2CW0A

Crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 36
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2cw0A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2cw0A01
5C4XK 2JA7C 2WB1D 3EQLA 1SFOC 1TWCC 2JA6K 2R7ZK 3GTKC 1TWFK 4A3JC 1TWCK 3S14C 3S14K 3DXJA 5FLMC 4QJVA 2PMZD 3HOYK 2NVTK 5IYCC 2R93K 1YNJA 4BY1K 5FLMK 3HOYC 4XSZA 1Y1WC 4YFNA 4A3MK 1Y1VC 4KN7A 4AYBL 5TMFA 4BBSC 1I50C 2O5IA 4BY7K 4BBSK 4XSXA 4Q5SA 1TWAC 3GTQK 3GTOK 5M3FK 4Y7NK 4A3BC 2JA5K 2O5JA 3H0GC 4QJVB 4A3CK 4LJZA 4ZH4A 4Y7NC 3S1RC 5FJ8K 3HOUK 2NVYC 4MEXA 3RZDC 3H0GK 2PA8D 3CQZC 3K7AC 3S1RK 4Y52C 4GZYA 3GTKK 3S1NK 4LK0A 3CQZK 3K7AK 4BBRK 4KN4A 3HOXC 2E2HC 4BBRC 4YFKA 4BXXK 4KMUA 4JK1A 2E2HK 3GTMC 3GTGK 4BXXC 2E2JK 2E2IK 3S15K 1I3QK 3GTGC 3FKIC 1I3QC 4A3DC 5M5YK 4A3EK 2JA8C 5C44K 4A3KC 3S16K 3FKIK 2WAQL 4A3EC 3HOVC 2NVQK 5C44C 2JA8K 2R92K 4A3DK 5TMCA 4OINA 4QIWD 4X6AK 2Y0SD 2NVQC 1XPPA 1R9TC 1K83C 5IYDC 3HOVK 3PO2K 4OIPA 1WCMC 4YFXA 3PO2C 1K83K 1YNNA 1TWHC 3WODA 4A3IK 3HOWC 2VUMK 1WCMK 5IYDK 4A3FC 3I4NC 4C3HK 4OIQA 5M3MK 2WAQD 2A69A 3HOWK 5IYBK 1I6HK 3I4NK 5C4XC 3S1MK 3HKZD 2JA6C 2R7ZC 1SFOK 2JA7K 3S1QK 3S2HC 5IYBC 4C3JK 3M3YK 3S2HK 3S2DK 2A68A 2BE5A 3M3YC 2R93C 4A3JK 1TWGC 4BY1C 4Q4ZA 1Y1WK 4NOIA 1TWGK 3GTLC 1Y1VK 2NVTC 5IYCK 3H3VD 2PMZL 3GTLK 3HOZK 4A3MC 3GTJK 2NVXK 3HOZC 4OIRA 3GTQC 3M4OC 3GTOC 3GTJC 1I50K 2NVXC 4AYBD 4A93C 1HQMA 2JA5C 4A3BK 3M4OK 4BY7C 3PO3C 3H3VL 4A93K 1TWAK 5M5WK 4C3IK 4LK1A 3RZDK 3PO3K 4Y52K 3S1NC 4C3IC 4A3CC 2CW0A 5C4JC 3HOUC 2NVYK 4LLGA 5C4JK 2B63K 2YU9K 5C3EK 4XLPA 2PA8L 2A6HA 2A6EA 4XLNA 2B63C 2YU9C 4G7OA 5C3EC 2E2IC 1ZYRA 2E2JC 5D4DA 1IW7A 4G7HA 3RZOC 4A3LC 4A3GC 3HOXK 4OIOA 3GTPC 3RZOK 4MEYA 4A3GK 4A3LK 1BDFA 1SMYA 3GTPK 3GTMK 4MQ9A 3S15C 4C2MK 5M5XK 4QIWL 2R92C 4C2MC 5IP7C 3S16C 4A3KK 5IP7K 5IP9C 4YG2A 2PPBA 3I4MC 1TWHK 4X6AC 2WB1L 5IP9K 4G7ZA 1R9TK 3I4MK 1I6VA 2Y0SL 3HKZL 1I6HC 4A3IC 3S1MC 2VUMC 3S1QC 3S17C 4C3HC 4A3FK 4C3JC 3S17K 3S2DC 1TWFC
