2CW0A

Crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation
pubmed doi rcsb
molecule tags Transferase
total genus 36
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2cw0A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2cw0A01
4XLPA 2JA6C 2A69A 3I4MC 3S1QK 4MEXA 4A93K 4A3MK 2E2IC 2R93C 2O5IA 4QIWL 4XLNA 3S1QC 4A3JK 4JK1A 4A93C 4GZYA 1I6VA 5M3FK 3S2DK 3HOXK 2E2HK 4MEYA 4A3JC 2JA5K 4OIRA 4OINA 3I4NK 4LJZA 3RZOK 3HOXC 2E2HC 3M3YK 3HOYK 1I3QK 3HOWK 2JA5C 1TWHK 3GTOK 3I4NC 5IYCK 1WCMK 3RZOC 3M3YC 5C3EK 1YNJA 3M4OK 4OIPA 1I3QC 2CW0A 4YG2A 3HOWC 2R93K 4X6AK 1TWHC 3GTOC 2YU9K 5IYCC 1WCMC 2NVTC 3M4OC 4A3BC 4X6AC 1K83K 1TWFK 1Y1VK 3GTMK 5TMCA 1TWFC 1K83C 2PA8D 3HOUK 3K7AC 4BY1K 3I4MK 4BBSC 1Y1VC 5M5WK 3GTMC 2Y0SD 2JA8C 3HOUC 4MQ9A 4BY1C 2E2IK 4ZH4A 4XSXA 3S15K 1Y1WK 3GTQK 1TWGK 5M3MK 1TWAC 2PA8L 3CQZK 5C4JK 4A3EK 2R7ZK 4QJVA 3S15C 1Y1WC 3GTQC 2Y0SL 1TWGC 2BE5A 4A3IK 3CQZC 4A3GK 5D4DA 5C4JC 4A3EC 2R7ZC 4G7ZA 4C3HK 3GTLK 4KN7A 4NOIA 1R9TC 4A3IC 4YFKA 1BDFA 4A3GC 4BY7K 3S2HK 1XPPA 4C3HC 5IYDC 3EQLA 3GTLC 3H3VD 2NVTK 3GTJK 4BY7C 1ZYRA 3S2HC 3WODA 3S16K 4LK0A 4YFXA 3GTJC 3K7AK 1HQMA 4BBSK 4QJVB 3S16C 3HOVK 2B63C 2JA8K 3H3VL 5IP7K 5C4XK 3HOVC 1TWAK 1I50K 2WAQD 5IP7C 3H0GC 5IP9K 4OIOA 4AYBD 4A3KK 2E2JK 5TMFA 5C4XC 2NVQK 1YNNA 1I50C 4LLGA 4A3KC 5IP9C 2E2JC 2NVQC 5FLMC 1SMYA 4KMUA 1R9TK 1I6HK 4G7OA 3RZDC 2WAQL 5IYDK 4AYBL 4A3BK 4A3DK 1I6HC 5C44C 4G7HA 4BXXK 3HKZD 2PMZD 4A3DC 4Q4ZA 2A6HA 4XSZA 4BXXC 2R92K 3S1MK 1TWCK 2JA7K 3FKIC 2VUMC 2B63K 4C3JK 2NVYC 2R92C 4BBRC 3S1MC 3HKZL 3PO3C 1TWCC 2JA7C 2A6EA 2PMZL 3GTGK 4YFNA 4C3JC 4Y7NC 4A3LC 4C3IK 3H0GK 3GTPK 3S17K 4OIQA 3GTGC 4A3MC 4C3IC 4A3CK 2WB1D 5FLMK 3GTPC 3S17C 3HOZK 2PPBA 3PO2K 3S2DC 3RZDK 4A3CC 4LK1A 5M5YK 3HOZC 5C44K 3S1NK 3DXJA 5IYBK 3S1RK 3PO2C 4Y52K 4Q5SA 3HOYC 2WB1L 4A3FK 2NVXK 1IW7A 3S1NC 3S14K 5IYBC 3S1RC 4C2MK 4Y52C 1SFOK 5C3EC 4A3FC 3FKIK 2O5JA 2VUMK 2NVXC 3S14C 2NVYK 4QIWD 2YU9C 4C2MC 1SFOC 5FJ8K 4BBRK 2JA6K 2A68A 3GTKK 3PO3K 5M5XK 4A3LK 4Y7NK 4KN4A 3GTKC
chains in the Genus database with same CATH superfamily
