2CW0A

Crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation
pubmed doi rcsb
total genus 36
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2cw0A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2cw0A01
3S1NC 3PO3K 2WB1L 4A3JC 3RZOK 4BXXK 4Y52C 3HOVK 5C44K 4OIOA 4XSXA 4QIWD 4MEXA 1WCMC 1YNJA 3M3YC 1TWGK 3S17C 4LLGA 2R92K 3S1RK 3GTGC 4OINA 3GTJK 4NOIA 3GTQC 2B63K 2JA8C 3GTLK 3S15K 1TWHC 4MQ9A 2PA8D 3CQZC 4A3CC 5IYCC 2PPBA 3I4MK 3HOYC 1TWCK 1I6VA 5IYDK 3DXJA 1R9TC 5M5XK 3S16C 2NVYK 2NVXK 2YU9K 4BY1K 2E2IK 2VUMC 3HOUK 4A3DK 1SFOK 2A68A 3FKIC 4QJVA 2A6HA 1HQMA 5C4JK 3S1MK 4C2MK 4A3IK 4BY7K 3K7AK 3RZDK 5D4DA 2PMZD 4XSZA 3S14K 3S2HC 1Y1VK 2Y0SD 3GTKK 2E2HK 3I4NC 4A3FC 4X6AC 5M3MK 4A3LK 4A3KC 2NVQK 1IW7A 4Q5SA 3M4OK 2JA6C 4A3EK 3H0GK 3GTPK 3GTMK 4C3IC 5IP9K 3H3VD 3HKZD 1TWAK 2JA7C 3GTOK 3S2DK 1Y1WK 4A3BK 4A3JK 4C3JC 4A3GC 2R7ZK 4C3HC 4G7OA 4LJZA 3S1QK 4GZYA 3WODA 3PO3C 2O5JA 3RZOC 4BXXC 3PO2K 1BDFA 5IP7K 1I50K 5C3EK 5C44C 1I6HK 4QIWL 4G7HA 3H3VL 1I3QK 2R92C 1TWGC 4KMUA 3HOXK 2JA5K 2R93K 1YNNA 3S1RC 4OIRA 3GTJC 4BBSK 2CW0A 3GTLC 2PA8L 2B63C 5M5WK 2A69A 3S15C 1XPPA 2E2JK 4AYBD 5IYBK 2NVTK 4ZH4A 4OIQA 1TWCC 3I4MC 4A3MK 4BBRK 3HOWK 4Y7NK 4A93K 5FJ8K 5FLMC 4BY1C 4KN7A 2YU9C 2NVYC 5TMFA 2E2IC 2WAQL 3HOUC 4A3DC 1SFOC 5C4JC 5M3FK 4G7ZA 4BY7C 3S1MC 1K83K 2PMZL 4C2MC 4A3IC 1TWFK 3K7AC 3RZDC 2Y0SL 5C4XK 3S1NK 3S14C 4X6AK 1Y1VC 2WAQD 3GTKC 3HOZC 4Y52K 4OIPA 4A3LC 4MEYA 4LK0A 4YFXA 1WCMK 3M3YK 3S17K 3HKZL 4JK1A 4A3EC 3GTGK 3GTPC 3GTMC 3GTQK 1SMYA 5IP9C 2JA8K 3HOZK 1TWAC 1TWHK 4XLNA 3GTOC 3S2DC 3CQZK 4QJVB 4A3CK 1Y1WC 4A3BC 5IYCK 2R7ZC 4Q4ZA 3S1QC 5M5YK 3HOYK 2O5IA 3PO2C 2BE5A 1R9TK 3S16K 5IP7C 1I50C 5C3EC 5IYDC 1I6HC 2VUMK 1I3QC 2NVXC 3FKIK 2R93C 2JA5C 3HOXC 4BBSC 4AYBL 3S2HK 2A6EA 4YG2A 4XLPA 2E2JC 3EQLA 5IYBC 2NVTC 4YFKA 3I4NK 4A3FK 5TMCA 5FLMK 4A3KK 4LK1A 4BBRC 2WB1D 4A3MC 4Y7NC 2E2HC 3HOWC 4A93C 2JA6K 1ZYRA 4C3IK 2NVQC 4KN4A 3M4OC 4YFNA 2JA7K 3H0GC 3HOVC 4C3JK 4A3GK 1K83C 4C3HK 5C4XC 1TWFC
chains in the Genus database with same CATH superfamily
