2CW0A

Crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation
pubmed doi rcsb
molecule tags Transferase
total genus 36
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2cw0A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2cw0A01
4Y7NK 5FLMC 3HOXK 3S1QC 2WB1D 3CQZC 4KN7A 4Q4ZA 4A3GK 3I4NK 2JA6K 3S1MK 1YNNA 4A3BC 2Y0SL 4MQ9A 3PO2K 2YU9C 3GTLK 5IP9C 2JA7K 3S15C 3HOVK 4YFXA 4YG2A 4X6AK 2A68A 1WCMC 3M3YK 3S1RC 5FLMK 2WAQD 3CQZK 5FJ8K 1TWAC 3DXJA 3S1QK 1SFOC 4G7OA 3S1NC 4A3CC 1I50K 4A3BK 1I3QC 1TWHC 1ZYRA 3GTJC 4MEXA 4BXXC 2NVYK 4XLNA 3S15K 3HOYC 4YFNA 5IYCC 5TMFA 1WCMK 4C2MK 5IP7K 3GTKC 3S1RK 2PA8D 2NVTC 5C4XK 2PPBA 5M3MK 1YNJA 4C3JC 1SFOK 4C3IC 4BBRC 2E2HC 4C3HK 4A3KK 3HOWK 4QIWD 4A3CK 2R92C 3GTJK 2B63K 4BXXK 5D4DA 4NOIA 3HOYK 2JA5C 3GTQC 4OINA 5M5WK 3GTKK 5M5XK 5TMCA 2NVTK 4C3JK 1Y1VC 3M3YC 2NVQK 4C3IK 4BBRK 3RZOC 3GTGC 2E2HK 3GTPK 3S2DK 2Y0SD 4Y52C 2R92K 4BY7C 2JA5K 3GTQK 1TWFC 4A3MC 2PMZD 3WODA 2A69A 4KN4A 5C44C 1Y1VK 3S14C 4QJVB 3GTGK 3GTMC 4OIOA 2YU9K 5IP9K 4KMUA 4Y52K 2O5JA 3RZDC 4A3FC 2R7ZC 1TWAK 4A3MK 1SMYA 3S1NK 3S14K 2R93C 4G7HA 2NVXC 4GZYA 3S2HC 4XSZA 1I3QK 3H0GC 1TWHK 4A3FK 2E2JC 4BBSC 5IYCK 4AYBL 3HOZC 5M5YK 3M4OC 3H3VL 5M3FK 1TWGC 2VUMC 1R9TC 2R93K 2NVXK 4A3IC 3HOUC 4A93C 3PO3C 3HKZL 3S2HK 3K7AC 3H0GK 1BDFA 2E2JK 1I6HC 2CW0A 4BBSK 4YFKA 4Y7NC 2PA8L 5C4JC 3M4OK 3HOXC 3PO2C 3FKIC 1TWCC 4BY1C 1TWGK 4A3GC 2VUMK 3RZOK 2E2IC 4QIWL 1R9TK 4XLPA 4A93K 3HOUK 4MEYA 4OIRA 2BE5A 2JA7C 3HOVC 4BY7K 1I6HK 5IYDC 4X6AC 3GTOC 4LK0A 1IW7A 1TWFK 2WB1L 5C4JK 4A3LC 4LLGA 4A3JC 4A3DC 3FKIK 1TWCK 5C44K 2JA8C 4QJVA 5C3EC 1I6VA 2A6EA 2E2IK 4BY1K 3GTMK 1I50C 3RZDK 2NVYC 5IYDK 3GTOK 5IP7C 4AYBD 1Y1WC 4C2MC 4A3EC 2WAQL 2R7ZK 4A3LK 2PMZL 5C4XC 4A3JK 4A3DK 4Q5SA 3H3VD 2JA8K 1K83C 4LK1A 5C3EK 4C3HC 4A3KC 5IYBC 3HOWC 4JK1A 3I4MC 4XSXA 4OIQA 3HKZD 3S16C 3S17C 1HQMA 2B63C 3HOZK 1Y1WK 3EQLA 4ZH4A 4OIPA 2O5IA 1XPPA 4LJZA 4A3EK 3I4NC 2JA6C 3S1MC 1K83K 2NVQC 2A6HA 3GTPC 4A3IK 3PO3K 5IYBK 3I4MK 3GTLC 3S2DC 4G7ZA 3K7AK 3S16K 3S17K
chains in the Genus database with same CATH superfamily
