1I6VA

Thermus aquaticus core rna polymerase-rifampicin complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
224
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism for rifampicin inhibition of bacterial rna polymerase.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE
total genus 33
structure length 224
sequence length 224
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2001-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1i6vA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1i6vA01
4OIQA 3M3YK 2R93K 1TWAC 2JA5C 1I50K 1TWFK 5IYDC 3S1NC 2VUMC 3CQZC 4BY7K 4A3MK 5C4XC 4C2MK 4OINA 4AYBD 2B63K 2E2IC 1I3QK 4YG2A 4A3BC 2NVTC 2PA8L 5C44C 2A6HA 2YU9K 4A3CK 3S2DK 2Y0SL 1ZYRA 3M3YC 2R93C 3I4NK 3S14K 3HOXK 4C3HK 3S1NK 2Y0SD 3CQZK 3H0GK 5FLMK 1WCMC 1SFOK 5IYBK 2B63C 4XSXA 3HKZD 4A3CC 1TWGK 5C44K 1R9TK 3GTGC 3S2DC 4QIWD 2E2HK 2NVXC 4JK1A 4A3LK 4C3IC 2JA8C 4BBRC 4YFXA 4A3FK 2WAQL 2PA8D 2CW0A 2NVYC 3S2HK 3H0GC 3S1QC 5M5YK 1TWHC 1TWCC 2E2JK 2NVQK 3GTPK 3HOYC 1K83C 3GTQC 4G7HA 1R9TC 2JA7C 2PMZL 1HQMA 1Y1WC 3PO3C 4A3DC 3HOWC 4OIPA 3H3VD 4BBRK 4A3FC 5C3EC 2R7ZC 3S2HC 3H3VL 2PPBA 2NVYK 4Y52C 2R92C 5M3FK 4A3EK 1SMYA 1TWHK 2JA5K 5M5WK 4LK0A 4OIRA 4A3GK 2A69A 2JA7K 3S16K 3S17K 1XPPA 4KN4A 3GTOC 2WB1L 3S1MK 4BBSK 4XLPA 1I3QC 2E2IK 3PO2C 2R92K 4Y52K 3I4NC 5IP9C 3S14C 3I4MK 3HOXC 3HOUC 3I4MC 5IYCK 4A3GC 3EQLA 2A6EA 3GTJK 3S16C 3S17C 4C3JK 5M3MK 1SFOC 5D4DA 4MEXA 4Y7NK 2A68A 4MQ9A 4BY1K 4QJVB 3GTGK 3WODA 4KN7A 4X6AC 5M5XK 2E2HC 3FKIK 4Q5SA 3PO2K 4C3IK 4XSZA 4LLGA 2JA8K 5IYCC 3GTJC 1BDFA 4Q4ZA 4A3IC 4C3JC 5TMCA 4Y7NC 4A3KC 2E2JC 1TWCK 3HOYK 2WB1D 5IP7K 4G7ZA 3RZDC 3GTQK 4BY1C 3HOZC 5TMFA 5C4JC 3DXJA 1Y1VK 3GTLK 4X6AK 1I50C 1TWAK 1TWFC 4A3DK 5IYDK 3HOWK 4YFNA 4GZYA 5C3EK 4OIOA 2R7ZK 4KMUA 3HOVC 1I6HC 4XLNA 4C2MC 4A3IK 4G7OA 4YFKA 2YU9C 2JA6C 5IP7C 2BE5A 4LJZA 4BXXC 4A93K 3HOZK 4A3JC 1Y1VC 5C4JK 3GTLC 3M4OC 4BBSC 3S1MC 3GTOK 4C3HC 2O5JA 3GTKC 1YNJA 3GTMK 5FLMC 5FJ8K 3HOVK 1WCMK 1I6HK 4MEYA 5IP9K 5IYBC 3HOUK 4NOIA 3K7AK 2JA6K 1TWGC 3S15C 4A93C 3S1RC 1IW7A 4QIWL 4A3JK 4BXXK 3RZOK 4A3LC 1I6VA 2NVXK 3M4OK 1YNNA 4ZH4A 4QJVA 2O5IA 3GTKK 3GTMC 3S1QK 3FKIC 2NVQC 3GTPC 1K83K 2VUMK 3K7AC 2PMZD 4BY7C 3S15K 4A3MC 3S1RK 3HKZL 3RZOC 5C4XK 1Y1WK 4A3KK 3PO3K 4AYBL 4A3BK 2NVTK 3RZDK 4LK1A 2WAQD 4A3EC
chains in the Genus database with same CATH superfamily