chains in the Genus database with same CATH superfamily
2JA7C 1SFOC 2R7ZK 4A3JC 1TWCK 1O2BA 1B4AA 3GDZA 4QJVA 2PMZD 3BP3A 5IYCC 2V6TA 5TMFA 1I50C 1TWAA 4BY7K 4BBSK 2RH6A 2E2IA 4GTDA 4G0WA 5M3FK 5TJ3A 4WFBS 4A3BC 4A3CK 5FJ8K 1O24A 3RZDC 4FZBA 1XZQB 4LK0A 1WOSA 4JK1A 3GTMC 4BXXC 2E2IK 3S15K 1I3QK 2XCRB 1I3QC 4A3DC 4A3EK 4A3KC 3FKIK 2NVQK 4A3EC 4A3DK 5C44C 1O2AA 5EGEA 5TMCA 4X6AK 4QIWD 1XPPA 1R9TC 1I50A 1WCMC 2VUMK 2R93A 1WCMK 1ZVUA 4OIQA 4LOWA 2L3UA 2ZUFA 5C4XC 3M3YK 2A68A 4RMFA 5EGHA 3M3YC 1JOEA 1USOA 1TWGC 4BY1C 1Y1WK 1Y1VK 2PMZL 3Q3QA 5JVHS 1DCPA 2FQOA 5CHPA 5DM7S 3AQPA 3M4OC 3GTOC 1O25A 2NVXC 3GTQA 5HL8A 4P5BA 4KARA 3T01A 5M5WK 4C3IK 4LK1A 4C3IC 5C4JC 4KC6A 4WILA 4LLGA 5C4JK 4KM8A 1KQ4A 2L5NA 2JH3A 1PJ6A 2A6HA 1ZYRA 3HOXK 5D4DA 5DM6S 4G7HA 4KM9A 2KWAA 3GTPC 3HXAA 2GSNA 2D6FC 4ILDA 2V6UA 4O2DA 3OEPA 3BUEA 2YU9A 5IP9C 3IPJA 5HQHA 4LQYA 4WCES 5IP9K 4G7ZA 1I6VA 1I6HC 2NVYA 3S1MC 3GTGA 2GSUA 4C3HC 4A3FK 4C3JC 3LPXA 3N0BA 3S2DC 2WB1D 3EQLA 5IOQA 1TWCC 2JA6K 4FM9A 4WFNS 3S14K 4KAWX 1FEUA 4GTAA 3HOYK 1C0AA 5FLMK 3HOYC 1IS1A 3GIRA 3TFHA 1BJTA 1EH1A 4KN7A 1VH2A 4AYBL 1PJ7A 4BBSC 3AD7C 2O5IA 2GAHC 4KB2A 4KATA 3GTQK 2JA5K 1PJ5A 1UV7A 4Y52C 4GZYA 4GTBA 3CQZA 4YFKA 1O28A 2CFAB 1ZXOA 2E2JK 5IOSA 1F7VA 3GTGK 3FKIA 3GTGC 3FKIC 5M5YK 3S16K 5C44K 2ZJPS 1J6WA 2WAQL 1XXBA 2R92K 4OINA 1F93A 1WCMA 3QX3A 1J6XA 3ERED 4PAAA 1YNNA 1TWHC 5JVGS 3JSTA 2FQTA 2A69A 3HOWK 5E68A 5IYBK 3S1QK 5IYBC 4G0VA 3S2HK 2BE5A 1O27A 3FOEA 2R93C 4A3JK 3OREA 1JVIA 5CJ9A 4NOIA 2NVTC 1EFWA 3GTLK 4A3MC 3TFJA 2NVXK 2NVXA 3GSIA 1I50K 2ZUEA 3GTMA 1YCLA 3H3VL 1DCOA 3L4JA 1TWAK 3RZDK 3S1NC 2ZJQS 4A3CC 1EQRA 5HL7S 2NVYK 2B63K 2B63A 3G4AA 3AD8C 2A6EA 4XLNA 2B63C 2YU9C 1WQHA 2KXYA 1IW7A 4OIOA 1VLOA 4MEYA 3T02A 1RU0A 1BDFA 3GTMK 4MQ9A 3S15C 2KQ1A 5M5XK 3A8KA 1WSRA 4A3KK 2PPBA 4X6AC 3ADAC 1R9TK 3I4MK 3HKZL 2P8TA 2KPUA 3S17K 4WJ3M 4WFAS 3PIOS 1WQFA 5L46A 2JA7A 1TWCA 2RGRA 3S14C 