3GEHA 3PO3K 4GTDA 1WORA 4QIWD 4MEXA 1YNJA 3Q3QA 3OREA 4J3NA 4BLBA 4NOIA 2B63K 4GTCA 1O2FB 3T01A 4MQ9A 1YX2A 2PA8D 4A3CC 1F9NA 4O2DA 3VA7A 2NVYK 3QX3A 5E68A 2E2IK 4A3DK 1WSVA 4QJVA 1WCMA 2A6HA 3S1MK 1PJ7A 2GSNA 4XSZA 4GTBA 3S2HC 1ZQ1C 3GTKK 3CQZA 1VLOA 4X6AC 2GSOA 5M3MK 3M4OK 3JSTA 1DCHA 2JA6C 3H0GK 3GTPK 1TWAK 2JA7C 1O2BA 3FKIA 4C3JC 3L4KA 3WODA 3PO3C 4M1XA 3FOEA 4IOCS 1DD5A 1I6HK 1I3QK 4KMUA 4IOAS 5M5WK 2B63C 1UV7A 1XPPA 4AYBD 2NVTK 3A8IA 1BGWA 4OIQA 3ADAC 4BBRK 3G4AA 4Y7NK 2PHCB 4A93K 2V6SA 2CFAA 2NVYC 2E2IC 3PIOS 1XXCA 4A3DC 4IO9S 1V5VA 3A8KA 1K83K 3S1MC 5C4XK 2Y0SL 2EBBA 3GTJA 2WAQD 3GTKC 1BS2A 4Y52K 1XXBA 1WSRA 1TWCA 1L0WA 5L46A 3M3YK 3GTGK 3N0BA 3GTPC 2NVXA 3GTQK 1SMYA 2JA8K 1TWAC 1TWHK 4QJVB 3GIRA 4GTLA 5IYDC 1I6HC 3ERED 1I3QC 4KDDA 1X31C 2FQTA 3I4NK 2NVTC 5TMCA 1IQ0A 3S0XA 4BBRC 4Y7NC 4A93C 4GTAA 4LQYA 4PABA 5IORA 1O25A 4A3GK 1K83C 3HOZK 5C4XC 4WJ4A 1O28A 1WOOA 4A3JC 5IOSA 4Y52C 4PAAA 5IOTA 3M3YC 5EGEA 4LLGA 3GTGC 2CFAB 4OINA 3GTQC 2JA8C 3S15K 1TWHC 3LAPA 3L4JA 4BY1K 2ZUEA 2JA6A 4KM9A 3HOUK 5C4JK 4BY7K 5CJ9A 2W7VA 4C2MK 1XXAA 3K7AK 1WQHA 3S14K 3OPFA 1USMA 2E2HK 3I4NC 1B4AA 4BLAA 1R9TA 2VUMA 5CHPA 4RMFA 3S2DK 1IS1A 4WCES 2R7ZK 4A3GC 4G7OA 4LJZA 4KC6A 2O5JA 4XCHA 3BUEA 4KARA 1I50K 5C3EK 4G7HA 3FHZA 3AQPA 2R93K 2JA5K 3AD8C 1YNNA 2Y3PA 2A69A 5JVGS 3S15C 2E2JK 5IOQA 4ZH4A 3LYWA 3HOWK 4WFBS 5FLMC 4BY1C 1KQ4A 1XZQA 3BP8C 3HOUC 3HOVK 5C4JC 1TWGA 4BY7C 2PMZL 2L5NA 5M3FK 4C2MC 3T00A 3K7AC 2L3UA 3AD9C 3GTLA 3S14C 3LAJA 4LK0A 1WCMK 3S17K 3HKZL 1WOPA 2YU9A 2V6TA 3S2DC 3CQZK 1EQRA 5IYCK 3AD7C 1SFOA 2R7ZC 1FEUA 1USOA 1Y1VA 4P5BA 3S16K 1I50C 5C3EC 5JFEA 2XCRB 3FKIK 2R93C 2JA5C 4GTFA 3GTMA 4YG2A 2E2JC 1Y1WA 4YFKA 4G0UA 4A3KK 2WB1D 3HOWC 4U67S 2KPUA 3M4OC 4LOWA 4GT9A 3H0GC 3HOVC 3TFJA 2JH3A 3PIPS 4C3HK 1TWHA 5JVHS 2XCOA 4BXXK 4KMAA 1O2AA 1EK8A 1VGXA 3AQOA 3TFIA 2R92K 1WCMC 1EH1A 3S17C 3GTJK 3TTGA 3CF5S 1WQFA 4KB4A 3CQZC 5IYCC 1TWCK 1TWFA 2P5MA 2GSUA 2NVXK 3S16C 1DCPA 2ZFZA 4KMDA 2A68A 3FKIC 1ZXOA 1F93A 1IL2A 4C45A 4ILDA 2Y0SD 2D6FC 4A3KC 2NVQK 4Q5SA 4A3EK 3BP3A 5IP9K 3H3VD 1BJTA 3GTOK 4A3BK 4C3HC 2ZJRS 3GEIA 1IBAA 4GZYA 3MMLB 4BXXC 3PO2K 3DLLS 1BDFA 5IP7K 4LR2A 4QIWL 4KM8A 5HQHA 1J98A 2R92C 3NUHA 2XCQA 3GSIA 3TFHA 3HOXK 4P5AA 3GTJC 2KXYA 2CW0A 5DM6S 2PA8L 2JA7A 1ZVUA 1ISEA 1TWCC 4A3MK 5FJ8K 4FZBA 3N0CA 3GDZA 4G7ZA 3LPXA 1O29A 3S1NK 2B63A 4X6AK 2ZUFA 3HOZC 2RH6A 5EGHA 1JVIA 4G0VA 4A3EC 2RGRA 2NVYA 5IP9C 2R93A 2E2IA 4XLNA 3GTOC 4A3BC 1RU0A 3HOYK 4Q4ZA 5M5YK 1J6WA 1ZBSA 5DM7S 2O5IA 3GTKA 5HL7S 3PO2C 1WIHA 1R9TK 5IP7C 1F7VA 1B4BA 2VUMK 1PJ6A 