3PIOS 1TWGA 3CQZA 4QIWL 1ZVUA 1R9TA 1I6VA 1V5VA 4MEYA 3AD8C 4OIRA 1J98A 1DCHA 4BKWA 1VLOA 3GDZA 3GTOK 3AH5A 5IYCK 3RZOC 4A3BK 3HOWC 2P8TA 1EK8A 4U67S 1WCMC 3M4OC 4PABA 1BGWA 2FQTA 5JFEA 1K83C 3H0GA 3S0XA 4BBSC 1DCOA 4KARA 2XCRB 3HOUC 4ZH4A 2JH3A 1TWGK 3CQZK 5C4JK 4LOWA 3GTQC 2BE5A 5D4DA 4A3EC 4G7ZA 1HI9A 4KN7A 5HQHA 1PJ5A 1BDFA 4C3HC 4AH6A 3EQLA 1WQHA 2KXYA 3S2HC 3VA7A 3GTJC 3K7AK 3S16C 4WJ4A 5IOTA 2JA8K 3HOVC 3LAPA 4OIOA 5C4XC 1YNNA 4A3KC 2NVQC 5FLMC 1SMYA 2KPUA 1EQRA 1I6HK 1JQWA 4GTFA 3G4CA 3AQOA 4A3DK 1SFOA 4GTEA 4Q4ZA 4XCHA 5E68A 4BXXC 1IBAA 2VUMC 2B63K 4C3JK 2NVYC 4BBRC 3S1MC 3HKZL 4O2DA 1TWCC 2JA7C 4KC6A 1AB4A 4Y7NC 3TFJA 4C3IC 4A3CK 2PPBA 3S2DC 5CHPA 1O2AA 3LAJA 5M5YK 1WCMA 2V6SA 4A3FK 5IYBC 3S1RC 1K83A 4Y52C 1SFOK 1USMA 1O26A 4QIWD 4C2MC 5JVOA 1KQ4A 2V6TA 3PO3K 3GTKC 4XLPA 1IE0A 4A3MK 3GTQA 4GZYA 3GEHA 4OINA 3RZOK 3HOXC 2E2HC 3T00A 3HOYK 3HOWK 1VJEA 4KB4A 3I4NC 3GTJA 2W7VA 1WCMK 2XCQA 3M3YC 3M4OK 3GSIA 1TWHC 1B4BA 2YU9K 2NVTC 1K83K 4BLBA 1EI6A 1X31C 1JVIA 1TWFC 3HOUK 3I4MK 5HL8A 3LPXA 1XXBA 1TWAA 2XCOA 2ZUEA 3GTQK 5M3MK 1J6XA 2PA8L 4A3EK 3T01A 4PAAA 1Y1WC 1WORA 2R7ZC 4C3HK 1WSRA 2RH6A 4NOIA 3S2HK 2VUMA 5IYDC 3GTLC 2NVYA 3GTJK 4BY7C 1TWCA 1O25A 3S16K 2JA7A 1DCPA 1INNA 4YFXA 1HQMA 4QJVB 1YX2A 1O2BA 3HOVK 5C4XK 2KQ1A 2KWAA 3SZYA 1TWAK 5IP7C 4A3KK 2GAHC 2NVQK 5TMFA 1WQGA 4ILDA 1I50C 5IP9C 2E2JC 1R9TK 3N0BA 3BP3A 1BJTA 2WAQL 4AYBL 3N3YA 4G7HA 3ADAC 4BXXK 3HKZD 4KAWX 3GTKA 1XZQB 1J6VA 3AQPA 3FOFA 3S1MK 3A8KA 1TWCK 2JA7K 3FKIC 1O29A 2PHCB 3MMLB 2R92C 2PMZL 4YFNA 4A3LC 1WSVA 4C3IK 3H0GK 4GTLA 2E2HA 3ERED 1DD5A 3RZDK 1XXCA 2Y3PA 4IO9S 1TWHA 5C44K 5IYBK 3S1RK 2EBBA 3PO2C 4Y52K 1EFWA 2WB1L 3PIPS 3N0CA 1TWFA 4C2MK 1ISEA 2V6UA 3TFHA 2O5JA 2NVXC 3CAGA 5EGEA 5FJ8K 3GTKK 4WJ3M 3IPJA 2L5NA 3OREA 1VGXA 5M5XK 3FHZA 5EGHA 2E2IC 1Y1WA 2R93C 1IL2A 3TFIA 2R7ZA 3S1QC 4A93C 4GTBA 3HOXK 2E2HK 4A3JC 3GTLA 3NUHA 3I4NK 4LJZA 3M3YK 2ZJQS 4FM9A 2JA5C 1TWHK 1O2FB 4M1XA 5C3EK 1YNJA 1VH2A 4OIPA 1I3QC 3OEPA 4P5AA 4G0VA 1GE9A 1TWFK 4X6AC 1J6WA 1G51A 5TMCA 2PA8D 2CFAB 3K7AC 1Y1VC 5M5WK 3GTMC 3T02A 2JA8C 1I50A 4MQ9A 4BY1C 1ZQ1C 4XSXA 1XZPB 1Y1WK 1C0AA 2R7ZK 3S15C 2Y0SL 1F7VA 4GTDA 3GTLK 1XXAA 4A3IC 4A3GC 4BY7K 1PJ6A 2GSNA 2R92A 1ZYRA 3A8IA 3DLLS 4BBSK 3V4GA 1WOOA 3LYWA 5DM6S 2B63C 3H3VL 5IP7K 4KMHA 1F93A 3TTGA 1I50K 2WAQD 2GAGC 5IP9K 4AYBD 2E2JK 1USOA 2GSOA 4FZBA 1WIHA 4KMUA 4G7OA 1O24A 3L4KA 2NVXA 4DDQA 2PMZD 2A6HA 1VRQC 4XSZA 4KATA 2R92K 5TJ3A 4BLAA 2E2IA 2R93A 1IQ0A 1WOSA 3PO3C 3SZZA 1YCLA 3BUEA 4KM8A 4OIQA 3GTGC 4A3MC 2WB1D 5FLMK 3GTPC 