1K83A 4PABA 5FLMC 1ZBSA 4BY1K 2GAGC 4XSZA 2ZJRS 1Y1WC 4YFNA 1XZQA 1Y1VC 3LYWA 4WF9S 1BGWA 4Q5SA 3GTOK 4QJVB 4LJZA 4ZH4A 4Y7NC 2ZFZA 1IL2A 3HOUK 1WOPA 3LAJA 4MEXA 3H0GK 1EK8A 3K7AC 3AH5A 3N3YA 3S1RK 1WQGA 4IO9S 3K7AK 3VA7A 4KN4A 5JVOA 1ISEA 3GTOA 3G4CA 1AB4A 3MMLB 3L4KA 1INNA 4KMDA 1I3QA 4M1XA 4GTLA 2JA8K 1GE9A 3A8JA 3AQOA 2Y0SD 3CF5S 5IYDC 3PO2K 3TFIA 4YFXA 3PO2C 4A3IK 5IYDK 3HOWC 3GTPA 4A3FC 4C3HK 5M3MK 1I6HK 3I4NK 1Y1VA 2R7ZC 1YX2A 1SFOK 2JA7K 2XCOA 3S2HC 4P9SA 4C3JK 1O29A 3T00A 1O26A 4KMHA 3NUHA 2V6SA 2E2HA 4BKWA 4Q4ZA 3S0XA 2P5MA 3GTLC 3GEHA 5IYCK 4IOCS 4OIRA 3GTQC 4LR2A 4XCHA 4AYBD 1HQMA 4A3BK 4BY7C 3OPFA 1XXAA 4A93K 2JA5A 5JFEA 3PO3K 4Y52K 2CW0A 3GEEA 3FHZA 3SZYA 1WIHA 2YU9K 5C3EK 4G7OA 3N0CA 5C3EC 2E2IC 1ZQ1C 4A3GC 4BXXK 4U67S 4A3GK 4A3LK 1V5VA 4GTCA 3GTLA 2R92C 5IP7C 1HI9A 1XXCA 1F9NA 5IP7K 4YG2A 3I4MC 2WB1L 3S1QC 2VUMC 3S17C 1SFOA 1WORA 4WJ4A 5C4XK 4DDQA 2PHCB 3GTKC 1TWFK 3GTJA 3FOFA 3DXJA 2R93K 2NVTK 2VUMA 1Y1WA 1YNJA 4GTEA 4A3MK 3V4GA 4GTFA 5IOTA 1TWHA 4XSXA 1TWAC 1WSVA 4KMAA 4Y7NK 2O5JA 3H0GC 4P5AA 4GFQA 3S1RC 2NVYC 2PA8D 3CQZC 4KB4A 3GTKK 3S1NK 3CQZK 4BBRK 5IORA 3HOXC 2Y3PA 2E2HC 4BBRC 3DLLS 1G51A 4KMUA 3CAGA 2E2HK 4IOAS 1B4BA 2GSOA 4J3NA 1O2FB 3AD9C 4AH6A 4KDDA 1VJEA 2JA8C 3HOVC 1XZPB 1VGXA 1JQWA 2NVQC 3HOVK 1K83C 4BLBA 4OIPA 1K83K 3WODA 2CFAA 2W7VA 3I4NC 2WAQD 2JA6A 3H0GA 3S1MK 3HKZD 2JA6C 2R92A 4BLAA 2R7ZA 3S2DK 3A8IA 4GT9A 1IQ0A 3PIPS 1TWGK 3H3VD 3HOZK 1TWFA 3GTJK 3HOZC 3GTJC 3GTKA 4A93C 1IBAA 2JA5C 1VRQC 3M4OK 3PO3C 1J6VA 3SZZA 1USMA 1XZPA 1DCHA 3HOUC 1L0WA 4G0UA 4XLPA 2PA8L 1R9TA 2EBBA 2E2JC 3RZOC 4A3LC 3RZOK 1BS2A 1DD5A 1SMYA 3GTPK 1J98A 1IE0A 1X31C 4C2MK 4QIWL 4C2MC 3S16C 3GEIA 4C45A 4KASA 1TWHK 2XCQA 1TWGA 1EI6A 2Y0SL 4A3IC 3LAPA 3TTGA 1F7UA 1WOOA 3BP8C 1TWFC
chains in the Genus database with same CATH topology