3HOXC 3H0GA 3GTPA 1J6XA 4P9SA 4AYBL 2A6EA 1TWAA 4XLPA 1O26A 4G0WA 3V4GA 4WFAS 4A3FK 4LK1A 4A3MC 2E2HC 1C0AA 4BKWA 1EI6A 4C3IK 1I3QA 2WAQL 3S1NC 2KQ1A 2WB1L 3RZOK 5C44K 4OIOA 1YCLA 1G51A 4XSXA 5JVOA 1TWGK 3S1RK 1XZPA 3GTLK 1IE0A 1JQWA 2PPBA 1K83A 3I4MK 3HOYC 1I6VA 5IYDK 4GTEA 1O27A 3DXJA 1R9TC 5M5XK 2YU9K 1GE9A 2VUMC 1O24A 3AH5A 1SFOK 3A8JA 2P8TA 1HQMA 3OEPA 4A3IK 3GTGA 3RZDK 5D4DA 2PMZD 3GTQA 1Y1VK 4WJ3M 4AH6A 1HI9A 4A3FC 4A3LK 1IW7A 1PJ5A 4DDQA 1VH2A 4C3IC 3GTMK 2R92A 3HKZD 1VRQC 3N3YA 1Y1WK 1XZQB 4KATA 4A3JK 3S1QK 1WQGA 2KWAA 3RZOC 3G4CA 3IPJA 5C44C 3H3VL 1WOSA 1TWGC 4WF9S 3GEEA 4OIRA 3S1RC 1J6VA 4BBSK 3GTLC 3CAGA 1VJEA 5HL8A 4KAWX 5IYBK 1F7UA 4KMHA 1AB4A 3I4MC 2ZJQS 2GAHC 4GFQA 4KB2A 3FOFA 4KN7A 2YU9C 5TMFA 4FM9A 1SFOC 2V6UA 4A3IC 1TWFK 3RZDC 1XZPB 3GTOA 1Y1VC 1EFWA 4OIPA 3T02A 4A3LC 4MEYA 2GAGC 4YFXA 4JK1A 1INNA 3GTMC 4A3CK 3HXAA 1Y1WC 3S1QC 2BE5A 2E2HA 4WFNS 2JA5A 3SZYA 2FQOA 5TJ3A 2NVXC 4BBSC 1DCOA 3S2HK 3EQLA 5IYBC 5FLMK 2R7ZA 2JA6K 1ZYRA 1I50A 2NVQC 4KN4A 4YFNA 2ZJPS 4WILA 2JA7K 4KASA 4C3JK 3SZZA 1JOEA 1TWFC
chains in the Genus database with same CATH topology
3S1NC 3PO3K 2WB1L 4A3JC 3RZOK 4BXXK 4Y52C 3HOVK 5C44K 4OIOA 4XSXA 4QIWD 4MEXA 1WCMC 1YNJA 3M3YC 1TWGK 3S17C 4LLGA 2R92K 3S1RK 3GTGC 4OINA 3GTJK 4NOIA 3GTQC 2B63K 2JA8C 3GTLK 3S15K 1TWHC 4MQ9A 2PA8D 3CQZC 4A3CC 5IYCC 2PPBA 3I4MK 3HOYC 1TWCK 1I6VA 5IYDK 3DXJA 1R9TC 5M5XK 3S16C 2NVYK 2NVXK 2YU9K 4BY1K 2E2IK 2VUMC 3HOUK 4A3DK 1SFOK 2A68A 3FKIC 4QJVA 2A6HA 1HQMA 5C4JK 3S1MK 4C2MK 4A3IK 4BY7K 3K7AK 3RZDK 5D4DA 2PMZD 4XSZA 3S14K 3S2HC 1Y1VK 2Y0SD 3GTKK 2E2HK 3I4NC 4A3FC 4X6AC 5M3MK 4A3LK 4A3KC 2NVQK 1IW7A 4Q5SA 3M4OK 2JA6C 4A3EK 3H0GK 3GTPK 3GTMK 4C3IC 5IP9K 3H3VD 3HKZD 1TWAK 2JA7C 3GTOK 3S2DK 1Y1WK 4A3BK 4A3JK 4C3JC 4A3GC 2R7ZK 4C3HC 4G7OA 4LJZA 3S1QK 4GZYA 3WODA 3PO3C 2O5JA 3RZOC 4BXXC 3PO2K 1BDFA 5IP7K 1I50K 5C3EK 5C44C 1I6HK 4QIWL 4G7HA 3H3VL 1I3QK 2R92C 1TWGC 4KMUA 3HOXK 2JA5K 2R93K 1YNNA 3S1RC 4OIRA 3GTJC 4BBSK 2CW0A 3GTLC 2PA8L 2B63C 5M5WK 2A69A 3S15C 1XPPA 2E2JK 4AYBD 5IYBK 2NVTK 4ZH4A 4OIQA 1TWCC 3I4MC 4A3MK 4BBRK 3HOWK 4Y7NK 4A93K 5FJ8K 5FLMC 4BY1C 4KN7A 2YU9C 2NVYC 5TMFA 2E2IC 2WAQL 3HOUC 4A3DC 1SFOC 5C4JC 5M3FK 4G7ZA 4BY7C 3S1MC 1K83K 2PMZL 4C2MC 4A3IC 1TWFK 3K7AC 3RZDC 2Y0SL 5C4XK 3S1NK 3S14C 4X6AK 1Y1VC 2WAQD 3GTKC 