1TWAC 1I50K 5IYDC 2ZJQS 2GSNA 5C4XC 4C2MK 4AYBD 2B63K 1O2FB 2E2IC 2YU9K 4A3BC 3CAGA 2A6HA 3S2DK 1IS1A 5EGHA 2R93C 4C3HK 1VLOA 1TWAA 2Y0SD 2GSUA 3TFIA 1HI9A 2GSOA 3HXAA 3JSTA 1PJ7A 4XSXA 1PJ5A 4A3CC 4GTDA 4KMAA 3TTGA 2E2HK 4BBRC 4YFXA 2WAQL 2CW0A 1WSRA 3H0GC 1VGXA 2E2JK 1XZQA 1J98A 1Y1WC 3PO3C 3HOWC 4GFQA 1GE9A 2PHCB 3GTMA 5C3EC 2V6SA 4Y52C 1RU0A 4WFNS 1TWHK 1IE0A 2A69A 2JA6A 4IOCS 1F7UA 2R92K 1BJTA 4WJ4A 1O25A 3I4NC 4RMFA 4G0VA 3HOXC 1I50A 3HOUC 2A6EA 3N0BA 3G4CA 4WF9S 3S0XA 2L5NA 4MEXA 4MQ9A 3PO2K 2E2HC 3FKIK 4Q5SA 4XSZA 4M1XA 4C3JC 5TMCA 4Y7NC 5TJ3A 3TFHA 3GEIA 3GTQK 4BY1C 5C4JC 1Y1VK 3GTLK 2XCQA 2E2HA 5C3EK 3HOVC 2KWAA 5IP7C 2BE5A 4GTEA 1ZXOA 3N0CA 4BBSC 3GTOK 2O5JA 3GTKC 3GTMK 4AH6A 5FJ8K 3NUHA 2R7ZA 5IP9K 4BXXK 4QIWL 1R9TA 1IW7A 3GTQA 3AD8C 3M4OK 1F93A 1TWCA 3AQOA 4QJVA 2O5IA 1G51A 3T00A 4LQYA 1WOPA 3L4JA 3S1QK 1O26A 2KQ1A 2NVQC 3GTPC 1F9NA 2Y3PA 1C0AA 3K7AC 3S1RK 3RZOC 1AB4A 3M3YK 2JA5C 1TWFK 4KM8A 3S1NC 4LOWA 3CQZC 3TFJA 5JFEA 3A8KA 2NVTC 4GTLA 1O2BA 3CQZA 1ZYRA 3S14K 1DCHA 1B4BA 1SFOK 2B63C 3HKZD 2ZJRS 1TWGK 5C44K 1B4AA 3GTGC 3S2DC 1JVIA 4JK1A 4IO9S 3GTPA 1DD5A 2JA8C 4A3FK 3S2HK 1EK8A 3S1QC 1VJEA 1TWCC 4P5AA 2RH6A 2NVQK 1K83C 2JA7C 4A3DC 3H3VD 1JQWA 4BBRK 2D6FC 3GEHA 4OIRA 3GTLA 4A3GK 1YX2A 3Q3QA 3S16K 1DCPA 1XPPA 4KN4A 4BLAA 2WB1L 2E2IK 4Y52K 2V6UA 3S14C 1WQHA 3I4MC 1USMA 4C45A 1Y1VA 5IYCK 3T01A 2YU9A 5JVOA 1UV7A 1BS2A 4GTCA 4KN7A 4X6AC 5M5XK 4WFBS 4LLGA 4KM9A 4P5BA 3GTJC 4Q4ZA 2GAGC 1TWCK 2E2JC 1SFOA 4G7ZA 4LR2A 3VA7A 1JOEA 1XZQB 1EH1A 4KB2A 1PJ6A 3HOWK 4KAWX 1O24A 4GZYA 5L46A 1I6HC 4P9SA 4YFKA 4IOAS 4LJZA 4A93K 3HOZK 1Y1VC 5C4JK 1IQ0A 5FLMC 3GTOA 1IL2A 5IOQA 2JA6K 3HOUK 3S15C 4A3JK 4XCHA 3A8JA 4A3LC 1YNNA 4GT9A 2NVYA 2JH3A 4PABA 3FKIC 3PIPS 2JA7A 4BY7C 4KC6A 3HKZL 1K83A 5E68A 4LK1A 2WAQD 2XCRB 1F7VA 2R93K 2NVXA 5HL8A 2VUMC 4BKWA 1INNA 1J6XA 4A3MK 3AD7C 1WCMA 1I3QK 1EFWA 2PA8L 2Y0SL 4WCES 1O27A 2ZUFA 3LAJA 1R9TK 4O2DA 4A3LK 2JA5A 4C3IC 2KXYA 3FKIA 2KPUA 3ERED 2NVYC 5DM7S 5M5YK 3GTPK 3HOYC 1J6VA 5CJ9A 1XZPB 3CF5S 1TWGA 1HQMA 5HL7S 4OIPA 1J6WA 4A3FC 1O29A 1ZQ1C 2PPBA 5M3FK 1SMYA 2W7VA 2JA5K 1ZVUA 1VRQC 2EBBA 5IORA 2JA7K 1BGWA 3S17K 1EI6A 4G0WA 3S1MK 5JVHS 1TWFA 1X31C 5EGEA 3EQLA 4WILA 5HQHA 1SFOC 5D4DA 4QJVB 3GTGK 5CHPA 4C3IK 2JA8K 5IYCC 2FQTA 4FM9A 1BDFA 1KQ4A 4A3IC 3LPXA 4A3KC 4G0UA 3HOYK 5DM6S 2WB1D 