3S17C 2CFAA 2JA5A 4KMDA 3PO2K 3L4JA 1I3QA 2ZJRS 3HXAA 3HOZC 1O27A 4Q5SA 1XZPA 3HOYC 4G0UA 1L0WA 2NVXK 1IW7A 3S1NC 5L46A 1B4AA 1Y1VA 2VUMK 3GTMA 3G4AA 3S14C 2NVYK 2YU9C 4BBRK 2A68A 1WQFA 2ZUFA 1IS1A 4Y7NK 2E2IK 2R93K 5IOSA 2JA6C 3GEIA 2A69A 3I4MC 5IOQA 3S1QK 4MEXA 4A93K 2O5IA 4XLNA 4A3JK 4JK1A 3JSTA 5M3FK 3S2DK 5JVGS 2JA5K 1I3QK 4X6AK 4YG2A 2CW0A 2D6FC 2B63A 3GTOC 5IYCC 4A3BC 4GT9A 1Y1VK 4GTAA 1RU0A 3GTMK 4IOAS 4BY1K 2Y0SD 3OPFA 4GFQA 3AD9C 4WILA 4KM9A 4KDDA 1PJ7A 3S15K 3CF5S 1TWAC 4QJVA 3A8JA 4C45A 4A3IK 4A3GK 1TWGC 3CQZC 5C4JC 4P9SA 1R9TC 1FEUA 4KMAA 4LR2A 3FOEA 4YFKA 4KB2A 4WFBS 2RGRA 4LQYA 1XPPA 3AD7C 1BS2A 3H3VD 2NVTK 3WODA 5IORA 4LK0A 4KASA 3GTGA 2FQOA 5CJ9A 3GTPA 3BP8C 1XZQA 3H0GC 1ZBSA 4RMFA 4IOCS 4WFNS 4WF9S 4LLGA 1ZXOA 3RZDC 5IYDK 4WCES 5JVHS 1I6HC 2YU9A 5C44C 1UV7A 3FKIA 4A3DC 2JA6A 2ZFZA 3GIRA 3QX3A 1JOEA 4G0WA 2L3UA 4GTCA 2ZJPS 3Q3QA 2A6EA 1WOPA 4P5BA 3GTGK 4C3JC 5HL7S 3GEEA 3GTPK 3S17K 5DM7S 3HOZK 4J3NA 4A3CC 4LK1A 3GTOA 1F9NA 3S1NK 3DXJA 1O28A 1F7UA 3S14K 2P5MA 2GSUA 5C3EC 4A3FC 1EH1A 3FKIK 1SFOC 2JA6K 4WFAS 4A3LK 4KN4A
chains in the Genus database with same CATH topology
4XLPA 2JA6C 2A69A 3I4MC 3S1QK 4MEXA 4A93K 4A3MK 2E2IC 2R93C 2O5IA 4QIWL 4XLNA 3S1QC 4A3JK 4JK1A 4A93C 4GZYA 1I6VA 5M3FK 3S2DK 3HOXK 2E2HK 4MEYA 4A3JC 2JA5K 4OIRA 4OINA 3I4NK 4LJZA 3RZOK 3HOXC 2E2HC 3M3YK 3HOYK 1I3QK 3HOWK 2JA5C 1TWHK 3GTOK 3I4NC 5IYCK 1WCMK 3RZOC 3M3YC 5C3EK 1YNJA 3M4OK 4OIPA 1I3QC 2CW0A 4YG2A 3HOWC 2R93K 4X6AK 1TWHC 3GTOC 2YU9K 5IYCC 1WCMC 2NVTC 3M4OC 4A3BC 4X6AC 1K83K 1TWFK 1Y1VK 3GTMK 5TMCA 1TWFC 1K83C 2PA8D 3HOUK 3K7AC 4BY1K 3I4MK 4BBSC 1Y1VC 5M5WK 3GTMC 2Y0SD 2JA8C 3HOUC 4MQ9A 4BY1C 2E2IK 4ZH4A 4XSXA 3S15K 1Y1WK 3GTQK 1TWGK 5M3MK 1TWAC 2PA8L 3CQZK 5C4JK 4A3EK 2R7ZK 4QJVA 3S15C 1Y1WC 3GTQC 2Y0SL 1TWGC 2BE5A 4A3IK 3CQZC 4A3GK 5D4DA 5C4JC 4A3EC 2R7ZC 4G7ZA 4C3HK 3GTLK 4KN7A 4NOIA 1R9TC 4A3IC 4YFKA 1BDFA 4A3GC 4BY7K 3S2HK 1XPPA 4C3HC 5IYDC 3EQLA 3GTLC 3H3VD 2NVTK 3GTJK 4BY7C 1ZYRA 3S2HC 3WODA 3S16K 4LK0A 4YFXA 3GTJC 3K7AK 1HQMA 4BBSK 4QJVB 3S16C 3HOVK 2B63C 2JA8K 3H3VL 5IP7K 5C4XK 3HOVC 1TWAK 1I50K 2WAQD 5IP7C 3H0GC 5IP9K 4OIOA 4AYBD 4A3KK 2E2JK 5TMFA 5C4XC 2NVQK 1YNNA 1I50C 4LLGA 4A3KC 5IP9C 2E2JC 2NVQC 5FLMC 1SMYA 4KMUA 1R9TK 1I6HK 4G7OA 3RZDC 2WAQL 5IYDK 4AYBL 4A3BK 4A3DK 1I6HC 5C44C 4G7HA 