3HOZC 4Y52K 4OIPA 4A3LC 4MEYA 4LK0A 4YFXA 1WCMK 3M3YK 3S17K 3HKZL 4JK1A 4A3EC 3GTGK 3GTPC 3GTMC 3GTQK 1SMYA 5IP9C 2JA8K 3HOZK 1TWAC 1TWHK 4XLNA 3GTOC 3S2DC 3CQZK 4QJVB 4A3CK 1Y1WC 4A3BC 5IYCK 2R7ZC 4Q4ZA 3S1QC 5M5YK 3HOYK 2O5IA 3PO2C 2BE5A 1R9TK 3S16K 5IP7C 1I50C 5C3EC 5IYDC 1I6HC 2VUMK 1I3QC 2NVXC 3FKIK 2R93C 2JA5C 3HOXC 4BBSC 4AYBL 3S2HK 2A6EA 4YG2A 4XLPA 2E2JC 3EQLA 5IYBC 2NVTC 4YFKA 3I4NK 4A3FK 5TMCA 5FLMK 4A3KK 4LK1A 4BBRC 2WB1D 4A3MC 4Y7NC 2E2HC 3HOWC 4A93C 2JA6K 1ZYRA 4C3IK 2NVQC 4KN4A 3M4OC 4YFNA 2JA7K 3H0GC 3HOVC 4C3JK 4A3GK 1K83C 4C3HK 5C4XC 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N C;  3PO3 K;  2WB1 L;  4A3J C;  3RZO K;  4BXX K;  4Y52 C;  3HOV K;  5C44 K;  4OIO A;  4XSX A;  4QIW D;  4MEX A;  1WCM C;  1YNJ A;  3M3Y C;  1TWG K;  3S17 C;  4LLG A;  2R92 K;  3S1R K;  3GTG C;  4OIN A;  3GTJ K;  4NOI A;  3GTQ C;  2B63 K;  2JA8 C;  3GTL K;  3S15 K;  1TWH C;  4MQ9 A;  2PA8 D;  3CQZ C;  4A3C C;  5IYC C;  2PPB A;  3I4M K;  3HOY C;  1TWC K;  1I6V A;  5IYD K;  3DXJ A;  1R9T C;  5M5X K;  3S16 C;  2NVY K;  2NVX K;  2YU9 K;  4BY1 K;  2E2I K;  2VUM C;  3HOU K;  4A3D K;  1SFO K;  2A68 A;  3FKI C;  4QJV A;  2A6H A;  1HQM A;  5C4J K;  3S1M K;  4C2M K;  4A3I K;  4BY7 K;  3K7A K;  3RZD K;  5D4D A;  2PMZ D;  4XSZ A;  3S14 K;  3S2H C;  1Y1V K;  2Y0S D;  3GTK K;  2E2H K;  3I4N C;  4A3F C;  4X6A C;  5M3M K;  4A3L K;  4A3K C;  2NVQ K;  1IW7 A;  4Q5S A;  3M4O K;  2JA6 C;  4A3E K;  3H0G K;  3GTP K;  3GTM K;  4C3I C;  5IP9 K;  3H3V D;  3HKZ D;  1TWA K;  2JA7 C;  3GTO K;  3S2D K;  1Y1W K;  4A3B K;  4A3J K;  4C3J C;  4A3G C;  2R7Z K;  4C3H C;  4G7O A;  4LJZ A;  3S1Q K;  4GZY A;  3WOD A;  3PO3 C;  2O5J A;  3RZO C;  4BXX C;  3PO2 K;  1BDF A;  5IP7 K;  1I50 K;  5C3E K;  5C44 C;  1I6H K;  4QIW L;  4G7H A;  3H3V L;  1I3Q K;  2R92 C;  1TWG C;  4KMU A;  3HOX K;  2JA5 K;  2R93 K;  1YNN A;  3S1R C;  4OIR A;  3GTJ C;  4BBS K;  2CW0 A;  3GTL C;  2PA8 L;  2B63 C;  5M5W K;  2A69 A;  3S15 C;  1XPP A;  2E2J K;  4AYB D;  5IYB K;  2NVT K;  4ZH4 A;  4OIQ A;  1TWC C;  3I4M C;  4A3M K;  4BBR K;  3HOW K;  4Y7N K;  4A93 K;  5FJ8 K;  5FLM C;  4BY1 C;  4KN7 A;  2YU9 C;  2NVY C;  5TMF A;  2E2I C;  2WAQ L;  3HOU C;  4A3D C;  1SFO C;  5C4J C;  5M3F K;  4G7Z A;  4BY7 C;  3S1M C;  1K83 K;  2PMZ L;  4C2M C;  4A3I C;  1TWF K;  