3BP3A 3FOFA 3RZDC 4KDDA 3DXJA 3DLLS 4A3DK 4YFNA 1WQGA 4OIOA 3GSIA 4XLNA 4C2MC 3SZYA 4GTBA 4BXXC 2ZJPS 3GTLC 4ILDA 3M4OC 4KMHA 4C3HC 2R92A 3OREA 3HOVK 1WCMK 3V4GA 4MEYA 1DCOA 5IYBC 4DDQA 3I4MK 4A93C 3IPJA 3RZOK 2NVXK 3AH5A 4ZH4A 3N3YA 3GTKK 4GTAA 3GTMC 3OPFA 1Y1WA 3G4AA 2PMZD 3GTGA 1WIHA 2CFAB 5C4XK 2B63A 4A3BK 2CFAA 3RZDK 2NVTK 3L4KA 4A3EC 1WQFA 5IOSA 4OIQA 3GIRA 4KARA 1XXCA 4BY7K 1YCLA 5JVGS 1O2AA 4OINA 3GEEA 4KASA 4YG2A 4A3CK 5C44C 3I4NK 3M3YC 3HOXK 2R93A 3S1NK 2RGRA 3CQZK 3H0GK 5FLMK 2E2IA 1WCMC 3BP8C 1VH2A 3GDZA 4KMDA 5IYBK 2GAHC 1EQRA 2VUMA 2ZFZA 4QIWD 2NVXC 4WFAS 5IOTA 2PA8D 4FZBA 1TWHC 3BUEA 3OEPA 1L0WA 3GTQC 4G7HA 1R9TC 2PMZL 3LAPA 2P5MA 2R7ZC 3S2HC 2NVYK 4A3EK 2R92C 3GTKA 1XXAA 5M5WK 4LK0A 1O28A 1WOSA 4PAAA 4J3NA 3T02A 3GTOC 3A8IA 4BBSK 4XLPA 1I3QC 2L3UA 3PO2C 1XXBA 5IP9C 2XCOA 4A3GC 3GTJK 3S16C 1IBAA 3S17C 4C3JK 5M3MK 4Y7NK 2A68A 1ISEA 1V5VA 4BY1K 3PIOS 1WSVA 3WODA 3FOEA 3FHZA 5IP7K 1ZBSA 3HOZC 3ADAC 5TMFA 3GTJA 1XZPA 4X6AK 1I50C 1TWAK 2V6TA 1TWFC 5IYDK 4WJ3M 2R7ZK 4KATA 4KMUA 4A3IK 3AD9C 4G7OA 2P8TA 2FQOA 4GTFA 2YU9C 2JA6C 4A3JC 3QX3A 1FEUA 3S1MC 1YNJA 1I3QA 1I6HK 4BLBA 1WOOA 4NOIA 3K7AK 1TWGC 4U67S 3S1RC 1I6VA 3MMLB 3H0GA 3LYWA 2ZUEA 1WORA 1K83K 3SZZA 1USOA 2VUMK 3S15K 4A3MC 4KB4A 3AQPA 4A3KK 1Y1WK 3PO3K 1TWHA 4AYBL 3H3VL
chains in the Genus database with same CATH topology
4OIQA 3M3YK 2R93K 1TWAC 2JA5C 1I50K 1TWFK 5IYDC 3S1NC 2VUMC 3CQZC 4BY7K 4A3MK 5C4XC 4C2MK 4OINA 4AYBD 2B63K 2E2IC 1I3QK 4YG2A 4A3BC 2NVTC 2PA8L 5C44C 2A6HA 2YU9K 4A3CK 3S2DK 2Y0SL 1ZYRA 3M3YC 2R93C 3I4NK 3S14K 3HOXK 4C3HK 3S1NK 2Y0SD 3CQZK 3H0GK 5FLMK 1WCMC 1SFOK 5IYBK 2B63C 4XSXA 3HKZD 4A3CC 1TWGK 5C44K 1R9TK 3GTGC 3S2DC 4QIWD 2E2HK 2NVXC 4JK1A 4A3LK 4C3IC 2JA8C 4BBRC 4YFXA 4A3FK 2WAQL 2PA8D 2CW0A 2NVYC 3S2HK 3H0GC 3S1QC 5M5YK 1TWHC 1TWCC 2E2JK 2NVQK 3GTPK 3HOYC 1K83C 3GTQC 4G7HA 1R9TC 2JA7C 2PMZL 1HQMA 1Y1WC 3PO3C 4A3DC 3HOWC 4OIPA 3H3VD 4BBRK 4A3FC 5C3EC 2R7ZC 3S2HC 3H3VL 2PPBA 2NVYK 4Y52C 2R92C 5M3FK 4A3EK 1SMYA 1TWHK 2JA5K 5M5WK 4LK0A 4OIRA 4A3GK 2A69A 2JA7K 3S16K 3S17K 1XPPA 4KN4A 3GTOC 2WB1L 3S1MK 4BBSK 4XLPA 1I3QC 2E2IK 3PO2C 2R92K 4Y52K 3I4NC 5IP9C 3S14C 3I4MK 3HOXC 3HOUC 3I4MC 5IYCK 4A3GC 3EQLA 2A6EA 3GTJK 3S16C 3S17C 4C3JK 5M3MK 1SFOC 5D4DA 4MEXA 4Y7NK 2A68A 4MQ9A 4BY1K 4QJVB 3GTGK 3WODA 4KN7A 4X6AC 5M5XK 2E2HC 3FKIK 4Q5SA 3PO2K 4C3IK 