKIK 3RZOK 2E2JC 1ZYRA 2E2HK 4A93K 4BBSC 3CQZK 5TMFA 4MEYA 1BDFA 4Q5SA 2NVYC 4A3DC 1R9TC 3GTOC 5C4XC 1SFOC 3H0GK 5M5YK 5IYBK 4A3MK 2NVTC 2JA7K 3RZDK 3HKZL 2VUMC 4A3KK 4A3LK 4C3JC 5C44K 3DXJA 4YFNA 3S1NC 4QJVA 1I3QK 1XPPA 5M5WK 4C3IC 4QJVB 4A3EK 3HOZK 1TWHC 2JA8K 2R7ZK 1TWFC 3S2DC 4A3BC 5IP7K 5FLMK 2B63C 2YU9C 3I4MC 2JA5K 3I4NK 5FJ8K 4A3FC 4QIWD 4C3HK 3GTKC 3M4OK 3PO3C 3M3YC
chains in the Genus database with same CATH superfamily
1B4AA 2ZUEA 4BLAA 3TTGA 2E2IK 1TWGK 1HQMA 3GTJA 1J98A 3GTPC 1IW7A 1O24A 3LYWA 4BBRK 3GTLA 3HOUC 3GTGK 5CJ9A 1USOA 1IE0A 2WAQD 4XCHA 3S15K 2A6EA 4LOWA 3HOXK 5C44C 1O2AA 5DM7S 4KDDA 1F9NA 5HQHA 1XXCA 1WOSA 3AD7C 2R7ZC 3BP8C 2R92K 2NVYK 4XSZA 5HL8A 4LR2A 4A3JK 4BY1K 4A93K 4C3HC 3GTQA 3FHZA 4AH6A 3AD9C 1EQRA 3S1NK 3TFHA 4G7ZA 1WSVA 3S17K 3GTOA 2YU9K 1IQ0A 3GIRA 2WAQL 4C2MC 1BGWA 5IYBC 4IO9S 3S1QK 5D4DA 1TWHA 3S1MC 2D6FC 3ADAC 3N0CA 4G7HA 1AB4A 2EBBA 3K7AC 4BBSK 4P5AA 1B4BA 5C4XK 2L3UA 2VUMK 1INNA 3S1RK 3GTPA 2NVXC 1PJ6A 2O5IA 1JVIA 3MMLB 3S16K 2PHCB 4OIOA 3DLLS 3GTMC 3T01A 2V6SA 2JA6K 3N0BA 4BKWA 3HOVK 3S2HK 5IYCC 1TWFA 2RH6A 1DCPA 2R7ZA 1Y1WC 2CFAA 4XSXA 3FKIK 2V6UA 1JOEA 1ZYRA 2E2HK 3CQZK 1R9TC 1SFOC 4PAAA 3V4GA 1VH2A 4A3LK 4GFQA 3LAJA 1WQHA 4KM8A 3PIPS 1I3QK 3HOZK 2ZFZA 3GEEA 5CHPA 3S2DC 1ZVUA 3H0GA 3BP3A 2B63C 3I4MC 4A3FC 3VA7A 5TJ3A 3GTKC 3M4OK 3PO3C 3T00A 4YFKA 2R93K 4U67S 1TWAK 2NVQC 4GTBA 2A6HA 1I50K 4A3GK 2JA5A 3HOYC 4FM9A 1I6HC 4G7OA 1WQGA 2NVXA 3GEHA 4BY7K 1DCHA 5IOQA 3G4AA 2GAHC 4BXXK 5DM6S 3H3VL 4WFBS 1IBAA 3GTQK 1WCMK 4A3KC 3GEIA 3S14K 5EGEA 1XZPA 4X6AK 4J3NA 4Q4ZA 3PO2K 5FLMC 4OIQA 1WORA 4DDQA 1Y1WA 5IP9K 2E2IC 1TWGC 4WFAS 1O26A 1TWHK 4KARA 3RZOC 3G4CA 1R9TA 4GZYA 1SFOA 3WODA 4KMUA 4BBRC 1O29A 4G0WA 3GTGC 3SZYA 1I6VA 2JH3A 5M5XK 5EGHA 5C3EK 1WOPA 3AD8C 3EQLA 4LLGA 3S15C 3HXAA 4KMAA 3FOFA 3HOXC 2B63A 2WB1D 4QIWL 3HOUK 2CFAB 1O27A 2GSUA 2Y3PA 2R92C 4KM9A 4C3JK 2V6TA 4A3JC 1O2BA 2PPBA 4BY1C 4A93C 1Y1VC 4C3IK 3CAGA 2BE5A 1TWFK 4A3BK 1O2FB 4MQ9A 1ZQ1C 4M1XA 4OIRA 1K83C 3S17C 4WILA 3M3YK 4WFNS 3QX3A 1DCOA 4KATA 2GSNA 3TFJA 1XZQA 2WB1L 4OIPA 4A3IK 4AYBD 1IS1A 2E2JC 3N3YA 