3K7A C;  3RZD C;  2Y0S L;  5C4X K;  3S1N K;  3S14 C;  4X6A K;  1Y1V C;  2WAQ D;  3GTK C;  3HOZ C;  4Y52 K;  4OIP A;  4A3L C;  4MEY A;  4LK0 A;  4YFX A;  1WCM K;  3M3Y K;  3S17 K;  3HKZ L;  4JK1 A;  4A3E C;  3GTG K;  3GTP C;  3GTM C;  3GTQ K;  1SMY A;  5IP9 C;  2JA8 K;  3HOZ K;  1TWA C;  1TWH K;  4XLN A;  3GTO C;  3S2D C;  3CQZ K;  4QJV B;  4A3C K;  1Y1W C;  4A3B C;  5IYC K;  2R7Z C;  4Q4Z A;  3S1Q C;  5M5Y K;  3HOY K;  2O5I A;  3PO2 C;  2BE5 A;  1R9T K;  3S16 K;  5IP7 C;  1I50 C;  5C3E C;  5IYD C;  1I6H C;  2VUM K;  1I3Q C;  2NVX C;  3FKI K;  2R93 C;  2JA5 C;  3HOX C;  4BBS C;  4AYB L;  3S2H K;  2A6E A;  4YG2 A;  4XLP A;  2E2J C;  3EQL A;  5IYB C;  2NVT C;  4YFK A;  3I4N K;  4A3F K;  5TMC A;  5FLM K;  4A3K K;  4LK1 A;  4BBR C;  2WB1 D;  4A3M C;  4Y7N C;  2E2H C;  3HOW C;  4A93 C;  2JA6 K;  1ZYR A;  4C3I K;  2NVQ C;  4KN4 A;  3M4O C;  4YFN A;  2JA7 K;  3H0G C;  3HOV C;  4C3J K;  4A3G K;  1K83 C;  4C3H K;  5C4X C;  1TWF C; 
#chains in the Genus database with same CATH topology
 3GEH A;  3PO3 K;  4GTD A;  1WOR A;  4QIW D;  4MEX A;  1YNJ A;  3Q3Q A;  3ORE A;  4J3N A;  4BLB A;  4NOI A;  2B63 K;  4GTC A;  1O2F B;  3T01 A;  4MQ9 A;  1YX2 A;  2PA8 D;  4A3C C;  1F9N A;  4O2D A;  3VA7 A;  2NVY K;  3QX3 A;  5E68 A;  2E2I K;  4A3D K;  1WSV A;  4QJV A;  1WCM A;  2A6H A;  3S1M K;  1PJ7 A;  2GSN A;  4XSZ A;  4GTB A;  3S2H C;  1ZQ1 C;  3GTK K;  3CQZ A;  1VLO A;  4X6A C;  2GSO A;  5M3M K;  3M4O K;  3JST A;  1DCH A;  2JA6 C;  3H0G K;  3GTP K;  1TWA K;  2JA7 C;  1O2B A;  3FKI A;  4C3J C;  3L4K A;  3WOD A;  3PO3 C;  4M1X A;  3FOE A;  4IOC S;  1DD5 A;  1I6H K;  1I3Q K;  4KMU A;  4IOA S;  5M5W K;  2B63 C;  1UV7 A;  1XPP A;  4AYB D;  2NVT K;  3A8I A;  1BGW A;  4OIQ A;  3ADA C;  4BBR K;  3G4A A;  4Y7N K;  2PHC B;  4A93 K;  2V6S A;  2CFA A;  2NVY C;  2E2I C;  3PIO S;  1XXC A;  4A3D C;  4IO9 S;  1V5V A;  3A8K A;  1K83 K;  3S1M C;  5C4X K;  2Y0S L;  2EBB A;  3GTJ A;  2WAQ D;  3GTK C;  1BS2 A;  4Y52 K;  1XXB A;  1WSR A;  1TWC A;  1L0W A;  5L46 A;  3M3Y K;  3GTG K;  3N0B A;  3GTP C;  2NVX A;  3GTQ K;  1SMY A;  2JA8 K;  1TWA C;  1TWH K;  4QJV B;  3GIR A;  4GTL A;  5IYD C;  1I6H C;  3ERE D;  1I3Q C;  4KDD A;  1X31 C;  2FQT A;  3I4N K;  2NVT C;  5TMC A;  1IQ0 A;  3S0X A;  4BBR C;  4Y7N C;  4A93 C;  4GTA A;  4LQY A;  