4XSZA 4LLGA 2JA8K 5IYCC 3GTJC 1BDFA 4Q4ZA 4A3IC 4C3JC 5TMCA 4Y7NC 4A3KC 2E2JC 1TWCK 3HOYK 2WB1D 5IP7K 4G7ZA 3RZDC 3GTQK 4BY1C 3HOZC 5TMFA 5C4JC 3DXJA 1Y1VK 3GTLK 4X6AK 1I50C 1TWAK 1TWFC 4A3DK 5IYDK 3HOWK 4YFNA 4GZYA 5C3EK 4OIOA 2R7ZK 4KMUA 3HOVC 1I6HC 4XLNA 4C2MC 4A3IK 4G7OA 4YFKA 2YU9C 2JA6C 5IP7C 2BE5A 4LJZA 4BXXC 4A93K 3HOZK 4A3JC 1Y1VC 5C4JK 3GTLC 3M4OC 4BBSC 3S1MC 3GTOK 4C3HC 2O5JA 3GTKC 1YNJA 3GTMK 5FLMC 5FJ8K 3HOVK 1WCMK 1I6HK 4MEYA 5IP9K 5IYBC 3HOUK 4NOIA 3K7AK 2JA6K 1TWGC 3S15C 4A93C 3S1RC 1IW7A 4QIWL 4A3JK 4BXXK 3RZOK 4A3LC 1I6VA 2NVXK 3M4OK 1YNNA 4ZH4A 4QJVA 2O5IA 3GTKK 3GTMC 3S1QK 3FKIC 2NVQC 3GTPC 1K83K 2VUMK 3K7AC 2PMZD 4BY7C 3S15K 4A3MC 3S1RK 3HKZL 3RZOC 5C4XK 1Y1WK 4A3KK 3PO3K 4AYBL 4A3BK 2NVTK 3RZDK 4LK1A 2WAQD 4A3EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIQ A;  3M3Y K;  2R93 K;  1TWA C;  2JA5 C;  1I50 K;  1TWF K;  5IYD C;  3S1N C;  2VUM C;  3CQZ C;  4BY7 K;  4A3M K;  5C4X C;  4C2M K;  4OIN A;  4AYB D;  2B63 K;  2E2I C;  1I3Q K;  4YG2 A;  4A3B C;  2NVT C;  2PA8 L;  5C44 C;  2A6H A;  2YU9 K;  4A3C K;  3S2D K;  2Y0S L;  1ZYR A;  3M3Y C;  2R93 C;  3I4N K;  3S14 K;  3HOX K;  4C3H K;  3S1N K;  2Y0S D;  3CQZ K;  3H0G K;  5FLM K;  1WCM C;  1SFO K;  5IYB K;  2B63 C;  4XSX A;  3HKZ D;  4A3C C;  1TWG K;  5C44 K;  1R9T K;  3GTG C;  3S2D C;  4QIW D;  2E2H K;  2NVX C;  4JK1 A;  4A3L K;  4C3I C;  2JA8 C;  4BBR C;  4YFX A;  4A3F K;  2WAQ L;  2PA8 D;  2CW0 A;  2NVY C;  3S2H K;  3H0G C;  3S1Q C;  5M5Y K;  1TWH C;  1TWC C;  2E2J K;  2NVQ K;  3GTP K;  3HOY C;  1K83 C;  3GTQ C;  4G7H A;  1R9T C;  2JA7 C;  2PMZ L;  1HQM A;  1Y1W C;  3PO3 C;  4A3D C;  3HOW C;  4OIP A;  3H3V D;  4BBR K;  4A3F C;  5C3E C;  2R7Z C;  3S2H C;  3H3V L;  2PPB A;  2NVY K;  4Y52 C;  2R92 C;  5M3F K;  4A3E K;  1SMY A;  1TWH K;  2JA5 K;  5M5W K;  4LK0 A;  4OIR A;  4A3G K;  2A69 A;  2JA7 K;  3S16 K;  3S17 K;  1XPP A;  4KN4 A;  3GTO C;  2WB1 L;  3S1M K;  4BBS K;  4XLP A;  1I3Q C;  2E2I K;  3PO2 C;  2R92 K;  4Y52 K;  3I4N C;  5IP9 C;  3S14 C;  3I4M K;  3HOX C;  3HOU C;  3I4M C;  5IYC K;  4A3G C;  3EQL A;  2A6E A;  3GTJ K;  3S16 C;  3S17 C;  4C3J K;  5M3M K;  1SFO C;  5D4D A;  4MEX A;  4Y7N K;  2A68 A;  4MQ9 A;  4BY1 K;  4QJV B;  3GTG K;  3WOD A;  4KN7 A;  4X6A C;  5M5X K;  2E2H C;  3FKI K;  4Q5S A;  3PO2 K;  4C3I K;  4XSZ A;  4LLG A;  2JA8 K;  5IYC