3ERED 4BBSC 4MEYA 4Y52K 3H0GK 5IYBK 5C4XC 4A3MK 2NVTC 2E2IA 3RZDK 1GE9A 2VUMC 3L4KA 2KWAA 1KQ4A 4QJVA 4A3EK 3LPXA 1F7VA 3GTGA 3JSTA 2JA5K 3I4NK 3L4JA 5JVOA 2FQTA 2Y0SD 1J6WA 3HOVC 3SZZA 3S2HC 4C45A 4Y7NK 1EI6A 4KASA 2W7VA 2PA8D 1O25A 2R92A 1ZXOA 2E2HC 4KN7A 5C4JC 1Y1VA 3GDZA 5IOTA 5IYCK 5L46A 1YX2A 4KB2A 2PMZD 5E68A 3TFIA 3GTJK 1K83A 5IYDK 2XCOA 1SMYA 1I3QC 1XXAA 3HOZC 5JVHS 3AQOA 3GTLK 4PABA 5M3FK 3M4OC 2FQOA 1TWCC 4LK1A 2A68A 2R93C 1TWAC 3HKZD 4JK1A 4WCES 4FZBA 1I50C 4A3GC 4P5BA 1F7UA 4GTCA 3CF5S 1L0WA 1BJTA 4OINA 4A3CK 2VUMA 4KMDA 3PO3K 2JA7C 3HOWK 3GTMA 4BY7C 1O28A 1ISEA 2NVQK 4BXXC 1WCMC 2JA8C 4LK0A 5IP7C 3S14C 4A3DK 4X6AC 3GTOK 4KAWX 1VJEA 3PO2C 5IORA 1DD5A 2P8TA 4YFXA 5IP9C 5M3MK 5TMCA 2O5JA 2E2HA 4ZH4A 4BLBA 2A69A 2XCQA 1RU0A 3OPFA 5JVGS 4KMHA 1I3QA 3GTPK 3S0XA 5C3EC 1PJ7A 4GTFA 3GTKA 3RZOK 3NUHA 4GTDA 1BDFA 2NVYC 1TWCA 5JFEA 2R93A 1X31C 1TWAA 2KPUA 4C3JC 1JQWA 2GAGC 5C44K 1I50A 4YFNA 3S1NC 4C3IC 2R7ZK 1TWFC 4A3BC 2YU9C 2JA7A 4GTLA 4C3HK 1USMA 4O2DA 3M3YC 3S1QC 3A8IA 2XCRB 1WIHA 1Y1VK 1WCMA 2KXYA 1V5VA 4A3IC 1F93A 1K83K 4XLNA 2GSOA 4C2MK 4LJZA 2ZJQS 1TWGA 4Y52C 1HI9A 1PJ5A 3H0GC 4A3MC 3S1MK 3S1RC 1EFWA 3RZDC 3S16C 3AH5A 3BUEA 3K7AK 2E2JK 4A3EC 1XZPB 2JA6C 3Q3QA 2JA5C 3I4NC 2NVTK 1VLOA 4P9SA 2NVXK 4AYBL 2CW0A 4YG2A 1YNNA 2ZJPS 1EH1A 3OREA 3GTMK 1XXBA 1BS2A 4KN4A 1YCLA 3A8KA 2L5NA 3IPJA 4LQYA 4Y7NC 1YNJA 4IOAS 3FKIC 1UV7A 2NVYA 1VGXA 3CQZC 1FEUA 1WSRA 3FOEA 1G51A 1WQFA 4A3LC 1Y1WK 2RGRA 3PIOS 2YU9A 4MEXA 5IYDC 3GTJC 4G0UA 4WF9S 1C0AA 4WJ4A 1IL2A 1R9TK 2Y0SL 1SFOK 3GTLC 5IOSA 5C4JK 2PA8L 3S2DK 4ILDA 2B63K 3I4MK 3H3VD 1J6VA 4A3FK 4GTAA 3GTKK 4NOIA 5HL7S 4A3CC 2PMZL 1TWCK 3HOWC 3A8JA 1XZQB 2ZJRS 4WJ3M 3HOYK 4RMFA 4XLPA 3GTQC 4KC6A 2JA6A 4GT9A 1I6HK 1WOOA 3T02A 1VRQC 1ZBSA 3LAPA 5TMFA 4Q5SA 4KB4A 2ZUFA 2KQ1A 4A3DC 3GTOC 1J6XA 3AQPA 4GTEA 2JA7K 5M5YK 3HKZL 1EK8A 4A3KK 3FKIA 3GSIA 3DXJA 1XPPA 5M5WK 3OEPA 4QJVB 1TWHC 3CQZA 2JA8K 5FLMK 4IOCS 5IP7K 5FJ8K 2P5MA 4QIWD 4G0VA
chains in the Genus database with same CATH topology