1DD5A 1X31C 5FLMC 1I3QA 3HOXK 1USOA 1XZPB 1IBAA 4A3GK 5JVOA 4MQ9A 1ZXOA 2JA7K 3HOVK 3N3YA 2A68A 2P5MA 3LPXA 2R92A 3S1RC 2WAQD 5FJ8K 3GTQA 2XCRB 1RU0A 5HL7S 3GTJC 4WILA 2RGRA 5IP7K 5C4XK 2PPBA 1YNJA 4C3JC 1SFOK 1XXBA 1AB4A 1B4AA 5TJ3A 1TWCA 4BXXK 3HOYK 2ZUFA 4WF9S 5M5WK 2NVTK 3GTPK 4BBRK 3RZOC 3GTGC 2R7ZA 4Y52C 2R92K 3T01A 4KB2A 4G0WA 3GTQK 2GSOA 2A69A 4KN4A 4QJVB 4A3FC 1R9TA 1F7UA 1XZQB 2JH3A 3ERED 2R93C 2NVXC 4GZYA 3S2HC 3HXAA 3FKIA 2E2JC 3A8IA 1GE9A 4BBSC 3FOEA 5M5YK 5CJ9A 4PAAA 1HI9A 4P9SA 3H3VL 3AQOA 1EK8A 3HOUC 3PO3C 1ZVUA 1I50A 1F9NA 3PO2C 2NVYA 3RZOK 2W7VA 2E2IC 1R9TK 4XLPA 4A93K 4A3LC 4GTEA 3FKIK 2JA8C 5CHPA 1IE0A 1XXCA 3GTOK 3GTLA 2WAQL 1K83C 3I4MC 3CQZA 2GAHC 3HKZD 1IS1A 1KQ4A 3BP3A 1HQMA 4GFQA 2YU9A 4ZH4A 1BS2A 5HL8A 4KM9A 2A6HA 1WOSA 3PO3K 4GTLA 3S17K 3SZZA 2WB1D 3L4JA 4Q4ZA 1EH1A 3I4NK 3JSTA 4U67S 2KQ1A 3GTLK 4GTCA 4YG2A 1USMA 1PJ6A 2CFAB 3CQZK 2V6TA 1SFOC 2L3UA 1PJ7A 1I3QC 1Y1VA 1ZYRA 3S15K 4BXXC 1O27A 3HOYC 4LR2A 5IYCC 5TMFA 2NVTC 4P5AA 1F7VA 4IOCS 4BBRC 4A3CK 1EI6A 2R92C 3G4AA 5D4DA 1IQ0A 3GTMA 3GTQC 4LQYA 3GTKK 4P5BA 4GTBA 2E2HK 2Y0SD 1ZQ1C 1J6WA 3LYWA 2JA5K 3H0GA 1Y1VK 1J98A 1O2BA 2V6SA 4KMAA 4G0VA 1Y1WA 4KMUA 4KC6A 4J3NA 3SZYA 2ZJRS 2R7ZC 4A3MK 2D6FC 1I3QK 4XSZA 3MMLB 5EGHA 5IYCK 4FM9A 4WCES 4ILDA 4GTFA 4DDQA 3DLLS 1R9TC 2KPUA 4A3IC 4A93C 1WQGA 3HKZL 4IO9S 3AD9C 4BLBA 3K7AC 3H0GK 1BDFA 1IL2A 5IORA 1B4BA 3GEIA 3M4OK 4O2DA 1ZBSA 3FKIC 4QIWL 3TTGA 1I6HK 5EGEA 2RH6A 3GTOC 4LK0A 5HQHA 2WB1L 5C4JK 1VRQC 3GTJA 2GSNA 2B63A 1TWCK 2A6EA 1I50C 2JA6A 3AD8C 2NVYC 2R7ZK 2PMZL 4A3JK 4A3DK 5C3EK 4C3HC 4A3KC 4XSXA 4OIQA 1VGXA 2FQTA 3S17C 2Y3PA 3OREA 4KATA 3EQLA 4A3EK 4OIPA 3QX3A 3I4NC 1WCMA 2NVQC 4A3IK 4AH6A 3GTLC 3K7AK 1TWAA 5L46A 2ZJQS 2PHCB 1TWHA 3CQZC 4KN7A 2JA6K 2Y0SL 2ZJPS 2YU9C 3S15C 1VLOA 2NVXA 3S1QK 3N0CA 4A3CC 1I50K 4A3BK 3LAPA 1ISEA 1YX2A 2NVYK 1VH2A 1F93A 1WCMK 3GTKC 2XCOA 2GAGC 5M3MK 2L5NA 2E2HC 4KMHA 4C3HK 3LAJA 4A3KK 4QIWD 1TWFA 3FOFA 2JA5C 2E2IA 5M5XK 5TMCA 4KARA 3PIPS 1Y1VC 2ZFZA 4GTDA 4C3IK 2NVQK 1O28A 5IOSA 3AQPA 1JQWA 1DCPA 4A3MC 2PMZD 3WODA 1XZPA 3M3YK 5C44C 4KMDA 3GTMC 4OIOA 3GDZA 2YU9K 2O5JA 1TWGA 2VUMA 1WSVA 3V4GA 3S14K 4G7HA 4M1XA 4IOAS 1JOEA 1WORA 4LOWA 3H0GC 3A8KA 2KXYA 1V5VA 3ADAC 4PABA 2JA7A 3M4OC 3T00A 4BKWA 3S0XA 5DM6S 1I6HC 1BJTA 3TFJA 1WQFA 4Y7NC 1WQHA 2PA8L 5C4JC 5IOTA 1INNA 4KM8A 1TWCC 3CF5S 1TWGK 2VUMK 2ZUEA 4MEYA 3BP8C 2GSUA 3GEEA 4X6AC 1DCHA 4A3JC 4A3DC 1JVIA 3OEPA 5C44K 4BY1K 4QJVA 5C3EC 1I6VA 3GTMK 3Q3QA 3TFHA 4KAWX 3GTPA 5IYDK 1O29A 4AYBD 4C2MC 4A3EC 1XZQA 3TFIA 4RMFA 