4BXXK 3HKZD 2PMZD 4A3DC 4Q4ZA 2A6HA 4XSZA 4BXXC 2R92K 3S1MK 1TWCK 2JA7K 3FKIC 2VUMC 2B63K 4C3JK 2NVYC 2R92C 4BBRC 3S1MC 3HKZL 3PO3C 1TWCC 2JA7C 2A6EA 2PMZL 3GTGK 4YFNA 4C3JC 4Y7NC 4A3LC 4C3IK 3H0GK 3GTPK 3S17K 4OIQA 3GTGC 4A3MC 4C3IC 4A3CK 2WB1D 5FLMK 3GTPC 3S17C 3HOZK 2PPBA 3PO2K 3S2DC 3RZDK 4A3CC 4LK1A 5M5YK 3HOZC 5C44K 3S1NK 3DXJA 5IYBK 3S1RK 3PO2C 4Y52K 4Q5SA 3HOYC 2WB1L 4A3FK 2NVXK 1IW7A 3S1NC 3S14K 5IYBC 3S1RC 4C2MK 4Y52C 1SFOK 5C3EC 4A3FC 3FKIK 2O5JA 2VUMK 2NVXC 3S14C 2NVYK 4QIWD 2YU9C 4C2MC 1SFOC 5FJ8K 4BBRK 2JA6K 2A68A 3GTKK 3PO3K 5M5XK 4A3LK 4Y7NK 4KN4A 3GTKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP A;  2JA6 C;  2A69 A;  3I4M C;  3S1Q K;  4MEX A;  4A93 K;  4A3M K;  2E2I C;  2R93 C;  2O5I A;  4QIW L;  4XLN A;  3S1Q C;  4A3J K;  4JK1 A;  4A93 C;  4GZY A;  1I6V A;  5M3F K;  3S2D K;  3HOX K;  2E2H K;  4MEY A;  4A3J C;  2JA5 K;  4OIR A;  4OIN A;  3I4N K;  4LJZ A;  3RZO K;  3HOX C;  2E2H C;  3M3Y K;  3HOY K;  1I3Q K;  3HOW K;  2JA5 C;  1TWH K;  3GTO K;  3I4N C;  5IYC K;  1WCM K;  3RZO C;  3M3Y C;  5C3E K;  1YNJ A;  3M4O K;  4OIP A;  1I3Q C;  2CW0 A;  4YG2 A;  3HOW C;  2R93 K;  4X6A K;  1TWH C;  3GTO C;  2YU9 K;  5IYC C;  1WCM C;  2NVT C;  3M4O C;  4A3B C;  4X6A C;  1K83 K;  1TWF K;  1Y1V K;  3GTM K;  5TMC A;  1TWF C;  1K83 C;  2PA8 D;  3HOU K;  3K7A C;  4BY1 K;  3I4M K;  4BBS C;  1Y1V C;  5M5W K;  3GTM C;  2Y0S D;  2JA8 C;  3HOU C;  4MQ9 A;  4BY1 C;  2E2I K;  4ZH4 A;  4XSX A;  3S15 K;  1Y1W K;  3GTQ K;  1TWG K;  5M3M K;  1TWA C;  2PA8 L;  3CQZ K;  5C4J K;  4A3E K;  2R7Z K;  4QJV A;  3S15 C;  1Y1W C;  3GTQ C;  2Y0S L;  1TWG C;  2BE5 A;  4A3I K;  3CQZ C;  4A3G K;  5D4D A;  5C4J C;  4A3E C;  2R7Z C;  4G7Z A;  4C3H K;  3GTL K;  4KN7 A;  4NOI A;  1R9T C;  4A3I C;  4YFK A;  1BDF A;  4A3G C;  4BY7 K;  3S2H K;  1XPP A;  4C3H C;  5IYD C;  3EQL A;  3GTL C;  3H3V D;  2NVT K;  3GTJ K;  4BY7 C;  1ZYR A;  3S2H C;  3WOD A;  3S16 K;  4LK0 A;  4YFX A;  3GTJ C;  3K7A K;  1HQM A;  4BBS K;  4QJV B;  3S16 C;  3HOV K;  2B63 C;  2JA8 K;  3H3V L;  5IP7 K;  5C4X K;  3HOV C;  1TWA K;  1I50 K;  2WAQ D;  5IP7 C;  3H0G C;  5IP9 K;  4OIO A;  4AYB D;  4A3K K;  2E2J K;  5TMF A;  5C4X C;  2NVQ K;  1YNN A;  1I50 C;  4LLG A;  4A3K C;  5IP9 C;  2E2J C;  2NVQ C;  5FLM C;  1SMY A;  4KMU A;  1R9T K;  1I6H K;  4G7O