4PAB A;  5IOR A;  1O25 A;  4A3G K;  1K83 C;  3HOZ K;  5C4X C;  4WJ4 A;  1O28 A;  1WOO A;  4A3J C;  5IOS A;  4Y52 C;  4PAA A;  5IOT A;  3M3Y C;  5EGE A;  4LLG A;  3GTG C;  2CFA B;  4OIN A;  3GTQ C;  2JA8 C;  3S15 K;  1TWH C;  3LAP A;  3L4J A;  4BY1 K;  2ZUE A;  2JA6 A;  4KM9 A;  3HOU K;  5C4J K;  4BY7 K;  5CJ9 A;  2W7V A;  4C2M K;  1XXA A;  3K7A K;  1WQH A;  3S14 K;  3OPF A;  1USM A;  2E2H K;  3I4N C;  1B4A A;  4BLA A;  1R9T A;  2VUM A;  5CHP A;  4RMF A;  3S2D K;  1IS1 A;  4WCE S;  2R7Z K;  4A3G C;  4G7O A;  4LJZ A;  4KC6 A;  2O5J A;  4XCH A;  3BUE A;  4KAR A;  1I50 K;  5C3E K;  4G7H A;  3FHZ A;  3AQP A;  2R93 K;  2JA5 K;  3AD8 C;  1YNN A;  2Y3P A;  2A69 A;  5JVG S;  3S15 C;  2E2J K;  5IOQ A;  4ZH4 A;  3LYW A;  3HOW K;  4WFB S;  5FLM C;  4BY1 C;  1KQ4 A;  1XZQ A;  3BP8 C;  3HOU C;  3HOV K;  5C4J C;  1TWG A;  4BY7 C;  2PMZ L;  2L5N A;  5M3F K;  4C2M C;  3T00 A;  3K7A C;  2L3U A;  3AD9 C;  3GTL A;  3S14 C;  3LAJ A;  4LK0 A;  1WCM K;  3S17 K;  3HKZ L;  1WOP A;  2YU9 A;  2V6T A;  3S2D C;  3CQZ K;  1EQR A;  5IYC K;  3AD7 C;  1SFO A;  2R7Z C;  1FEU A;  1USO A;  1Y1V A;  4P5B A;  3S16 K;  1I50 C;  5C3E C;  5JFE A;  2XCR B;  3FKI K;  2R93 C;  2JA5 C;  4GTF A;  3GTM A;  4YG2 A;  2E2J C;  1Y1W A;  4YFK A;  4G0U A;  4A3K K;  2WB1 D;  3HOW C;  4U67 S;  2KPU A;  3M4O C;  4LOW A;  4GT9 A;  3H0G C;  3HOV C;  3TFJ A;  2JH3 A;  3PIP S;  4C3H K;  1TWH A;  5JVH S;  2XCO A;  4BXX K;  4KMA A;  1O2A A;  1EK8 A;  1VGX A;  3AQO A;  3TFI A;  2R92 K;  1WCM C;  1EH1 A;  3S17 C;  3GTJ K;  3TTG A;  3CF5 S;  1WQF A;  4KB4 A;  3CQZ C;  5IYC C;  1TWC K;  1TWF A;  2P5M A;  2GSU A;  2NVX K;  3S16 C;  1DCP A;  2ZFZ A;  4KMD A;  2A68 A;  3FKI C;  1ZXO A;  1F93 A;  1IL2 A;  4C45 A;  4ILD A;  2Y0S D;  2D6F C;  4A3K C;  2NVQ K;  4Q5S A;  4A3E K;  3BP3 A;  5IP9 K;  3H3V D;  1BJT A;  3GTO K;  4A3B K;  4C3H C;  2ZJR S;  3GEI A;  1IBA A;  4GZY A;  3MML B;  4BXX C;  3PO2 K;  3DLL S;  1BDF A;  5IP7 K;  4LR2 A;  4QIW L;  4KM8 A;  5HQH A;  1J98 A;  2R92 C;  3NUH A;  2XCQ A;  3GSI A;  3TFH A;  3HOX K;  4P5A A;  3GTJ C;  2KXY A;  2CW0 A;  5DM6 S;  2PA8 L;  2JA7 A;  1ZVU A;  1ISE A;  1TWC C;  4A3M K;  5FJ8 K;  4FZB A;  3N0C A;  3GDZ A;  4G7Z A;  3LPX A;  1O29 A;  3S1N K;  2B63 A;  4X6A K;  2ZUF A;  3HOZ C;  2RH6 A;  5EGH A;  1JVI A;  4G0V