5IOQA 3HOWC 1O25A 3G4CA 1VJEA 3CAGA 4WFBS 2B63C 1Y1WK 1L0WA 2O5IA 3BUEA 4LJZA 1O26A 2JA6C 5IYBK 3S2DC 3S16K 3OPFA 4Y7NK 2KWAA 1WOPA 3S1QC 3NUHA 1UV7A 4WJ3M 1WSRA 3N0BA 3S1MK 1YNNA 4A3BC 1J6XA 4KB4A 5IP9C 4YFXA 4X6AK 1WCMC 3IPJA 5FLMK 3AH5A 1TWAC 3DXJA 5DM7S 4G7OA 3T02A 3S1NC 1TWHC 1O2FB 4MEXA 3GIRA 4XLNA 3GTGA 4YFNA 4C2MK 2XCQA 3S1RK 3VA7A 2PA8D 4C3IC 5JVGS 3HOWK 3GTJK 3GSIA 2B63K 4NOIA 4GTAA 4OINA 4C3JK 3M3YC 3GTOA 1G51A 4FZBA 3S2DK 1O2AA 4XCHA 2R93A 4BY7C 5JVHS 2EBBA 1DCOA 4GT9A 1TWFC 1WOOA 3S14C 2FQOA 3GTGK 5IP9K 1EFWA 1YCLA 3AD7C 4Y52K 3RZDC 1O24A 4G0UA 1WIHA 2CFAA 1TWAK 1SMYA 3S1NK 2V6UA 1TWHK 1J6VA 4A3FK 4AYBL 3HOZC 5M3FK 1TWGC 2VUMC 2R93K 3GEHA 2NVXK 3S2HK 2E2JK 4C45A 2CW0A 4BBSK 4YFKA 3PIOS 5E68A 4WJ4A 3HOXC 3A8JA 4BY1C 1C0AA 4A3GC 4BLAA 2P8TA 3HOUK 4OIRA 2BE5A 2JA7C 3HOVC 1K83A 4BY7K 5IYDC 4WFNS 1IW7A 1TWFK 4LLGA 3PO2K 4KASA 2E2IK 1BGWA 3GTKA 3RZDK 1XXAA 2E2HA 5IP7C 1Y1WC 4A3LK 5C4XC 4WFAS 4Q5SA 1EQRA 3H3VD 2JA8K 2JA5A 4LK1A 5IYBC 4JK1A 4KDDA 1PJ5A 3S16C 5JFEA 3HOZK 1XPPA 3S1MC 1K83K 3FHZA 3GTPC 1FEUA 3L4KA 3I4MK 4G7ZA 1SFOA
chains in the Genus database with same CATH topology
4Y7NK 5FLMC 3HOXK 3S1QC 2WB1D 3CQZC 4KN7A 4Q4ZA 4A3GK 3I4NK 2JA6K 3S1MK 1YNNA 4A3BC 2Y0SL 4MQ9A 3PO2K 2YU9C 3GTLK 5IP9C 2JA7K 3S15C 3HOVK 4YFXA 4YG2A 4X6AK 2A68A 1WCMC 3M3YK 3S1RC 5FLMK 2WAQD 3CQZK 5FJ8K 1TWAC 3DXJA 3S1QK 1SFOC 4G7OA 3S1NC 4A3CC 1I50K 4A3BK 1I3QC 1TWHC 1ZYRA 3GTJC 4MEXA 4BXXC 2NVYK 4XLNA 3S15K 3HOYC 4YFNA 5IYCC 5TMFA 1WCMK 4C2MK 5IP7K 3GTKC 3S1RK 2PA8D 2NVTC 5C4XK 2PPBA 5M3MK 1YNJA 4C3JC 1SFOK 4C3IC 4BBRC 2E2HC 4C3HK 4A3KK 3HOWK 4QIWD 4A3CK 2R92C 3GTJK 2B63K 4BXXK 5D4DA 4NOIA 3HOYK 2JA5C 3GTQC 4OINA 5M5WK 3GTKK 5M5XK 5TMCA 2NVTK 4C3JK 1Y1VC 3M3YC 2NVQK 4C3IK 4BBRK 3RZOC 3GTGC 2E2HK 3GTPK 3S2DK 2Y0SD 4Y52C 2R92K 4BY7C 2JA5K 3GTQK 1TWFC 4A3MC 2PMZD 3WODA 2A69A 4KN4A 5C44C 1Y1VK 3S14C 4QJVB 3GTGK 3GTMC 4OIOA 2YU9K 5IP9K 4KMUA 4Y52K 2O5JA 3RZDC 4A3FC 2R7ZC 1TWAK 4A3MK 1SMYA 3S1NK 3S14K 2R93C 4G7HA 2NVXC 4GZYA 3S2HC 4XSZA 1I3QK 3H0GC 1TWHK 4A3FK 2E2JC 4BBSC 5IYCK 4AYBL 3HOZC 5M5YK 3M4OC 3H3VL 5M3FK 1TWGC 2VUMC 1R9TC 2R93K 2NVXK 4A3IC 3HOUC 4A93C 3PO3C 3HKZL 3S2HK 3K7AC 3H0GK 1BDFA 2E2JK 1I6HC 2CW0A 4BBSK 4YFKA 4Y7NC 2PA8L 5C4JC 3M4OK 3HOXC 3PO2C 3FKIC 1TWCC 4BY1C 1TWGK 4A3GC 2VUMK 3RZOK 2E2IC 4QIWL 