3S1QC 2Y0SD 3HOVC 4YFKA 2R93K 3S2HC 2E2IK 1TWGK 1Y1VK 1TWAK 1HQMA 2NVQC 4Y7NK 2A6HA 1I50K 4A3GK 3HOYC 3GTPC 1IW7A 4A3IC 4BBRK 2PA8D 3HOUC 1I6HC 1K83K 3GTGK 4XLNA 4C2MK 4G7OA 4LJZA 2E2HC 2WAQD 4KN7A 5C4JC 4BY7K 4Y52C 3H0GC 4A3MC 5IYCK 3S1MK 3S1RC 3S15K 4BXXK 2A6EA 3RZDC 3HOXK 3H3VL 3GTQK 3S16C 1WCMK 2PMZD 4A3KC 3K7AK 5C44C 3GTJK 5IYDK 1SMYA 3S14K 1I3QC 4X6AK 3HOZC 4A3EC 2R7ZC 2E2JK 3GTLK 4Q4ZA 2JA6C 3PO2K 5FLMC 2JA5C 3I4NC 2NVYK 2R92K 4XSZA 5M3FK 4A3JK 2NVTK 2NVXK 4BY1K 4C3HC 4OIQA 3M4OC 2CW0A 4YG2A 4AYBL 1YNNA 1TWCC 4LK1A 5IP9K 3GTMK 2A68A 4KN4A 2E2IC 2R93C 3S1NK 1TWGC 1TWAC 3HKZD 4Y7NC 1YNJA 4JK1A 1TWHK 4G7ZA 1I50C 4A3GC 3FKIC 3RZOC 3S17K 4GZYA 2YU9K 3WODA 4KMUA 4BBRC 4OINA 3CQZC 2WAQL 3GTGC 4A3CK 4C2MC 1I6VA 5IYBC 3PO3K 2JA7C 3HOWK 3S1QK 5M5XK 4BY7C 5D4DA 4A3LC 5C3EK 2NVQK 3S1MC 1Y1WK 3EQLA 4LLGA 4G7HA 3S15C 4BXXC 3HOXC 4MEXA 2WB1D 1WCMC 4QIWL 5IYDC 3GTJC 3K7AC 2JA8C 4LK0A 3HOUK 4BBSK 5IP7C 3S14C 4A3DK 4X6AC 1R9TK 2Y0SL 5C4XK 1SFOK 3GTLC 3GTOK 5C4JK 3PO2C 2VUMK 2R92C 4C3JK 4A3JC 2PPBA 3S1RK 2NVXC 4BY1C 1Y1VC 4A93C 2O5IA 4C3IK 2PA8L 3S16K 4YFXA 2BE5A 5IP9C 1TWFK 4OIOA 3GTMC 3S2DK 4A3BK 2B63K 5M3MK 5TMCA 3I4MK 3H3VD 2O5JA 4MQ9A 4A3FK 4OIRA 1K83C 2JA6K 3GTKK 4ZH4A 3S17C 4NOIA 2A69A 3M3YK 4Y52K 3HOVK 4A3CC 3S2HK 2PMZL 5IYCC 1TWCK 3HOWC 3HOYK 4XLPA 3GTPK 3GTQC 2WB1L 4OIPA 4A3IK 4AYBD 5C3EC 1Y1WC 1I6HK 4XSXA 3FKIK 3RZOK 2E2JC 1ZYRA 2E2HK 4A93K 4BBSC 3CQZK 5TMFA 4MEYA 1BDFA 4Q5SA 2NVYC 4A3DC 1R9TC 3GTOC 5C4XC 1SFOC 3H0GK 5M5YK 5IYBK 4A3MK 2NVTC 2JA7K 3RZDK 3HKZL 2VUMC 4A3KK 4A3LK 4C3JC 5C44K 3DXJA 4YFNA 3S1NC 4QJVA 1I3QK 1XPPA 5M5WK 4C3IC 4QJVB 4A3EK 3HOZK 1TWHC 2JA8K 2R7ZK 1TWFC 3S2DC 4A3BC 5IP7K 5FLMK 2B63C 2YU9C 3I4MC 2JA5K 3I4NK 5FJ8K 4A3FC 4QIWD 4C3HK 3GTKC 3M4OK 3PO3C 3M3YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1Q C;  2Y0S D;  3HOV C;  4YFK A;  2R93 K;  3S2H C;  2E2I K;  1TWG K;  1Y1V K;  1TWA K;  1HQM A;  2NVQ C;  4Y7N K;  2A6H A;  1I50 K;  4A3G K;  3HOY C;  3GTP C;  1IW7 A;  4A3I C;  4BBR K;  2PA8 D;  3HOU C;  1I6H C;  1K83 K;  3GTG K;  4XLN A;  4C2M K;  4G7O A;  4LJZ A;  2E2H C;  2WAQ D;  4KN7 A;  5C4J C;  4BY7 K;  4Y52 C;  3H0G C;  4A3M C;  5IYC K;  3S1M K;  