5C4XK 2JA7C 2WB1D 3EQLA 1SFOC 1TWCC 2JA6K 2R7ZK 3GTKC 1TWFK 4A3JC 1TWCK 3S14C 3S14K 3DXJA 5FLMC 4QJVA 2PMZD 3HOYK 2NVTK 5IYCC 2R93K 1YNJA 4BY1K 5FLMK 3HOYC 4XSZA 1Y1WC 4YFNA 4A3MK 1Y1VC 4KN7A 4AYBL 5TMFA 4BBSC 1I50C 2O5IA 4BY7K 4BBSK 4XSXA 4Q5SA 1TWAC 3GTQK 3GTOK 5M3FK 4Y7NK 4A3BC 2JA5K 2O5JA 3H0GC 4QJVB 4A3CK 4LJZA 4ZH4A 4Y7NC 3S1RC 5FJ8K 3HOUK 2NVYC 4MEXA 3RZDC 3H0GK 2PA8D 3CQZC 3K7AC 3S1RK 4Y52C 4GZYA 3GTKK 3S1NK 4LK0A 3CQZK 3K7AK 4BBRK 4KN4A 3HOXC 2E2HC 4BBRC 4YFKA 4BXXK 4KMUA 4JK1A 2E2HK 3GTMC 3GTGK 4BXXC 2E2JK 2E2IK 3S15K 1I3QK 3GTGC 3FKIC 1I3QC 4A3DC 5M5YK 4A3EK 2JA8C 5C44K 4A3KC 3S16K 3FKIK 2WAQL 4A3EC 3HOVC 2NVQK 5C44C 2JA8K 2R92K 4A3DK 5TMCA 4OINA 4QIWD 4X6AK 2Y0SD 2NVQC 1XPPA 1R9TC 1K83C 5IYDC 3HOVK 3PO2K 4OIPA 1WCMC 4YFXA 3PO2C 1K83K 1YNNA 1TWHC 3WODA 4A3IK 3HOWC 2VUMK 1WCMK 5IYDK 4A3FC 3I4NC 4C3HK 4OIQA 5M3MK 2WAQD 2A69A 3HOWK 5IYBK 1I6HK 3I4NK 5C4XC 3S1MK 3HKZD 2JA6C 2R7ZC 1SFOK 2JA7K 3S1QK 3S2HC 5IYBC 4C3JK 3M3YK 3S2HK 3S2DK 2A68A 2BE5A 3M3YC 2R93C 4A3JK 1TWGC 4BY1C 4Q4ZA 1Y1WK 4NOIA 1TWGK 3GTLC 1Y1VK 2NVTC 5IYCK 3H3VD 2PMZL 3GTLK 3HOZK 4A3MC 3GTJK 2NVXK 3HOZC 4OIRA 3GTQC 3M4OC 3GTOC 3GTJC 1I50K 2NVXC 4AYBD 4A93C 1HQMA 2JA5C 4A3BK 3M4OK 4BY7C 3PO3C 3H3VL 4A93K 1TWAK 5M5WK 4C3IK 4LK1A 3RZDK 3PO3K 4Y52K 3S1NC 4C3IC 4A3CC 2CW0A 5C4JC 3HOUC 2NVYK 4LLGA 5C4JK 2B63K 2YU9K 5C3EK 4XLPA 2PA8L 2A6HA 2A6EA 4XLNA 2B63C 2YU9C 4G7OA 5C3EC 2E2IC 1ZYRA 2E2JC 5D4DA 1IW7A 4G7HA 3RZOC 4A3LC 4A3GC 3HOXK 4OIOA 3GTPC 3RZOK 4MEYA 4A3GK 4A3LK 1BDFA 1SMYA 3GTPK 3GTMK 4MQ9A 3S15C 4C2MK 5M5XK 4QIWL 2R92C 4C2MC 5IP7C 3S16C 4A3KK 5IP7K 5IP9C 4YG2A 2PPBA 3I4MC 1TWHK 4X6AC 2WB1L 5IP9K 4G7ZA 1R9TK 3I4MK 1I6VA 2Y0SL 3HKZL 1I6HC 4A3IC 3S1MC 2VUMC 3S1QC 3S17C 4C3HC 4A3FK 4C3JC 3S17K 3S2DC 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X K;  2JA7 C;  2WB1 D;  3EQL A;  1SFO C;  1TWC C;  2JA6 K;  2R7Z K;  3GTK C;  1TWF K;  4A3J C;  1TWC K;  3S14 C;  3S14 K;  3DXJ A;  5FLM C;  4QJV A;  2PMZ D;  3HOY K;  2NVT K;  5IYC C;  2R93 K;  1YNJ A;  4BY1 K;  5FLM K;  