C;  3GTJ C;  1BDF A;  4Q4Z A;  4A3I C;  4C3J C;  5TMC A;  4Y7N C;  4A3K C;  2E2J C;  1TWC K;  3HOY K;  2WB1 D;  5IP7 K;  4G7Z A;  3RZD C;  3GTQ K;  4BY1 C;  3HOZ C;  5TMF A;  5C4J C;  3DXJ A;  1Y1V K;  3GTL K;  4X6A K;  1I50 C;  1TWA K;  1TWF C;  4A3D K;  5IYD K;  3HOW K;  4YFN A;  4GZY A;  5C3E K;  4OIO A;  2R7Z K;  4KMU A;  3HOV C;  1I6H C;  4XLN A;  4C2M C;  4A3I K;  4G7O A;  4YFK A;  2YU9 C;  2JA6 C;  5IP7 C;  2BE5 A;  4LJZ A;  4BXX C;  4A93 K;  3HOZ K;  4A3J C;  1Y1V C;  5C4J K;  3GTL C;  3M4O C;  4BBS C;  3S1M C;  3GTO K;  4C3H C;  2O5J A;  3GTK C;  1YNJ A;  3GTM K;  5FLM C;  5FJ8 K;  3HOV K;  1WCM K;  1I6H K;  4MEY A;  5IP9 K;  5IYB C;  3HOU K;  4NOI A;  3K7A K;  2JA6 K;  1TWG C;  3S15 C;  4A93 C;  3S1R C;  1IW7 A;  4QIW L;  4A3J K;  4BXX K;  3RZO K;  4A3L C;  1I6V A;  2NVX K;  3M4O K;  1YNN A;  4ZH4 A;  4QJV A;  2O5I A;  3GTK K;  3GTM C;  3S1Q K;  3FKI C;  2NVQ C;  3GTP C;  1K83 K;  2VUM K;  3K7A C;  2PMZ D;  4BY7 C;  3S15 K;  4A3M C;  3S1R K;  3HKZ L;  3RZO C;  5C4X K;  1Y1W K;  4A3K K;  3PO3 K;  4AYB L;  4A3B K;  2NVT K;  3RZD K;  4LK1 A;  2WAQ D;  4A3E C; 
#chains in the Genus database with same CATH topology
 1TWA C;  1I50 K;  5IYD C;  2ZJQ S;  2GSN A;  5C4X C;  4C2M K;  4AYB D;  2B63 K;  1O2F B;  2E2I C;  2YU9 K;  4A3B C;  3CAG A;  2A6H A;  3S2D K;  1IS1 A;  5EGH A;  2R93 C;  4C3H K;  1VLO A;  1TWA A;  2Y0S D;  2GSU A;  3TFI A;  1HI9 A;  2GSO A;  3HXA A;  3JST A;  1PJ7 A;  4XSX A;  1PJ5 A;  4A3C C;  4GTD A;  4KMA A;  3TTG A;  2E2H K;  4BBR C;  4YFX A;  2WAQ L;  2CW0 A;  1WSR A;  3H0G C;  1VGX A;  2E2J K;  1XZQ A;  1J98 A;  1Y1W C;  3PO3 C;  3HOW C;  4GFQ A;  1GE9 A;  2PHC B;  3GTM A;  5C3E C;  2V6S A;  4Y52 C;  1RU0 A;  4WFN S;  1TWH K;  1IE0 A;  2A69 A;  2JA6 A;  4IOC S;  1F7U A;  2R92 K;  1BJT A;  4WJ4 A;  1O25 A;  3I4N C;  4RMF A;  4G0V A;  3HOX C;  1I50 A;  3HOU C;  2A6E A;  3N0B A;  3G4C A;  4WF9 S;  3S0X A;  2L5N A;  4MEX A;  4MQ9 A;  3PO2 K;  2E2H C;  3FKI K;  4Q5S A;  4XSZ A;  4M1X A;  4C3J C;  5TMC A;  4Y7N C;  5TJ3 A;  3TFH A;  3GEI A;  3GTQ K;  4BY1 C;  5C4J C;  1Y1V K;  3GTL K;  2XCQ A;  2E2H A;  5C3E K;  3HOV C;  2KWA A;  5IP7 C;  2BE5 A;  4GTE A;  1ZXO A;  3N0C A;  4BBS C;  3GTO K;  2O5J A;  3GTK C;  3GTM K;  4AH6 A;  5FJ8 K;  3NUH A;  2R7Z A;  5IP9 K;  4BXX K;  4QIW L;  1R9T A;  1IW7 A;  3GTQ A;  