1R9TK 4XLPA 4A93K 3HOUK 4MEYA 4OIRA 2BE5A 2JA7C 3HOVC 4BY7K 1I6HK 5IYDC 4X6AC 3GTOC 4LK0A 1IW7A 1TWFK 2WB1L 5C4JK 4A3LC 4LLGA 4A3JC 4A3DC 3FKIK 1TWCK 5C44K 2JA8C 4QJVA 5C3EC 1I6VA 2A6EA 2E2IK 4BY1K 3GTMK 1I50C 3RZDK 2NVYC 5IYDK 3GTOK 5IP7C 4AYBD 1Y1WC 4C2MC 4A3EC 2WAQL 2R7ZK 4A3LK 2PMZL 5C4XC 4A3JK 4A3DK 4Q5SA 3H3VD 2JA8K 1K83C 4LK1A 5C3EK 4C3HC 4A3KC 5IYBC 3HOWC 4JK1A 3I4MC 4XSXA 4OIQA 3HKZD 3S16C 3S17C 1HQMA 2B63C 3HOZK 1Y1WK 3EQLA 4ZH4A 4OIPA 2O5IA 1XPPA 4LJZA 4A3EK 3I4NC 2JA6C 3S1MC 1K83K 2NVQC 2A6HA 3GTPC 4A3IK 3PO3K 5IYBK 3I4MK 3GTLC 3S2DC 4G7ZA 3K7AK 3S16K 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N K;  5FLM C;  3HOX K;  3S1Q C;  2WB1 D;  3CQZ C;  4KN7 A;  4Q4Z A;  4A3G K;  3I4N K;  2JA6 K;  3S1M K;  1YNN A;  4A3B C;  2Y0S L;  4MQ9 A;  3PO2 K;  2YU9 C;  3GTL K;  5IP9 C;  2JA7 K;  3S15 C;  3HOV K;  4YFX A;  4YG2 A;  4X6A K;  2A68 A;  1WCM C;  3M3Y K;  3S1R C;  5FLM K;  2WAQ D;  3CQZ K;  5FJ8 K;  1TWA C;  3DXJ A;  3S1Q K;  1SFO C;  4G7O A;  3S1N C;  4A3C C;  1I50 K;  4A3B K;  1I3Q C;  1TWH C;  1ZYR A;  3GTJ C;  4MEX A;  4BXX C;  2NVY K;  4XLN A;  3S15 K;  3HOY C;  4YFN A;  5IYC C;  5TMF A;  1WCM K;  4C2M K;  5IP7 K;  3GTK C;  3S1R K;  2PA8 D;  2NVT C;  5C4X K;  2PPB A;  5M3M K;  1YNJ A;  4C3J C;  1SFO K;  4C3I C;  4BBR C;  2E2H C;  4C3H K;  4A3K K;  3HOW K;  4QIW D;  4A3C K;  2R92 C;  3GTJ K;  2B63 K;  4BXX K;  5D4D A;  4NOI A;  3HOY K;  2JA5 C;  3GTQ C;  4OIN A;  5M5W K;  3GTK K;  5M5X K;  5TMC A;  2NVT K;  4C3J K;  1Y1V C;  3M3Y C;  2NVQ K;  4C3I K;  4BBR K;  3RZO C;  3GTG C;  2E2H K;  3GTP K;  3S2D K;  2Y0S D;  4Y52 C;  2R92 K;  4BY7 C;  2JA5 K;  3GTQ K;  1TWF C;  4A3M C;  2PMZ D;  3WOD A;  2A69 A;  4KN4 A;  5C44 C;  1Y1V K;  3S14 C;  4QJV B;  3GTG K;  3GTM C;  4OIO A;  2YU9 K;  5IP9 K;  4KMU A;  4Y52 K;  2O5J A;  3RZD C;  4A3F C;  2R7Z C;  1TWA K;  4A3M K;  1SMY A;  3S1N K;  3S14 K;  2R93 C;  4G7H A;  2NVX C;  4GZY A;  3S2H C;  4XSZ A;  1I3Q K;  3H0G C;  1TWH K;  4A3F K;  2E2J C;  4BBS C;  5IYC K;  4AYB L;  3HOZ C;  5M5Y K;  3M4O C;  3H3V L;  5M3F K;  1TWG C;  2VUM C;  1R9T C;  2R93 K;  2NVX K;  4A3I C;  3HOU C;  4A93 C;  3PO3 C;  3HKZ L;  3S2H K;  3K7A C;  3H0G K;  1BDF A;  2E2J K;  1I6H C;  2CW0 A;  4BBS K;  4YFK A;  4Y7N C;  2PA8 L;  5C4J C;  3M4O K;  3HOX C;  3PO2 