A;  4A3E C;  2RGR A;  2NVY A;  5IP9 C;  2R93 A;  2E2I A;  4XLN A;  3GTO C;  4A3B C;  1RU0 A;  3HOY K;  4Q4Z A;  5M5Y K;  1J6W A;  1ZBS A;  5DM7 S;  2O5I A;  3GTK A;  5HL7 S;  3PO2 C;  1WIH A;  1R9T K;  5IP7 C;  1F7V A;  1B4B A;  2VUM K;  1PJ6 A;  3HOX C;  3H0G A;  3GTP A;  1J6X A;  4P9S A;  4AYB L;  2A6E A;  1TWA A;  4XLP A;  1O26 A;  4G0W A;  3V4G A;  4WFA S;  4A3F K;  4LK1 A;  4A3M C;  2E2H C;  1C0A A;  4BKW A;  1EI6 A;  4C3I K;  1I3Q A;  2WAQ L;  3S1N C;  2KQ1 A;  2WB1 L;  3RZO K;  5C44 K;  4OIO A;  1YCL A;  1G51 A;  4XSX A;  5JVO A;  1TWG K;  3S1R K;  1XZP A;  3GTL K;  1IE0 A;  1JQW A;  2PPB A;  1K83 A;  3I4M K;  3HOY C;  1I6V A;  5IYD K;  4GTE A;  1O27 A;  3DXJ A;  1R9T C;  5M5X K;  2YU9 K;  1GE9 A;  2VUM C;  1O24 A;  3AH5 A;  1SFO K;  3A8J A;  2P8T A;  1HQM A;  3OEP A;  4A3I K;  3GTG A;  3RZD K;  5D4D A;  2PMZ D;  3GTQ A;  1Y1V K;  4WJ3 M;  4AH6 A;  1HI9 A;  4A3F C;  4A3L K;  1IW7 A;  1PJ5 A;  4DDQ A;  1VH2 A;  4C3I C;  3GTM K;  2R92 A;  3HKZ D;  1VRQ C;  3N3Y A;  1Y1W K;  1XZQ B;  4KAT A;  4A3J K;  3S1Q K;  1WQG A;  2KWA A;  3RZO C;  3G4C A;  3IPJ A;  5C44 C;  3H3V L;  1WOS A;  1TWG C;  4WF9 S;  3GEE A;  4OIR A;  3S1R C;  1J6V A;  4BBS K;  3GTL C;  3CAG A;  1VJE A;  5HL8 A;  4KAW X;  5IYB K;  1F7U A;  4KMH A;  1AB4 A;  3I4M C;  2ZJQ S;  2GAH C;  4GFQ A;  4KB2 A;  3FOF A;  4KN7 A;  2YU9 C;  5TMF A;  4FM9 A;  1SFO C;  2V6U A;  4A3I C;  1TWF K;  3RZD C;  1XZP B;  3GTO A;  1Y1V C;  1EFW A;  4OIP A;  3T02 A;  4A3L C;  4MEY A;  2GAG C;  4YFX A;  4JK1 A;  1INN A;  3GTM C;  4A3C K;  3HXA A;  1Y1W C;  3S1Q C;  2BE5 A;  2E2H A;  4WFN S;  2JA5 A;  3SZY A;  2FQO A;  5TJ3 A;  2NVX C;  4BBS C;  1DCO A;  3S2H K;  3EQL A;  5IYB C;  5FLM K;  2R7Z A;  2JA6 K;  1ZYR A;  1I50 A;  2NVQ C;  4KN4 A;  4YFN A;  2ZJP S;  4WIL A;  2JA7 K;  4KAS A;  4C3J K;  3SZZ A;  1JOE A;  1TWF C; 
#chains in the Genus database with same CATH homology
 3S1N C;  3PO3 K;  2WB1 L;  4A3J C;  3RZO K;  4BXX K;  4Y52 C;  3HOV K;  5C44 K;  4OIO A;  4XSX A;  4QIW D;  4MEX A;  1WCM C;  1YNJ A;  3M3Y C;  1TWG K;  3S17 C;  4LLG A;  2R92 K;  3S1R K;  3GTG C;  4OIN A;  3GTJ K;  4NOI A;  3GTQ C;  2B63 K;  2JA8 C;  3GTL K;  3S15 K;  1TWH C;  4MQ9 A;  2PA8 D;  3CQZ C;  4A3C C;  5IYC C;  2PPB A;  3I4M K;  3HOY C;  1TWC K;  1I6V A;  5IYD