3HOY C;  4XSZ A;  1Y1W C;  4YFN A;  4A3M K;  1Y1V C;  4KN7 A;  4AYB L;  5TMF A;  4BBS C;  1I50 C;  2O5I A;  4BY7 K;  4BBS K;  4XSX A;  4Q5S A;  1TWA C;  3GTQ K;  3GTO K;  5M3F K;  4Y7N K;  4A3B C;  2JA5 K;  2O5J A;  3H0G C;  4QJV B;  4A3C K;  4LJZ A;  4ZH4 A;  4Y7N C;  3S1R C;  5FJ8 K;  3HOU K;  2NVY C;  4MEX A;  3RZD C;  3H0G K;  2PA8 D;  3CQZ C;  3K7A C;  3S1R K;  4Y52 C;  4GZY A;  3GTK K;  3S1N K;  4LK0 A;  3CQZ K;  3K7A K;  4BBR K;  4KN4 A;  3HOX C;  2E2H C;  4BBR C;  4YFK A;  4BXX K;  4KMU A;  4JK1 A;  2E2H K;  3GTM C;  3GTG K;  4BXX C;  2E2J K;  2E2I K;  3S15 K;  1I3Q K;  3GTG C;  3FKI C;  1I3Q C;  4A3D C;  5M5Y K;  4A3E K;  2JA8 C;  5C44 K;  4A3K C;  3S16 K;  3FKI K;  2WAQ L;  4A3E C;  3HOV C;  2NVQ K;  5C44 C;  2JA8 K;  2R92 K;  4A3D K;  5TMC A;  4OIN A;  4QIW D;  4X6A K;  2Y0S D;  2NVQ C;  1XPP A;  1R9T C;  1K83 C;  5IYD C;  3HOV K;  3PO2 K;  4OIP A;  1WCM C;  4YFX A;  3PO2 C;  1K83 K;  1YNN A;  1TWH C;  3WOD A;  4A3I K;  3HOW C;  2VUM K;  1WCM K;  5IYD K;  4A3F C;  3I4N C;  4C3H K;  4OIQ A;  5M3M K;  2WAQ D;  2A69 A;  3HOW K;  5IYB K;  1I6H K;  3I4N K;  5C4X C;  3S1M K;  3HKZ D;  2JA6 C;  2R7Z C;  1SFO K;  2JA7 K;  3S1Q K;  3S2H C;  5IYB C;  4C3J K;  3M3Y K;  3S2H K;  3S2D K;  2A68 A;  2BE5 A;  3M3Y C;  2R93 C;  4A3J K;  1TWG C;  4BY1 C;  4Q4Z A;  1Y1W K;  4NOI A;  1TWG K;  3GTL C;  1Y1V K;  2NVT C;  5IYC K;  3H3V D;  2PMZ L;  3GTL K;  3HOZ K;  4A3M C;  3GTJ K;  2NVX K;  3HOZ C;  4OIR A;  3GTQ C;  3M4O C;  3GTO C;  3GTJ C;  1I50 K;  2NVX C;  4AYB D;  4A93 C;  1HQM A;  2JA5 C;  4A3B K;  3M4O K;  4BY7 C;  3PO3 C;  3H3V L;  4A93 K;  1TWA K;  5M5W K;  4C3I K;  4LK1 A;  3RZD K;  3PO3 K;  4Y52 K;  3S1N C;  4C3I C;  4A3C C;  2CW0 A;  5C4J C;  3HOU C;  2NVY K;  4LLG A;  5C4J K;  2B63 K;  2YU9 K;  5C3E K;  4XLP A;  2PA8 L;  2A6H A;  2A6E A;  4XLN A;  2B63 C;  2YU9 C;  4G7O A;  5C3E C;  2E2I C;  1ZYR A;  2E2J C;  5D4D A;  1IW7 A;  4G7H