C;  3FKI C;  1TWC C;  4BY1 C;  1TWG K;  4A3G C;  2VUM K;  3RZO K;  2E2I C;  4QIW L;  1R9T K;  4XLP A;  4A93 K;  3HOU K;  4MEY A;  4OIR A;  2BE5 A;  2JA7 C;  3HOV C;  4BY7 K;  1I6H K;  5IYD C;  4X6A C;  3GTO C;  4LK0 A;  1IW7 A;  1TWF K;  2WB1 L;  5C4J K;  4A3L C;  4LLG A;  4A3J C;  4A3D C;  3FKI K;  1TWC K;  5C44 K;  2JA8 C;  4QJV A;  5C3E C;  1I6V A;  2A6E A;  2E2I K;  4BY1 K;  3GTM K;  1I50 C;  3RZD K;  2NVY C;  5IYD K;  3GTO K;  5IP7 C;  4AYB D;  1Y1W C;  4C2M C;  4A3E C;  2WAQ L;  2R7Z K;  4A3L K;  2PMZ L;  5C4X C;  4A3J K;  4A3D K;  4Q5S A;  3H3V D;  2JA8 K;  1K83 C;  4LK1 A;  5C3E K;  4C3H C;  4A3K C;  5IYB C;  3HOW C;  4JK1 A;  3I4M C;  4XSX A;  4OIQ A;  3HKZ D;  3S16 C;  3S17 C;  1HQM A;  2B63 C;  3HOZ K;  1Y1W K;  3EQL A;  4ZH4 A;  4OIP A;  2O5I A;  1XPP A;  4LJZ A;  4A3E K;  3I4N C;  2JA6 C;  3S1M C;  1K83 K;  2NVQ C;  2A6H A;  3GTP C;  4A3I K;  3PO3 K;  5IYB K;  3I4M K;  3GTL C;  3S2D C;  4G7Z A;  3K7A K;  3S16 K;  3S17 K; 
#chains in the Genus database with same CATH topology
 1DD5 A;  1X31 C;  5FLM C;  1I3Q A;  3HOX K;  1USO A;  1XZP B;  1IBA A;  4A3G K;  5JVO A;  4MQ9 A;  1ZXO A;  2JA7 K;  3HOV K;  3N3Y A;  2A68 A;  2P5M A;  3LPX A;  2R92 A;  3S1R C;  2WAQ D;  5FJ8 K;  3GTQ A;  2XCR B;  1RU0 A;  5HL7 S;  3GTJ C;  4WIL A;  2RGR A;  5IP7 K;  5C4X K;  2PPB A;  1YNJ A;  4C3J C;  1SFO K;  1XXB A;  1AB4 A;  1B4A A;  5TJ3 A;  1TWC A;  4BXX K;  3HOY K;  2ZUF A;  4WF9 S;  5M5W K;  2NVT K;  3GTP K;  4BBR K;  3RZO C;  3GTG C;  2R7Z A;  4Y52 C;  2R92 K;  3T01 A;  4KB2 A;  4G0W A;  3GTQ K;  2GSO A;  2A69 A;  4KN4 A;  4QJV B;  4A3F C;  1R9T A;  1F7U A;  1XZQ B;  2JH3 A;  3ERE D;  2R93 C;  2NVX C;  4GZY A;  3S2H C;  3HXA A;  3FKI A;  2E2J C;  3A8I A;  1GE9 A;  4BBS C;  3FOE A;  5M5Y K;  5CJ9 A;  4PAA A;  1HI9 A;  4P9S A;  3H3V L;  3AQO A;  1EK8 A;  3HOU C;  3PO3 C;  1ZVU A;  1I50 A;  1F9N A;  3PO2 C;  2NVY A;  3RZO K;  2W7V A;  2E2I C;  1R9T K;  4XLP A;  4A93 K;  4A3L C;  4GTE A;  3FKI K;  2JA8 C;  5CHP A;  1IE0 A;  1XXC A;  3GTO K;  3GTL A;  2WAQ L;  1K83 C;  3I4M C;  3CQZ A;  2GAH C;  3HKZ D;  1IS1 A;  1KQ4 A;  3BP3 A;  1HQM A;  4GFQ A;  2YU9 A;  4ZH4 A;  1BS2 A;  5HL8 A;  4KM9 A;  2A6H A;  1WOS A;  3PO3 K;  4GTL A;  3S17 K;  3SZZ A;  2WB1 D;  3L4J A;  4Q4Z A;  1EH1 A;  3I4N K;  3JST A;  