3AD8 C;  3M4O K;  1F93 A;  1TWC A;  3AQO A;  4QJV A;  2O5I A;  1G51 A;  3T00 A;  4LQY A;  1WOP A;  3L4J A;  3S1Q K;  1O26 A;  2KQ1 A;  2NVQ C;  3GTP C;  1F9N A;  2Y3P A;  1C0A A;  3K7A C;  3S1R K;  3RZO C;  1AB4 A;  3M3Y K;  2JA5 C;  1TWF K;  4KM8 A;  3S1N C;  4LOW A;  3CQZ C;  3TFJ A;  5JFE A;  3A8K A;  2NVT C;  4GTL A;  1O2B A;  3CQZ A;  1ZYR A;  3S14 K;  1DCH A;  1B4B A;  1SFO K;  2B63 C;  3HKZ D;  2ZJR S;  1TWG K;  5C44 K;  1B4A A;  3GTG C;  3S2D C;  1JVI A;  4JK1 A;  4IO9 S;  3GTP A;  1DD5 A;  2JA8 C;  4A3F K;  3S2H K;  1EK8 A;  3S1Q C;  1VJE A;  1TWC C;  4P5A A;  2RH6 A;  2NVQ K;  1K83 C;  2JA7 C;  4A3D C;  3H3V D;  1JQW A;  4BBR K;  2D6F C;  3GEH A;  4OIR A;  3GTL A;  4A3G K;  1YX2 A;  3Q3Q A;  3S16 K;  1DCP A;  1XPP A;  4KN4 A;  4BLA A;  2WB1 L;  2E2I K;  4Y52 K;  2V6U A;  3S14 C;  1WQH A;  3I4M C;  1USM A;  4C45 A;  1Y1V A;  5IYC K;  3T01 A;  2YU9 A;  5JVO A;  1UV7 A;  1BS2 A;  4GTC A;  4KN7 A;  4X6A C;  5M5X K;  4WFB S;  4LLG A;  4KM9 A;  4P5B A;  3GTJ C;  4Q4Z A;  2GAG C;  1TWC K;  2E2J C;  1SFO A;  4G7Z A;  4LR2 A;  3VA7 A;  1JOE A;  1XZQ B;  1EH1 A;  4KB2 A;  1PJ6 A;  3HOW K;  4KAW X;  1O24 A;  4GZY A;  5L46 A;  1I6H C;  4P9S A;  4YFK A;  4IOA S;  4LJZ A;  4A93 K;  3HOZ K;  1Y1V C;  5C4J K;  1IQ0 A;  5FLM C;  3GTO A;  1IL2 A;  5IOQ A;  2JA6 K;  3HOU K;  3S15 C;  4A3J K;  4XCH A;  3A8J A;  4A3L C;  1YNN A;  4GT9 A;  2NVY A;  2JH3 A;  4PAB A;  3FKI C;  3PIP S;  2JA7 A;  4BY7 C;  4KC6 A;  3HKZ L;  1K83 A;  5E68 A;  4LK1 A;  2WAQ D;  2XCR B;  1F7V A;  2R93 K;  2NVX A;  5HL8 A;  2VUM C;  4BKW A;  1INN A;  1J6X A;  4A3M K;  3AD7 C;  1WCM A;  1I3Q K;  1EFW A;  2PA8 L;  2Y0S L;  4WCE S;  1O27 A;  2ZUF A;  3LAJ A;  1R9T K;  4O2D A;  4A3L K;  2JA5 A;  4C3I C;  2KXY A;  3FKI A;  2KPU A;  3ERE D;  2NVY C;  5DM7 S;  5M5Y K;  3GTP K;  3HOY C;  1J6V A;  5CJ9 A;  1XZP B;  3CF5 S;  1TWG A;  1HQM A;  5HL7 S;  4OIP A;  1J6W A;  4A3F C;  1O29 A;  1ZQ1 C;  2PPB A;  5M3F K;  1SMY A;  2W7V A;  2JA5 K;  1ZVU A;  1VRQ C;  2EBB A;  5IOR A;  2JA7 K;  1BGW A;  3S17 K;  1EI6 A;  4G0W A;  3S1M K;  5JVH S;  1TWF A;  1X31 C;  5EGE A;  3EQL A;  4WIL A;  5HQH A;  1SFO C;  5D4D A;  4QJV B;  3GTG K;  5CHP A;  4C3I K;  2JA8 K;  5IYC C;  2FQT A;  4FM9 A;  1BDF A;  1KQ4 A;  4A3I C;  3LPX A;  4A3K C;  4G0U A;  3HOY K;  5DM6 S;  2WB1 D;  3BP3 A;  3FOF