3S1R C;  3S15 K;  4BXX K;  2A6E A;  3RZD C;  3HOX K;  3H3V L;  3GTQ K;  3S16 C;  1WCM K;  2PMZ D;  4A3K C;  3K7A K;  5C44 C;  3GTJ K;  5IYD K;  1SMY A;  3S14 K;  1I3Q C;  4X6A K;  3HOZ C;  4A3E C;  2R7Z C;  2E2J K;  3GTL K;  4Q4Z A;  2JA6 C;  3PO2 K;  5FLM C;  2JA5 C;  3I4N C;  2NVY K;  2R92 K;  4XSZ A;  5M3F K;  4A3J K;  2NVT K;  2NVX K;  4BY1 K;  4C3H C;  4OIQ A;  3M4O C;  2CW0 A;  4YG2 A;  4AYB L;  1YNN A;  1TWC C;  4LK1 A;  5IP9 K;  3GTM K;  2A68 A;  4KN4 A;  2E2I C;  2R93 C;  3S1N K;  1TWG C;  1TWA C;  3HKZ D;  4Y7N C;  1YNJ A;  4JK1 A;  1TWH K;  4G7Z A;  1I50 C;  4A3G C;  3FKI C;  3RZO C;  3S17 K;  4GZY A;  2YU9 K;  3WOD A;  4KMU A;  4BBR C;  4OIN A;  3CQZ C;  2WAQ L;  3GTG C;  4A3C K;  4C2M C;  1I6V A;  5IYB C;  3PO3 K;  2JA7 C;  3HOW K;  3S1Q K;  5M5X K;  4BY7 C;  5D4D A;  4A3L C;  5C3E K;  2NVQ K;  3S1M C;  1Y1W K;  3EQL A;  4LLG A;  4G7H A;  3S15 C;  4BXX C;  3HOX C;  4MEX A;  2WB1 D;  1WCM C;  4QIW L;  5IYD C;  3GTJ C;  3K7A C;  2JA8 C;  4LK0 A;  3HOU K;  4BBS K;  5IP7 C;  3S14 C;  4A3D K;  4X6A C;  1R9T K;  2Y0S L;  5C4X K;  1SFO K;  3GTL C;  3GTO K;  5C4J K;  3PO2 C;  2VUM K;  2R92 C;  4C3J K;  4A3J C;  2PPB A;  3S1R K;  2NVX C;  4BY1 C;  1Y1V C;  4A93 C;  2O5I A;  4C3I K;  2PA8 L;  3S16 K;  4YFX A;  2BE5 A;  5IP9 C;  1TWF K;  4OIO A;  3GTM C;  3S2D K;  4A3B K;  2B63 K;  5M3M K;  5TMC A;  3I4M K;  3H3V D;  2O5J A;  4MQ9 A;  4A3F K;  4OIR A;  1K83 C;  2JA6 K;  3GTK K;  4ZH4 A;  3S17 C;  4NOI A;  2A69 A;  3M3Y K;  4Y52 K;  3HOV K;  4A3C C;  3S2H K;  2PMZ L;  5IYC C;  1TWC K;  3HOW C;  3HOY K;  4XLP A;  3GTP K;  3GTQ C;  2WB1 L;  4OIP A;  4A3I K;  4AYB D;  5C3E C;  1Y1W C;  1I6H K;  4XSX A;  3FKI K;  3RZO K;  2E2J C;  1ZYR A;  2E2H K;  4A93 K;  4BBS C;  3CQZ K;  5TMF A;  4MEY A;  1BDF A;  4Q5S A;  2NVY C;  4A3D C;  1R9T C;  3GTO C;  5C4X C;  1SFO C;  3H0G K;  5M5Y K;  5IYB K;  4A3M K;  2NVT C;  2JA7 K;  3RZD K;  3HKZ L;  2VUM C;  4A3K K;  4A3L K;  4C3J C;  5C44 K;  3DXJ A;  4YFN A;  3S1N C;  4QJV A;  1I3Q K;  1XPP A;  5M5W K;  4C3I C;  4QJV B;  4A3E K;  3HOZ K;  1TWH C;  2JA8 K;  2R7Z K;  1TWF C;  3S2D C;  4A3B C;  5IP7 K;  5FLM K;  2B63 C;  2YU9 C;  3I4M C;  2JA5 K;  3I4N K;  5FJ8 K;  4A3F C;  4QIW D;  4C3H K;  3GTK C;  3M4O K;  3PO3 C;  3M3Y C; 