4U67 S;  2KQ1 A;  3GTL K;  4GTC A;  4YG2 A;  1USM A;  1PJ6 A;  2CFA B;  3CQZ K;  2V6T A;  1SFO C;  2L3U A;  1PJ7 A;  1I3Q C;  1Y1V A;  1ZYR A;  3S15 K;  4BXX C;  1O27 A;  3HOY C;  4LR2 A;  5IYC C;  5TMF A;  2NVT C;  4P5A A;  1F7V A;  4IOC S;  4BBR C;  4A3C K;  1EI6 A;  2R92 C;  3G4A A;  5D4D A;  1IQ0 A;  3GTM A;  3GTQ C;  4LQY A;  3GTK K;  4P5B A;  4GTB A;  2E2H K;  2Y0S D;  1ZQ1 C;  1J6W A;  3LYW A;  2JA5 K;  3H0G A;  1Y1V K;  1J98 A;  1O2B A;  2V6S A;  4KMA A;  4G0V A;  1Y1W A;  4KMU A;  4KC6 A;  4J3N A;  3SZY A;  2ZJR S;  2R7Z C;  4A3M K;  2D6F C;  1I3Q K;  4XSZ A;  3MML B;  5EGH A;  5IYC K;  4FM9 A;  4WCE S;  4ILD A;  4GTF A;  4DDQ A;  3DLL S;  1R9T C;  2KPU A;  4A3I C;  4A93 C;  1WQG A;  3HKZ L;  4IO9 S;  3AD9 C;  4BLB A;  3K7A C;  3H0G K;  1BDF A;  1IL2 A;  5IOR A;  1B4B A;  3GEI A;  3M4O K;  4O2D A;  1ZBS A;  3FKI C;  4QIW L;  3TTG A;  1I6H K;  5EGE A;  2RH6 A;  3GTO C;  4LK0 A;  5HQH A;  2WB1 L;  5C4J K;  1VRQ C;  3GTJ A;  2GSN A;  2B63 A;  1TWC K;  2A6E A;  1I50 C;  2JA6 A;  3AD8 C;  2NVY C;  2R7Z K;  2PMZ L;  4A3J K;  4A3D K;  5C3E K;  4C3H C;  4A3K C;  4XSX A;  4OIQ A;  1VGX A;  2FQT A;  3S17 C;  2Y3P A;  3ORE A;  4KAT A;  3EQL A;  4A3E K;  4OIP A;  3QX3 A;  3I4N C;  1WCM A;  2NVQ C;  4A3I K;  4AH6 A;  3GTL C;  3K7A K;  1TWA A;  5L46 A;  2ZJQ S;  2PHC B;  1TWH A;  3CQZ C;  4KN7 A;  2JA6 K;  2Y0S L;  2ZJP S;  2YU9 C;  3S15 C;  1VLO A;  2NVX A;  3S1Q K;  3N0C A;  4A3C C;  1I50 K;  4A3B K;  3LAP A;  1ISE A;  1YX2 A;  2NVY K;  1VH2 A;  1F93 A;  1WCM K;  3GTK C;  2XCO A;  2GAG C;  5M3M K;  2L5N A;  2E2H C;  4KMH A;  4C3H K;  3LAJ A;  4A3K K;  4QIW D;  1TWF A;  3FOF A;  2JA5 C;  2E2I A;  5M5X K;  5TMC A;  4KAR A;  3PIP S;  1Y1V C;  2ZFZ A;  4GTD A;  4C3I K;  2NVQ K;  1O28 A;  5IOS A;  3AQP A;  1JQW A;  1DCP A;  4A3M C;  2PMZ D;  3WOD A;  1XZP A;  3M3Y K;  5C44 C;  4KMD A;  3GTM C;  4OIO A;  3GDZ A;  2YU9 K;  2O5J A;  1TWG A;  2VUM A;  1WSV A;  3V4G A;  3S14 K;  4G7H A;  4M1X A;  4IOA S;  1JOE A;  1WOR A;  4LOW A;  3H0G C;  3A8K A;  2KXY A;  1V5V A;  3ADA C;  4PAB A;  2JA7 A;  3M4O C;  3T00 A;  4BKW A;  3S0X A;  5DM6 S;  1I6H C;  1BJT A;  3TFJ A;  1WQF A;  4Y7N C;  1WQH A;  2PA8 L;  5C4J C;  5IOT A;  1INN A;  4KM8 A;  1TWC C;  3CF5 S;  1TWG K;  2VUM K;  2ZUE A;  4MEY A;  3BP8 C;  2GSU