A;  3RZD C;  2WAQ L;  5IYD K;  4AYB L;  4A3B K;  4A3D K;  1I6H C;  5C44 C;  4G7H A;  4BXX K;  3HKZ D;  2PMZ D;  4A3D C;  4Q4Z A;  2A6H A;  4XSZ A;  4BXX C;  2R92 K;  3S1M K;  1TWC K;  2JA7 K;  3FKI C;  2VUM C;  2B63 K;  4C3J K;  2NVY C;  2R92 C;  4BBR C;  3S1M C;  3HKZ L;  3PO3 C;  1TWC C;  2JA7 C;  2A6E A;  2PMZ L;  3GTG K;  4YFN A;  4C3J C;  4Y7N C;  4A3L C;  4C3I K;  3H0G K;  3GTP K;  3S17 K;  4OIQ A;  3GTG C;  4A3M C;  4C3I C;  4A3C K;  2WB1 D;  5FLM K;  3GTP C;  3S17 C;  3HOZ K;  2PPB A;  3PO2 K;  3S2D C;  3RZD K;  4A3C C;  4LK1 A;  5M5Y K;  3HOZ C;  5C44 K;  3S1N K;  3DXJ A;  5IYB K;  3S1R K;  3PO2 C;  4Y52 K;  4Q5S A;  3HOY C;  2WB1 L;  4A3F K;  2NVX K;  1IW7 A;  3S1N C;  3S14 K;  5IYB C;  3S1R C;  4C2M K;  4Y52 C;  1SFO K;  5C3E C;  4A3F C;  3FKI K;  2O5J A;  2VUM K;  2NVX C;  3S14 C;  2NVY K;  4QIW D;  2YU9 C;  4C2M C;  1SFO C;  5FJ8 K;  4BBR K;  2JA6 K;  2A68 A;  3GTK K;  3PO3 K;  5M5X K;  4A3L K;  4Y7N K;  4KN4 A;  3GTK C; 
#chains in the Genus database with same CATH topology
 3PIO S;  1TWG A;  3CQZ A;  4QIW L;  1ZVU A;  1R9T A;  1I6V A;  1V5V A;  4MEY A;  3AD8 C;  4OIR A;  1J98 A;  1DCH A;  4BKW A;  1VLO A;  3GDZ A;  3GTO K;  3AH5 A;  5IYC K;  3RZO C;  4A3B K;  3HOW C;  2P8T A;  1EK8 A;  4U67 S;  1WCM C;  3M4O C;  4PAB A;  1BGW A;  2FQT A;  5JFE A;  1K83 C;  3H0G A;  3S0X A;  4BBS C;  1DCO A;  4KAR A;  2XCR B;  3HOU C;  4ZH4 A;  2JH3 A;  1TWG K;  3CQZ K;  5C4J K;  4LOW A;  3GTQ C;  2BE5 A;  5D4D A;  4A3E C;  4G7Z A;  1HI9 A;  4KN7 A;  5HQH A;  1PJ5 A;  1BDF A;  4C3H C;  4AH6 A;  3EQL A;  1WQH A;  2KXY A;  3S2H C;  3VA7 A;  3GTJ C;  3K7A K;  3S16 C;  4WJ4 A;  5IOT A;  2JA8 K;  3HOV C;  3LAP A;  4OIO A;  5C4X C;  1YNN A;  4A3K C;  2NVQ C;  5FLM C;  1SMY A;  2KPU A;  1EQR A;  1I6H K;  1JQW A;  4GTF A;  3G4C A;  3AQO A;  4A3D K;  1SFO A;  4GTE A;  4Q4Z A;  4XCH A;  5E68 A;  4BXX C;  1IBA A;  2VUM C;  2B63 K;  4C3J K;  2NVY C;  4BBR C;  3S1M C;  3HKZ L;  4O2D A;  1TWC C;  2JA7 C;  4KC6 A;  1AB4 A;  4Y7N C;  3TFJ A;  4C3I C;  4A3C K;  2PPB A;  3S2D C;  5CHP A;  1O2A A;  3LAJ A;  5M5Y K;  1WCM A;  2V6S A;  4A3F K;  5IYB C;  3S1R C;  1K83 A;  4Y52 C;  1SFO K;  1USM A;  1O26 A;  4QIW D;  4C2M C;  5JVO A;  1KQ4 A;  2V6T A;  3PO3 K;  3GTK C;  4XLP A;  1IE0 A;  4A3M K;  3GTQ A;  4GZY A;  3GEH