#chains in the Genus database with same CATH topology
 1B4A A;  2ZUE A;  4BLA A;  3TTG A;  2E2I K;  1TWG K;  1HQM A;  3GTJ A;  1J98 A;  3GTP C;  1IW7 A;  1O24 A;  3LYW A;  4BBR K;  3GTL A;  3HOU C;  3GTG K;  5CJ9 A;  1USO A;  1IE0 A;  2WAQ D;  4XCH A;  3S15 K;  2A6E A;  4LOW A;  3HOX K;  5C44 C;  1O2A A;  5DM7 S;  4KDD A;  1F9N A;  5HQH A;  1XXC A;  1WOS A;  3AD7 C;  2R7Z C;  3BP8 C;  2R92 K;  2NVY K;  4XSZ A;  5HL8 A;  4LR2 A;  4A3J K;  4BY1 K;  4A93 K;  4C3H C;  3GTQ A;  3FHZ A;  4AH6 A;  3AD9 C;  1EQR A;  3S1N K;  3TFH A;  4G7Z A;  1WSV A;  3S17 K;  3GTO A;  2YU9 K;  1IQ0 A;  3GIR A;  2WAQ L;  4C2M C;  1BGW A;  5IYB C;  4IO9 S;  3S1Q K;  5D4D A;  1TWH A;  3S1M C;  2D6F C;  3ADA C;  3N0C A;  4G7H A;  1AB4 A;  2EBB A;  3K7A C;  4BBS K;  4P5A A;  1B4B A;  5C4X K;  2L3U A;  2VUM K;  1INN A;  3S1R K;  3GTP A;  2NVX C;  1PJ6 A;  2O5I A;  1JVI A;  3MML B;  3S16 K;  2PHC B;  4OIO A;  3DLL S;  3GTM C;  3T01 A;  2V6S A;  2JA6 K;  3N0B A;  4BKW A;  3HOV K;  3S2H K;  5IYC C;  1TWF A;  2RH6 A;  1DCP A;  2R7Z A;  1Y1W C;  2CFA A;  4XSX A;  3FKI K;  2V6U A;  1JOE A;  1ZYR A;  2E2H K;  3CQZ K;  1R9T C;  1SFO C;  4PAA A;  3V4G A;  1VH2 A;  4A3L K;  4GFQ A;  3LAJ A;  1WQH A;  4KM8 A;  3PIP S;  1I3Q K;  3HOZ K;  2ZFZ A;  3GEE A;  5CHP A;  3S2D C;  1ZVU A;  3H0G A;  3BP3 A;  2B63 C;  3I4M C;  4A3F C;  3VA7 A;  5TJ3 A;  3GTK C;  3M4O K;  3PO3 C;  3T00 A;  4YFK A;  2R93 K;  4U67 S;  1TWA K;  2NVQ C;  4GTB A;  2A6H A;  1I50 K;  4A3G K;  2JA5 A;  3HOY C;  4FM9 A;  1I6H C;  4G7O A;  1WQG A;  2NVX A;  3GEH A;  4BY7 K;  1DCH A;  5IOQ A;  3G4A A;  2GAH C;  4BXX K;  5DM6 S;  3H3V L;  4WFB S;  1IBA A;  3GTQ K;  1WCM K;  4A3K C;  3GEI A;  3S14 K;  5EGE A;  1XZP A;  4X6A K;  4J3N A;  4Q4Z A;  3PO2 K;  5FLM C;  4OIQ A;  1WOR A;  4DDQ A;  1Y1W A;  5IP9 K;  2E2I C;  1TWG C;  4WFA S;  1O26 A;  1TWH K;  4KAR A;  3RZO C;  3G4C A;  1R9T A;  4GZY A;  1SFO A;  3WOD A;  4KMU