A;  3GEE A;  4X6A C;  1DCH A;  4A3J C;  4A3D C;  1JVI A;  3OEP A;  5C44 K;  4BY1 K;  4QJV A;  5C3E C;  1I6V A;  3GTM K;  3Q3Q A;  3TFH A;  4KAW X;  3GTP A;  5IYD K;  1O29 A;  4AYB D;  4C2M C;  4A3E C;  1XZQ A;  3TFI A;  4RMF A;  5IOQ A;  3HOW C;  1O25 A;  3G4C A;  1VJE A;  3CAG A;  4WFB S;  2B63 C;  1Y1W K;  1L0W A;  2O5I A;  3BUE A;  4LJZ A;  1O26 A;  2JA6 C;  5IYB K;  3S2D C;  3S16 K;  3OPF A;  4Y7N K;  2KWA A;  1WOP A;  3S1Q C;  3NUH A;  1UV7 A;  4WJ3 M;  1WSR A;  3N0B A;  3S1M K;  1YNN A;  4A3B C;  1J6X A;  4KB4 A;  5IP9 C;  4YFX A;  4X6A K;  1WCM C;  3IPJ A;  5FLM K;  3AH5 A;  1TWA C;  3DXJ A;  5DM7 S;  4G7O A;  3T02 A;  3S1N C;  1TWH C;  1O2F B;  4MEX A;  3GIR A;  4XLN A;  3GTG A;  4YFN A;  4C2M K;  2XCQ A;  3S1R K;  3VA7 A;  2PA8 D;  4C3I C;  5JVG S;  3HOW K;  3GTJ K;  3GSI A;  2B63 K;  4NOI A;  4GTA A;  4OIN A;  4C3J K;  3M3Y C;  3GTO A;  1G51 A;  4FZB A;  3S2D K;  1O2A A;  4XCH A;  2R93 A;  4BY7 C;  5JVH S;  2EBB A;  1DCO A;  4GT9 A;  1TWF C;  1WOO A;  3S14 C;  2FQO A;  3GTG K;  5IP9 K;  1EFW A;  1YCL A;  3AD7 C;  4Y52 K;  3RZD C;  1O24 A;  4G0U A;  1WIH A;  2CFA A;  1TWA K;  1SMY A;  3S1N K;  2V6U A;  1TWH K;  1J6V A;  4A3F K;  4AYB L;  3HOZ C;  5M3F K;  1TWG C;  2VUM C;  2R93 K;  3GEH A;  2NVX K;  3S2H K;  2E2J K;  4C45 A;  2CW0 A;  4BBS K;  4YFK A;  3PIO S;  5E68 A;  4WJ4 A;  3HOX C;  3A8J A;  4BY1 C;  1C0A A;  4A3G C;  4BLA A;  2P8T A;  3HOU K;  4OIR A;  2BE5 A;  2JA7 C;  3HOV C;  1K83 A;  4BY7 K;  5IYD C;  4WFN S;  1IW7 A;  1TWF K;  4LLG A;  3PO2 K;  4KAS A;  2E2I K;  1BGW A;  3GTK A;  3RZD K;  1XXA A;  2E2H A;  5IP7 C;  1Y1W C;  4A3L K;  5C4X C;  4WFA S;  4Q5S A;  1EQR A;  3H3V D;  2JA8 K;  2JA5 A;  4LK1 A;  5IYB C;  4JK1 A;  4KDD A;  1PJ5 A;  3S16 C;  5JFE A;  3HOZ K;  1XPP A;  3S1M C;  1K83 K;  3FHZ A;  3GTP C;  1FEU A;  3L4K A;  3I4M K;  4G7Z A;  1SFO A; 
#chains in the Genus database with same CATH homology
 4Y7N K;  5FLM C;  3HOX K;  3S1Q C;  2WB1 D;  3CQZ C;  4KN7 A;  4Q4Z A;  4A3G K;  3I4N K;  2JA6 K;  3S1M K;  1YNN A;  4A3B C;  2Y0S L;  4MQ9 A;  3PO2 K;  2YU9 C;  3GTL K;  5IP9 C;  2JA7 K;  3S15 C;  3HOV K;  4YFX A;  4YG2 A;  4X6A K;  2A68 A;  1WCM C;  3M3Y K;  3S1R C;  5FLM K;  2WAQ D;  3CQZ K;  5FJ8 K;  1TWA C;  3DXJ A;  3S1Q K;  1SFO C;  4G7O A;  3S1N C;  4A3C C;  1I50 