A;  4OIN A;  3RZO K;  3HOX C;  2E2H C;  3T00 A;  3HOY K;  3HOW K;  1VJE A;  4KB4 A;  3I4N C;  3GTJ A;  2W7V A;  1WCM K;  2XCQ A;  3M3Y C;  3M4O K;  3GSI A;  1TWH C;  1B4B A;  2YU9 K;  2NVT C;  1K83 K;  4BLB A;  1EI6 A;  1X31 C;  1JVI A;  1TWF C;  3HOU K;  3I4M K;  5HL8 A;  3LPX A;  1XXB A;  1TWA A;  2XCO A;  2ZUE A;  3GTQ K;  5M3M K;  1J6X A;  2PA8 L;  4A3E K;  3T01 A;  4PAA A;  1Y1W C;  1WOR A;  2R7Z C;  4C3H K;  1WSR A;  2RH6 A;  4NOI A;  3S2H K;  2VUM A;  5IYD C;  3GTL C;  2NVY A;  3GTJ K;  4BY7 C;  1TWC A;  1O25 A;  3S16 K;  2JA7 A;  1DCP A;  1INN A;  4YFX A;  1HQM A;  4QJV B;  1YX2 A;  1O2B A;  3HOV K;  5C4X K;  2KQ1 A;  2KWA A;  3SZY A;  1TWA K;  5IP7 C;  4A3K K;  2GAH C;  2NVQ K;  5TMF A;  1WQG A;  4ILD A;  1I50 C;  5IP9 C;  2E2J C;  1R9T K;  3N0B A;  3BP3 A;  1BJT A;  2WAQ L;  4AYB L;  3N3Y A;  4G7H A;  3ADA C;  4BXX K;  3HKZ D;  4KAW X;  3GTK A;  1XZQ B;  1J6V A;  3AQP A;  3FOF A;  3S1M K;  3A8K A;  1TWC K;  2JA7 K;  3FKI C;  1O29 A;  2PHC B;  3MML B;  2R92 C;  2PMZ L;  4YFN A;  4A3L C;  1WSV A;  4C3I K;  3H0G K;  4GTL A;  2E2H A;  3ERE D;  1DD5 A;  3RZD K;  1XXC A;  2Y3P A;  4IO9 S;  1TWH A;  5C44 K;  5IYB K;  3S1R K;  2EBB A;  3PO2 C;  4Y52 K;  1EFW A;  2WB1 L;  3PIP S;  3N0C A;  1TWF A;  4C2M K;  1ISE A;  2V6U A;  3TFH A;  2O5J A;  2NVX C;  3CAG A;  5EGE A;  5FJ8 K;  3GTK K;  4WJ3 M;  3IPJ A;  2L5N A;  3ORE A;  1VGX A;  5M5X K;  3FHZ A;  5EGH A;  2E2I C;  1Y1W A;  2R93 C;  1IL2 A;  3TFI A;  2R7Z A;  3S1Q C;  4A93 C;  4GTB A;  3HOX K;  2E2H K;  4A3J C;  3GTL A;  3NUH A;  3I4N K;  4LJZ A;  3M3Y K;  2ZJQ S;  4FM9 A;  2JA5 C;  1TWH K;  1O2F B;  4M1X A;  5C3E K;  1YNJ A;  1VH2 A;  4OIP A;  1I3Q C;  3OEP A;  4P5A A;  4G0V A;  1GE9 A;  1TWF K;  4X6A C;  1J6W A;  1G51 A;  5TMC A;  2PA8 D;  2CFA B;  3K7A C;  1Y1V C;  5M5W K;  3GTM C;  3T02 A;  2JA8 C;  1I50 A;  4MQ9 A;  4BY1 C;  1ZQ1 C;  4XSX A;  1XZP B;  1Y1W K;  1C0A A;  2R7Z K;  3S15 C;  2Y0S L;  1F7V A;  4GTD A;  3GTL K;  1XXA A;  4A3I C;  4A3G C;  4BY7 K;  1PJ6 A;  2GSN A;  2R92 A;  1ZYR A;  3A8I A;  3DLL S;  4BBS K;  3V4G A;  1WOO A;  3LYW A;  5DM6 S;  2B63 C;  3H3V L;  5IP7 K;  4KMH A;  1F93 A;  3TTG A;  1I50 K;  2WAQ D;  2GAG C;  5IP9 K;  4AYB D;  2E2J K;  1USO A;  2GSO A;  4FZB A;  1WIH A;  4KMU A;  4G7O A;  1O24 A;  3L4K A;  