A;  4BBR C;  1O29 A;  4G0W A;  3GTG C;  3SZY A;  1I6V A;  2JH3 A;  5M5X K;  5EGH A;  5C3E K;  1WOP A;  3AD8 C;  3EQL A;  4LLG A;  3S15 C;  3HXA A;  4KMA A;  3FOF A;  3HOX C;  2B63 A;  2WB1 D;  4QIW L;  3HOU K;  2CFA B;  1O27 A;  2GSU A;  2Y3P A;  2R92 C;  4KM9 A;  4C3J K;  2V6T A;  4A3J C;  1O2B A;  2PPB A;  4BY1 C;  4A93 C;  1Y1V C;  4C3I K;  3CAG A;  2BE5 A;  1TWF K;  4A3B K;  1O2F B;  4MQ9 A;  1ZQ1 C;  4M1X A;  4OIR A;  1K83 C;  3S17 C;  4WIL A;  3M3Y K;  4WFN S;  3QX3 A;  1DCO A;  4KAT A;  2GSN A;  3TFJ A;  1XZQ A;  2WB1 L;  4OIP A;  4A3I K;  4AYB D;  1IS1 A;  2E2J C;  3N3Y A;  3ERE D;  4BBS C;  4MEY A;  4Y52 K;  3H0G K;  5IYB K;  5C4X C;  4A3M K;  2NVT C;  2E2I A;  3RZD K;  1GE9 A;  2VUM C;  3L4K A;  2KWA A;  1KQ4 A;  4QJV A;  4A3E K;  3LPX A;  1F7V A;  3GTG A;  3JST A;  2JA5 K;  3I4N K;  3L4J A;  5JVO A;  2FQT A;  2Y0S D;  1J6W A;  3HOV C;  3SZZ A;  3S2H C;  4C45 A;  4Y7N K;  1EI6 A;  4KAS A;  2W7V A;  2PA8 D;  1O25 A;  2R92 A;  1ZXO A;  2E2H C;  4KN7 A;  5C4J C;  1Y1V A;  3GDZ A;  5IOT A;  5IYC K;  5L46 A;  1YX2 A;  4KB2 A;  2PMZ D;  5E68 A;  3TFI A;  3GTJ K;  1K83 A;  5IYD K;  2XCO A;  1SMY A;  1I3Q C;  1XXA A;  3HOZ C;  5JVH S;  3AQO A;  3GTL K;  4PAB A;  5M3F K;  3M4O C;  2FQO A;  1TWC C;  4LK1 A;  2A68 A;  2R93 C;  1TWA C;  3HKZ D;  4JK1 A;  4WCE S;  4FZB A;  1I50 C;  4A3G C;  4P5B A;  1F7U A;  4GTC A;  3CF5 S;  1L0W A;  1BJT A;  4OIN A;  4A3C K;  2VUM A;  4KMD A;  3PO3 K;  2JA7 C;  3HOW K;  3GTM A;  4BY7 C;  1O28 A;  1ISE A;  2NVQ K;  4BXX C;  1WCM C;  2JA8 C;  4LK0 A;  5IP7 C;  3S14 C;  4A3D K;  4X6A C;  3GTO K;  4KAW X;  1VJE A;  3PO2 C;  5IOR A;  1DD5 A;  2P8T A;  4YFX A;  5IP9 C;  5M3M K;  5TMC A;  2O5J A;  2E2H A;  4ZH4 A;  4BLB A;  2A69 A;  2XCQ A;  1RU0 A;  3OPF A;  5JVG S;  4KMH A;  1I3Q A;  3GTP K;  3S0X A;  5C3E C;  1PJ7 A;  4GTF A;  3GTK A;  3RZO K;  3NUH A;  4GTD A;  1BDF A;  2NVY C;  1TWC A;  5JFE A;  2R93 A;  1X31 C;  1TWA A;  2KPU A;  4C3J C;  1JQW A;  2GAG C;  5C44 K;  1I50 A;  4YFN A;  3S1N C;  4C3I C;  2R7Z K;  1TWF C;  4A3B C;  2YU9 C;  2JA7 A;  4GTL A;  4C3H K;  1USM