A;  3RZD C;  4KDD A;  3DXJ A;  3DLL S;  4A3D K;  4YFN A;  1WQG A;  4OIO A;  3GSI A;  4XLN A;  4C2M C;  3SZY A;  4GTB A;  4BXX C;  2ZJP S;  3GTL C;  4ILD A;  3M4O C;  4KMH A;  4C3H C;  2R92 A;  3ORE A;  3HOV K;  1WCM K;  3V4G A;  4MEY A;  1DCO A;  5IYB C;  4DDQ A;  3I4M K;  4A93 C;  3IPJ A;  3RZO K;  2NVX K;  3AH5 A;  4ZH4 A;  3N3Y A;  3GTK K;  4GTA A;  3GTM C;  3OPF A;  1Y1W A;  3G4A A;  2PMZ D;  3GTG A;  1WIH A;  2CFA B;  5C4X K;  2B63 A;  4A3B K;  2CFA A;  3RZD K;  2NVT K;  3L4K A;  4A3E C;  1WQF A;  5IOS A;  4OIQ A;  3GIR A;  4KAR A;  1XXC A;  4BY7 K;  1YCL A;  5JVG S;  1O2A A;  4OIN A;  3GEE A;  4KAS A;  4YG2 A;  4A3C K;  5C44 C;  3I4N K;  3M3Y C;  3HOX K;  2R93 A;  3S1N K;  2RGR A;  3CQZ K;  3H0G K;  5FLM K;  2E2I A;  1WCM C;  3BP8 C;  1VH2 A;  3GDZ A;  4KMD A;  5IYB K;  2GAH C;  1EQR A;  2VUM A;  2ZFZ A;  4QIW D;  2NVX C;  4WFA S;  5IOT A;  2PA8 D;  4FZB A;  1TWH C;  3BUE A;  3OEP A;  1L0W A;  3GTQ C;  4G7H A;  1R9T C;  2PMZ L;  3LAP A;  2P5M A;  2R7Z C;  3S2H C;  2NVY K;  4A3E K;  2R92 C;  3GTK A;  1XXA A;  5M5W K;  4LK0 A;  1O28 A;  1WOS A;  4PAA A;  4J3N A;  3T02 A;  3GTO C;  3A8I A;  4BBS K;  4XLP A;  1I3Q C;  2L3U A;  3PO2 C;  1XXB A;  5IP9 C;  2XCO A;  4A3G C;  3GTJ K;  3S16 C;  1IBA A;  3S17 C;  4C3J K;  5M3M K;  4Y7N K;  2A68 A;  1ISE A;  1V5V A;  4BY1 K;  3PIO S;  1WSV A;  3WOD A;  3FOE A;  3FHZ A;  5IP7 K;  1ZBS A;  3HOZ C;  3ADA C;  5TMF A;  3GTJ A;  1XZP A;  4X6A K;  1I50 C;  1TWA K;  2V6T A;  1TWF C;  5IYD K;  4WJ3 M;  2R7Z K;  4KAT A;  4KMU A;  4A3I K;  3AD9 C;  4G7O A;  2P8T A;  2FQO A;  4GTF A;  2YU9 C;  2JA6 C;  4A3J C;  3QX3 A;  1FEU A;  3S1M C;  1YNJ A;  1I3Q A;  1I6H K;  4BLB A;  1WOO A;  4NOI A;  3K7A K;  1TWG C;  4U67 S;  3S1R C;  1I6V A;  3MML B;  3H0G A;  3LYW A;  2ZUE A;  1WOR A;  1K83 K;  3SZZ A;  1USO A;  2VUM K;  3S15 K;  4A3M C;  4KB4 A;  3AQP A;  4A3K K;  1Y1W K;  3PO3 K;  1TWH A;  4AYB L;  3H3V L; 
#chains in the Genus database with same CATH homology
 4OIQ A;  3M3Y K;  2R93 K;  1TWA C;  2JA5 C;  1I50 K;  1TWF K;  5IYD C;  3S1N C;  2VUM C;  3CQZ C;  4BY7 K;  4A3M K;  5C4X C;  4C2M K;  4OIN A;  4AYB D;  2B63 K;  2E2I C;  1I3Q K;  4YG2 A;  4A3B C;  2NVT C;  2PA8 L;  5C44 C;  2A6H A;  2YU9 K;  4A3C K;  3S2D K;  2Y0S L;  1ZYR A;  3M3Y C;  2R93 C;  3I4N K;  3S14 K;  3HOX K;  4C3H K;  3S1N K;  