2NVX A;  4DDQ A;  2PMZ D;  2A6H A;  1VRQ C;  4XSZ A;  4KAT A;  2R92 K;  5TJ3 A;  4BLA A;  2E2I A;  2R93 A;  1IQ0 A;  1WOS A;  3PO3 C;  3SZZ A;  1YCL A;  3BUE A;  4KM8 A;  4OIQ A;  3GTG C;  4A3M C;  2WB1 D;  5FLM K;  3GTP C;  3S17 C;  2CFA A;  2JA5 A;  4KMD A;  3PO2 K;  3L4J A;  1I3Q A;  2ZJR S;  3HXA A;  3HOZ C;  1O27 A;  4Q5S A;  1XZP A;  3HOY C;  4G0U A;  1L0W A;  2NVX K;  1IW7 A;  3S1N C;  5L46 A;  1B4A A;  1Y1V A;  2VUM K;  3GTM A;  3G4A A;  3S14 C;  2NVY K;  2YU9 C;  4BBR K;  2A68 A;  1WQF A;  2ZUF A;  1IS1 A;  4Y7N K;  2E2I K;  2R93 K;  5IOS A;  2JA6 C;  3GEI A;  2A69 A;  3I4M C;  5IOQ A;  3S1Q K;  4MEX A;  4A93 K;  2O5I A;  4XLN A;  4A3J K;  4JK1 A;  3JST A;  5M3F K;  3S2D K;  5JVG S;  2JA5 K;  1I3Q K;  4X6A K;  4YG2 A;  2CW0 A;  2D6F C;  2B63 A;  3GTO C;  5IYC C;  4A3B C;  4GT9 A;  1Y1V K;  4GTA A;  1RU0 A;  3GTM K;  4IOA S;  4BY1 K;  2Y0S D;  3OPF A;  4GFQ A;  3AD9 C;  4WIL A;  4KM9 A;  4KDD A;  1PJ7 A;  3S15 K;  3CF5 S;  1TWA C;  4QJV A;  3A8J A;  4C45 A;  4A3I K;  4A3G K;  1TWG C;  3CQZ C;  5C4J C;  4P9S A;  1R9T C;  1FEU A;  4KMA A;  4LR2 A;  3FOE A;  4YFK A;  4KB2 A;  4WFB S;  2RGR A;  4LQY A;  1XPP A;  3AD7 C;  1BS2 A;  3H3V D;  2NVT K;  3WOD A;  5IOR A;  4LK0 A;  4KAS A;  3GTG A;  2FQO A;  5CJ9 A;  3GTP A;  3BP8 C;  1XZQ A;  3H0G C;  1ZBS A;  4RMF A;  4IOC S;  4WFN S;  4WF9 S;  4LLG A;  1ZXO A;  3RZD C;  5IYD K;  4WCE S;  5JVH S;  1I6H C;  2YU9 A;  5C44 C;  1UV7 A;  3FKI A;  4A3D C;  2JA6 A;  2ZFZ A;  3GIR A;  3QX3 A;  1JOE A;  4G0W A;  2L3U A;  4GTC A;  2ZJP S;  3Q3Q A;  2A6E A;  1WOP A;  4P5B A;  3GTG K;  4C3J C;  5HL7 S;  3GEE A;  3GTP K;  3S17 K;  5DM7 S;  3HOZ K;  4J3N A;  4A3C C;  4LK1 A;  3GTO A;  1F9N A;  3S1N K;  3DXJ A;  1O28 A;  1F7U A;  3S14 K;  2P5M A;  2GSU A;  5C3E C;  4A3F C;  1EH1 A;  3FKI K;  1SFO C;  2JA6 K;  4WFA S;  4A3L K;  4KN4 A; 
#chains in the Genus database with same CATH homology
 4XLP A;  2JA6 C;  2A69 A;  3I4M C;  3S1Q K;  4MEX A;  4A93 K;  4A3M K;  2E2I C;  2R93 C;  2O5I A;  4QIW L;  4XLN A;  3S1Q C;  4A3J K;  4JK1 A;  4A93 C;  4GZY A;  1I6V A;  5M3F K;  3S2D K;  3HOX K;  2E2H K;  4MEY A;  4A3J C;  2JA5 K;  4OIR A;  4OIN A;  3I4N K;  4LJZ A;  3RZO K;  3HOX C;  2E2H C;  3M3Y K;  3HOY K;  1I3Q K;  3HOW K;  2JA5 C;  1TWH K;  3GTO K;  3I4N C;  5IYC K;  