A;  4O2D A;  3M3Y C;  3S1Q C;  3A8I A;  2XCR B;  1WIH A;  1Y1V K;  1WCM A;  2KXY A;  1V5V A;  4A3I C;  1F93 A;  1K83 K;  4XLN A;  2GSO A;  4C2M K;  4LJZ A;  2ZJQ S;  1TWG A;  4Y52 C;  1HI9 A;  1PJ5 A;  3H0G C;  4A3M C;  3S1M K;  3S1R C;  1EFW A;  3RZD C;  3S16 C;  3AH5 A;  3BUE A;  3K7A K;  2E2J K;  4A3E C;  1XZP B;  2JA6 C;  3Q3Q A;  2JA5 C;  3I4N C;  2NVT K;  1VLO A;  4P9S A;  2NVX K;  4AYB L;  2CW0 A;  4YG2 A;  1YNN A;  2ZJP S;  1EH1 A;  3ORE A;  3GTM K;  1XXB A;  1BS2 A;  4KN4 A;  1YCL A;  3A8K A;  2L5N A;  3IPJ A;  4LQY A;  4Y7N C;  1YNJ A;  4IOA S;  3FKI C;  1UV7 A;  2NVY A;  1VGX A;  3CQZ C;  1FEU A;  1WSR A;  3FOE A;  1G51 A;  1WQF A;  4A3L C;  1Y1W K;  2RGR A;  3PIO S;  2YU9 A;  4MEX A;  5IYD C;  3GTJ C;  4G0U A;  4WF9 S;  1C0A A;  4WJ4 A;  1IL2 A;  1R9T K;  2Y0S L;  1SFO K;  3GTL C;  5IOS A;  5C4J K;  2PA8 L;  3S2D K;  4ILD A;  2B63 K;  3I4M K;  3H3V D;  1J6V A;  4A3F K;  4GTA A;  3GTK K;  4NOI A;  5HL7 S;  4A3C C;  2PMZ L;  1TWC K;  3HOW C;  3A8J A;  1XZQ B;  2ZJR S;  4WJ3 M;  3HOY K;  4RMF A;  4XLP A;  3GTQ C;  4KC6 A;  2JA6 A;  4GT9 A;  1I6H K;  1WOO A;  3T02 A;  1VRQ C;  1ZBS A;  3LAP A;  5TMF A;  4Q5S A;  4KB4 A;  2ZUF A;  2KQ1 A;  4A3D C;  3GTO C;  1J6X A;  3AQP A;  4GTE A;  2JA7 K;  5M5Y K;  3HKZ L;  1EK8 A;  4A3K K;  3FKI A;  3GSI A;  3DXJ A;  1XPP A;  5M5W K;  3OEP A;  4QJV B;  1TWH C;  3CQZ A;  2JA8 K;  5FLM K;  4IOC S;  5IP7 K;  5FJ8 K;  2P5M A;  4QIW D;  4G0V A; 
#chains in the Genus database with same CATH homology
 3S1Q C;  2Y0S D;  3HOV C;  4YFK A;  2R93 K;  3S2H C;  2E2I K;  1TWG K;  1Y1V K;  1TWA K;  1HQM A;  2NVQ C;  4Y7N K;  2A6H A;  1I50 K;  4A3G K;  3HOY C;  3GTP C;  1IW7 A;  4A3I C;  4BBR K;  2PA8 D;  3HOU C;  1I6H C;  1K83 K;  3GTG K;  4XLN A;  4C2M K;  4G7O A;  4LJZ A;  2E2H C;  2WAQ D;  4KN7 A;  5C4J C;  4BY7 K;  4Y52 C;  3H0G C;  4A3M C;  5IYC K;  3S1M K;  3S1R C;  3S15 K;  4BXX K;  2A6E A;  3RZD C;  3HOX K;  3H3V L;  3GTQ K;  3S16 C;  1WCM K;  2PMZ D;  4A3K C;  3K7A K;  5C44 C;  3GTJ K;  5IYD K;  1SMY A;  3S14 K;  1I3Q C;  4X6A K;  3HOZ C;  4A3E C;  2R7Z C;  2E2J