2Y0S D;  3CQZ K;  3H0G K;  5FLM K;  1WCM C;  1SFO K;  5IYB K;  2B63 C;  4XSX A;  3HKZ D;  4A3C C;  1TWG K;  5C44 K;  1R9T K;  3GTG C;  3S2D C;  4QIW D;  2E2H K;  2NVX C;  4JK1 A;  4A3L K;  4C3I C;  2JA8 C;  4BBR C;  4YFX A;  4A3F K;  2WAQ L;  2PA8 D;  2CW0 A;  2NVY C;  3S2H K;  3H0G C;  3S1Q C;  5M5Y K;  1TWH C;  1TWC C;  2E2J K;  2NVQ K;  3GTP K;  3HOY C;  1K83 C;  3GTQ C;  4G7H A;  1R9T C;  2JA7 C;  2PMZ L;  1HQM A;  1Y1W C;  3PO3 C;  4A3D C;  3HOW C;  4OIP A;  3H3V D;  4BBR K;  4A3F C;  5C3E C;  2R7Z C;  3S2H C;  3H3V L;  2PPB A;  2NVY K;  4Y52 C;  2R92 C;  5M3F K;  4A3E K;  1SMY A;  1TWH K;  2JA5 K;  5M5W K;  4LK0 A;  4OIR A;  4A3G K;  2A69 A;  2JA7 K;  3S16 K;  3S17 K;  1XPP A;  4KN4 A;  3GTO C;  2WB1 L;  3S1M K;  4BBS K;  4XLP A;  1I3Q C;  2E2I K;  3PO2 C;  2R92 K;  4Y52 K;  3I4N C;  5IP9 C;  3S14 C;  3I4M K;  3HOX C;  3HOU C;  3I4M C;  5IYC K;  4A3G C;  3EQL A;  2A6E A;  3GTJ K;  3S16 C;  3S17 C;  4C3J K;  5M3M K;  1SFO C;  5D4D A;  4MEX A;  4Y7N K;  2A68 A;  4MQ9 A;  4BY1 K;  4QJV B;  3GTG K;  3WOD A;  4KN7 A;  4X6A C;  5M5X K;  2E2H C;  3FKI K;  4Q5S A;  3PO2 K;  4C3I K;  4XSZ A;  4LLG A;  2JA8 K;  5IYC C;  3GTJ C;  1BDF A;  4Q4Z A;  4A3I C;  4C3J C;  5TMC A;  4Y7N C;  4A3K C;  2E2J C;  1TWC K;  3HOY K;  2WB1 D;  5IP7 K;  4G7Z A;  3RZD C;  3GTQ K;  4BY1 C;  3HOZ C;  5TMF A;  5C4J C;  3DXJ A;  1Y1V K;  3GTL K;  4X6A K;  1I50 C;  1TWA K;  1TWF C;  4A3D K;  5IYD K;  3HOW K;  4YFN A;  4GZY A;  5C3E K;  4OIO A;  2R7Z K;  4KMU A;  3HOV C;  1I6H C;  4XLN A;  4C2M C;  4A3I K;  4G7O A;  4YFK A;  2YU9 C;  2JA6 C;  5IP7 C;  2BE5 A;  4LJZ A;  4BXX C;  4A93 K;  3HOZ K;  4A3J C;  1Y1V C;  5C4J K;  3GTL C;  3M4O C;  4BBS C;  3S1M C;  3GTO K;  4C3H C;  2O5J A;  3GTK C;  1YNJ A;  3GTM K;  5FLM C;  5FJ8 K;  3HOV K;  1WCM K;  1I6H K;  4MEY A;  5IP9 K;  5IYB C;  3HOU K;  4NOI A;  3K7A K;  2JA6 K;  1TWG C;  3S15 C;  4A93 C;  3S1R C;  1IW7 A;  4QIW L;  4A3J K;  4BXX K;  3RZO K;  4A3L C;  1I6V A;  2NVX K;  3M4O K;  1YNN A;  4ZH4 A;  4QJV A;  2O5I A;  3GTK K;  3GTM C;  3S1Q K;  3FKI C;  2NVQ C;  3GTP C;  1K83 K;  2VUM K;  3K7A C;  2PMZ D;  4BY7 C;  3S15 K;  4A3M C;  3S1R K;  3HKZ L;  3RZO C;  5C4X K;  1Y1W K;  4A3K K;  3PO3 K;  4AYB L;  4A3B K;  2NVT K;  3RZD K;  4LK1 A;  2WAQ D;  4A3E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...