1WCM K;  3RZO C;  3M3Y C;  5C3E K;  1YNJ A;  3M4O K;  4OIP A;  1I3Q C;  2CW0 A;  4YG2 A;  3HOW C;  2R93 K;  4X6A K;  1TWH C;  3GTO C;  2YU9 K;  5IYC C;  1WCM C;  2NVT C;  3M4O C;  4A3B C;  4X6A C;  1K83 K;  1TWF K;  1Y1V K;  3GTM K;  5TMC A;  1TWF C;  1K83 C;  2PA8 D;  3HOU K;  3K7A C;  4BY1 K;  3I4M K;  4BBS C;  1Y1V C;  5M5W K;  3GTM C;  2Y0S D;  2JA8 C;  3HOU C;  4MQ9 A;  4BY1 C;  2E2I K;  4ZH4 A;  4XSX A;  3S15 K;  1Y1W K;  3GTQ K;  1TWG K;  5M3M K;  1TWA C;  2PA8 L;  3CQZ K;  5C4J K;  4A3E K;  2R7Z K;  4QJV A;  3S15 C;  1Y1W C;  3GTQ C;  2Y0S L;  1TWG C;  2BE5 A;  4A3I K;  3CQZ C;  4A3G K;  5D4D A;  5C4J C;  4A3E C;  2R7Z C;  4G7Z A;  4C3H K;  3GTL K;  4KN7 A;  4NOI A;  1R9T C;  4A3I C;  4YFK A;  1BDF A;  4A3G C;  4BY7 K;  3S2H K;  1XPP A;  4C3H C;  5IYD C;  3EQL A;  3GTL C;  3H3V D;  2NVT K;  3GTJ K;  4BY7 C;  1ZYR A;  3S2H C;  3WOD A;  3S16 K;  4LK0 A;  4YFX A;  3GTJ C;  3K7A K;  1HQM A;  4BBS K;  4QJV B;  3S16 C;  3HOV K;  2B63 C;  2JA8 K;  3H3V L;  5IP7 K;  5C4X K;  3HOV C;  1TWA K;  1I50 K;  2WAQ D;  5IP7 C;  3H0G C;  5IP9 K;  4OIO A;  4AYB D;  4A3K K;  2E2J K;  5TMF A;  5C4X C;  2NVQ K;  1YNN A;  1I50 C;  4LLG A;  4A3K C;  5IP9 C;  2E2J C;  2NVQ C;  5FLM C;  1SMY A;  4KMU A;  1R9T K;  1I6H K;  4G7O A;  3RZD C;  2WAQ L;  5IYD K;  4AYB L;  4A3B K;  4A3D K;  1I6H C;  5C44 C;  4G7H A;  4BXX K;  3HKZ D;  2PMZ D;  4A3D C;  4Q4Z A;  2A6H A;  4XSZ A;  4BXX C;  2R92 K;  3S1M K;  1TWC K;  2JA7 K;  3FKI C;  2VUM C;  2B63 K;  4C3J K;  2NVY C;  2R92 C;  4BBR C;  3S1M C;  3HKZ L;  3PO3 C;  1TWC C;  2JA7 C;  2A6E A;  2PMZ L;  3GTG K;  4YFN A;  4C3J C;  4Y7N C;  4A3L C;  4C3I K;  3H0G K;  3GTP K;  3S17 K;  4OIQ A;  3GTG C;  4A3M C;  4C3I C;  4A3C K;  2WB1 D;  5FLM K;  3GTP C;  3S17 C;  3HOZ K;  2PPB A;  3PO2 K;  3S2D C;  3RZD K;  4A3C C;  4LK1 A;  5M5Y K;  3HOZ C;  5C44 K;  3S1N K;  3DXJ A;  5IYB K;  3S1R K;  3PO2 C;  4Y52 K;  4Q5S A;  3HOY C;  2WB1 L;  4A3F K;  2NVX K;  1IW7 A;  3S1N C;  3S14 K;  5IYB C;  3S1R C;  4C2M K;  4Y52 C;  1SFO K;  5C3E C;  4A3F C;  3FKI K;  2O5J A;  2VUM K;  2NVX C;  3S14 C;  2NVY K;  4QIW D;  2YU9 C;  4C2M C;  1SFO C;  5FJ8 K;  4BBR K;  2JA6 K;  2A68 A;  3GTK K;  3PO3 K;  5M5X K;  4A3L K;  4Y7N K;  4KN4 A;  3GTK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...