K;  3GTL K;  4Q4Z A;  2JA6 C;  3PO2 K;  5FLM C;  2JA5 C;  3I4N C;  2NVY K;  2R92 K;  4XSZ A;  5M3F K;  4A3J K;  2NVT K;  2NVX K;  4BY1 K;  4C3H C;  4OIQ A;  3M4O C;  2CW0 A;  4YG2 A;  4AYB L;  1YNN A;  1TWC C;  4LK1 A;  5IP9 K;  3GTM K;  2A68 A;  4KN4 A;  2E2I C;  2R93 C;  3S1N K;  1TWG C;  1TWA C;  3HKZ D;  4Y7N C;  1YNJ A;  4JK1 A;  1TWH K;  4G7Z A;  1I50 C;  4A3G C;  3FKI C;  3RZO C;  3S17 K;  4GZY A;  2YU9 K;  3WOD A;  4KMU A;  4BBR C;  4OIN A;  3CQZ C;  2WAQ L;  3GTG C;  4A3C K;  4C2M C;  1I6V A;  5IYB C;  3PO3 K;  2JA7 C;  3HOW K;  3S1Q K;  5M5X K;  4BY7 C;  5D4D A;  4A3L C;  5C3E K;  2NVQ K;  3S1M C;  1Y1W K;  3EQL A;  4LLG A;  4G7H A;  3S15 C;  4BXX C;  3HOX C;  4MEX A;  2WB1 D;  1WCM C;  4QIW L;  5IYD C;  3GTJ C;  3K7A C;  2JA8 C;  4LK0 A;  3HOU K;  4BBS K;  5IP7 C;  3S14 C;  4A3D K;  4X6A C;  1R9T K;  2Y0S L;  5C4X K;  1SFO K;  3GTL C;  3GTO K;  5C4J K;  3PO2 C;  2VUM K;  2R92 C;  4C3J K;  4A3J C;  2PPB A;  3S1R K;  2NVX C;  4BY1 C;  1Y1V C;  4A93 C;  2O5I A;  4C3I K;  2PA8 L;  3S16 K;  4YFX A;  2BE5 A;  5IP9 C;  1TWF K;  4OIO A;  3GTM C;  3S2D K;  4A3B K;  2B63 K;  5M3M K;  5TMC A;  3I4M K;  3H3V D;  2O5J A;  4MQ9 A;  4A3F K;  4OIR A;  1K83 C;  2JA6 K;  3GTK K;  4ZH4 A;  3S17 C;  4NOI A;  2A69 A;  3M3Y K;  4Y52 K;  3HOV K;  4A3C C;  3S2H K;  2PMZ L;  5IYC C;  1TWC K;  3HOW C;  3HOY K;  4XLP A;  3GTP K;  3GTQ C;  2WB1 L;  4OIP A;  4A3I K;  4AYB D;  5C3E C;  1Y1W C;  1I6H K;  4XSX A;  3FKI K;  3RZO K;  2E2J C;  1ZYR A;  2E2H K;  4A93 K;  4BBS C;  3CQZ K;  5TMF A;  4MEY A;  1BDF A;  4Q5S A;  2NVY C;  4A3D C;  1R9T C;  3GTO C;  5C4X C;  1SFO C;  3H0G K;  5M5Y K;  5IYB K;  4A3M K;  2NVT C;  2JA7 K;  3RZD K;  3HKZ L;  2VUM C;  4A3K K;  4A3L K;  4C3J C;  5C44 K;  3DXJ A;  4YFN A;  3S1N C;  4QJV A;  1I3Q K;  1XPP A;  5M5W K;  4C3I C;  4QJV B;  4A3E K;  3HOZ K;  1TWH C;  2JA8 K;  2R7Z K;  1TWF C;  3S2D C;  4A3B C;  5IP7 K;  5FLM K;  2B63 C;  2YU9 C;  3I4M C;  2JA5 K;  3I4N K;  5FJ8 K;  4A3F C;  4QIW D;  4C3H K;  3GTK C;  3M4O K;  3PO3 C;  3M3Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...