K;  3DXJ A;  1R9T C;  5M5X K;  3S16 C;  2NVY K;  2NVX K;  2YU9 K;  4BY1 K;  2E2I K;  2VUM C;  3HOU K;  4A3D K;  1SFO K;  2A68 A;  3FKI C;  4QJV A;  2A6H A;  1HQM A;  5C4J K;  3S1M K;  4C2M K;  4A3I K;  4BY7 K;  3K7A K;  3RZD K;  5D4D A;  2PMZ D;  4XSZ A;  3S14 K;  3S2H C;  1Y1V K;  2Y0S D;  3GTK K;  2E2H K;  3I4N C;  4A3F C;  4X6A C;  5M3M K;  4A3L K;  4A3K C;  2NVQ K;  1IW7 A;  4Q5S A;  3M4O K;  2JA6 C;  4A3E K;  3H0G K;  3GTP K;  3GTM K;  4C3I C;  5IP9 K;  3H3V D;  3HKZ D;  1TWA K;  2JA7 C;  3GTO K;  3S2D K;  1Y1W K;  4A3B K;  4A3J K;  4C3J C;  4A3G C;  2R7Z K;  4C3H C;  4G7O A;  4LJZ A;  3S1Q K;  4GZY A;  3WOD A;  3PO3 C;  2O5J A;  3RZO C;  4BXX C;  3PO2 K;  1BDF A;  5IP7 K;  1I50 K;  5C3E K;  5C44 C;  1I6H K;  4QIW L;  4G7H A;  3H3V L;  1I3Q K;  2R92 C;  1TWG C;  4KMU A;  3HOX K;  2JA5 K;  2R93 K;  1YNN A;  3S1R C;  4OIR A;  3GTJ C;  4BBS K;  2CW0 A;  3GTL C;  2PA8 L;  2B63 C;  5M5W K;  2A69 A;  3S15 C;  1XPP A;  2E2J K;  4AYB D;  5IYB K;  2NVT K;  4ZH4 A;  4OIQ A;  1TWC C;  3I4M C;  4A3M K;  4BBR K;  3HOW K;  4Y7N K;  4A93 K;  5FJ8 K;  5FLM C;  4BY1 C;  4KN7 A;  2YU9 C;  2NVY C;  5TMF A;  2E2I C;  2WAQ L;  3HOU C;  4A3D C;  1SFO C;  5C4J C;  5M3F K;  4G7Z A;  4BY7 C;  3S1M C;  1K83 K;  2PMZ L;  4C2M C;  4A3I C;  1TWF K;  3K7A C;  3RZD C;  2Y0S L;  5C4X K;  3S1N K;  3S14 C;  4X6A K;  1Y1V C;  2WAQ D;  3GTK C;  3HOZ C;  4Y52 K;  4OIP A;  4A3L C;  4MEY A;  4LK0 A;  4YFX A;  1WCM K;  3M3Y K;  3S17 K;  3HKZ L;  4JK1 A;  4A3E C;  3GTG K;  3GTP C;  3GTM C;  3GTQ K;  1SMY A;  5IP9 C;  2JA8 K;  3HOZ K;  1TWA C;  1TWH K;  4XLN A;  3GTO C;  3S2D C;  3CQZ K;  4QJV B;  4A3C K;  1Y1W C;  4A3B C;  5IYC K;  2R7Z C;  4Q4Z A;  3S1Q C;  5M5Y K;  3HOY K;  2O5I A;  3PO2 C;  2BE5 A;  1R9T K;  3S16 K;  5IP7 C;  1I50 C;  5C3E C;  5IYD C;  1I6H C;  2VUM K;  1I3Q C;  2NVX C;  3FKI K;  2R93 C;  2JA5 C;  3HOX C;  4BBS C;  4AYB L;  3S2H K;  2A6E A;  4YG2 A;  4XLP A;  2E2J C;  3EQL A;  5IYB C;  2NVT C;  4YFK A;  3I4N K;  4A3F K;  5TMC A;  5FLM K;  4A3K K;  4LK1 A;  4BBR C;  2WB1 D;  4A3M C;  4Y7N C;  2E2H C;  3HOW C;  4A93 C;  2JA6 K;  1ZYR A;  4C3I K;  2NVQ C;  4KN4 A;  3M4O C;  4YFN A;  2JA7 K;  3H0G C;  3HOV C;  4C3J K;  4A3G K;  1K83 C;  4C3H K;  5C4X C;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...