K;  4A3B K;  1I3Q C;  1TWH C;  1ZYR A;  3GTJ C;  4MEX A;  4BXX C;  2NVY K;  4XLN A;  3S15 K;  3HOY C;  4YFN A;  5IYC C;  5TMF A;  1WCM K;  4C2M K;  5IP7 K;  3GTK C;  3S1R K;  2PA8 D;  2NVT C;  5C4X K;  2PPB A;  5M3M K;  1YNJ A;  4C3J C;  1SFO K;  4C3I C;  4BBR C;  2E2H C;  4C3H K;  4A3K K;  3HOW K;  4QIW D;  4A3C K;  2R92 C;  3GTJ K;  2B63 K;  4BXX K;  5D4D A;  4NOI A;  3HOY K;  2JA5 C;  3GTQ C;  4OIN A;  5M5W K;  3GTK K;  5M5X K;  5TMC A;  2NVT K;  4C3J K;  1Y1V C;  3M3Y C;  2NVQ K;  4C3I K;  4BBR K;  3RZO C;  3GTG C;  2E2H K;  3GTP K;  3S2D K;  2Y0S D;  4Y52 C;  2R92 K;  4BY7 C;  2JA5 K;  3GTQ K;  1TWF C;  4A3M C;  2PMZ D;  3WOD A;  2A69 A;  4KN4 A;  5C44 C;  1Y1V K;  3S14 C;  4QJV B;  3GTG K;  3GTM C;  4OIO A;  2YU9 K;  5IP9 K;  4KMU A;  4Y52 K;  2O5J A;  3RZD C;  4A3F C;  2R7Z C;  1TWA K;  4A3M K;  1SMY A;  3S1N K;  3S14 K;  2R93 C;  4G7H A;  2NVX C;  4GZY A;  3S2H C;  4XSZ A;  1I3Q K;  3H0G C;  1TWH K;  4A3F K;  2E2J C;  4BBS C;  5IYC K;  4AYB L;  3HOZ C;  5M5Y K;  3M4O C;  3H3V L;  5M3F K;  1TWG C;  2VUM C;  1R9T C;  2R93 K;  2NVX K;  4A3I C;  3HOU C;  4A93 C;  3PO3 C;  3HKZ L;  3S2H K;  3K7A C;  3H0G K;  1BDF A;  2E2J K;  1I6H C;  2CW0 A;  4BBS K;  4YFK A;  4Y7N C;  2PA8 L;  5C4J C;  3M4O K;  3HOX C;  3PO2 C;  3FKI C;  1TWC C;  4BY1 C;  1TWG K;  4A3G C;  2VUM K;  3RZO K;  2E2I C;  4QIW L;  1R9T K;  4XLP A;  4A93 K;  3HOU K;  4MEY A;  4OIR A;  2BE5 A;  2JA7 C;  3HOV C;  4BY7 K;  1I6H K;  5IYD C;  4X6A C;  3GTO C;  4LK0 A;  1IW7 A;  1TWF K;  2WB1 L;  5C4J K;  4A3L C;  4LLG A;  4A3J C;  4A3D C;  3FKI K;  1TWC K;  5C44 K;  2JA8 C;  4QJV A;  5C3E C;  1I6V A;  2A6E A;  2E2I K;  4BY1 K;  3GTM K;  1I50 C;  3RZD K;  2NVY C;  5IYD K;  3GTO K;  5IP7 C;  4AYB D;  1Y1W C;  4C2M C;  4A3E C;  2WAQ L;  2R7Z K;  4A3L K;  2PMZ L;  5C4X C;  4A3J K;  4A3D K;  4Q5S A;  3H3V D;  2JA8 K;  1K83 C;  4LK1 A;  5C3E K;  4C3H C;  4A3K C;  5IYB C;  3HOW C;  4JK1 A;  3I4M C;  4XSX A;  4OIQ A;  3HKZ D;  3S16 C;  3S17 C;  1HQM A;  2B63 C;  3HOZ K;  1Y1W K;  3EQL A;  4ZH4 A;  4OIP A;  2O5I A;  1XPP A;  4LJZ A;  4A3E K;  3I4N C;  2JA6 C;  3S1M C;  1K83 K;  2NVQ C;  2A6H A;  3GTP C;  4A3I K;  3PO3 K;  5IYB K;  3I4M K;  3GTL C;  3S2D C;  4G7Z A;  3K7A K;  3S16 K;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...