A;  3RZO C;  4A3L C;  4A3G C;  3HOX K;  4OIO A;  3GTP C;  3RZO K;  4MEY A;  4A3G K;  4A3L K;  1BDF A;  1SMY A;  3GTP K;  3GTM K;  4MQ9 A;  3S15 C;  4C2M K;  5M5X K;  4QIW L;  2R92 C;  4C2M C;  5IP7 C;  3S16 C;  4A3K K;  5IP7 K;  5IP9 C;  4YG2 A;  2PPB A;  3I4M C;  1TWH K;  4X6A C;  2WB1 L;  5IP9 K;  4G7Z A;  1R9T K;  3I4M K;  1I6V A;  2Y0S L;  3HKZ L;  1I6H C;  4A3I C;  3S1M C;  2VUM C;  3S1Q C;  3S17 C;  4C3H C;  4A3F K;  4C3J C;  3S17 K;  3S2D C;  1TWF C; 
#chains in the Genus database with same CATH topology
 2JA7 C;  1SFO C;  2R7Z K;  4A3J C;  1TWC K;  1O2B A;  1B4A A;  3GDZ A;  4QJV A;  2PMZ D;  3BP3 A;  5IYC C;  2V6T A;  5TMF A;  1I50 C;  1TWA A;  4BY7 K;  4BBS K;  2RH6 A;  2E2I A;  4GTD A;  4G0W A;  5M3F K;  5TJ3 A;  4WFB S;  4A3B C;  4A3C K;  5FJ8 K;  1O24 A;  3RZD C;  4FZB A;  1XZQ B;  4LK0 A;  1WOS A;  4JK1 A;  3GTM C;  4BXX C;  2E2I K;  3S15 K;  1I3Q K;  2XCR B;  1I3Q C;  4A3D C;  4A3E K;  4A3K C;  3FKI K;  2NVQ K;  4A3E C;  4A3D K;  5C44 C;  1O2A A;  5EGE A;  5TMC A;  4X6A K;  4QIW D;  1XPP A;  1R9T C;  1I50 A;  1WCM C;  2VUM K;  2R93 A;  1WCM K;  1ZVU A;  4OIQ A;  4LOW A;  2L3U A;  2ZUF A;  5C4X C;  3M3Y K;  2A68 A;  4RMF A;  5EGH A;  3M3Y C;  1JOE A;  1USO A;  1TWG C;  4BY1 C;  1Y1W K;  1Y1V K;  2PMZ L;  3Q3Q A;  5JVH S;  1DCP A;  2FQO A;  5CHP A;  5DM7 S;  3AQP A;  3M4O C;  3GTO C;  1O25 A;  2NVX C;  3GTQ A;  5HL8 A;  4P5B A;  4KAR A;  3T01 A;  5M5W K;  4C3I K;  4LK1 A;  4C3I C;  5C4J C;  4KC6 A;  4WIL A;  4LLG A;  5C4J K;  4KM8 A;  1KQ4 A;  2L5N A;  2JH3 A;  1PJ6 A;  2A6H A;  1ZYR A;  3HOX K;  5D4D A;  5DM6 S;  4G7H A;  4KM9 A;  2KWA A;  3GTP C;  3HXA A;  2GSN A;  2D6F C;  4ILD A;  2V6U A;  4O2D A;  3OEP A;  3BUE A;  2YU9 A;  5IP9 C;  3IPJ A;  5HQH A;  4LQY A;  4WCE S;  5IP9 K;  4G7Z A;  1I6V A;  1I6H C;  2NVY A;  3S1M C;  3GTG A;  2GSU A;  4C3H C;  4A3F K;  4C3J C;  3LPX A;  3N0B A;  3S2D C;  2WB1 D;  3EQL A;  5IOQ A;  1TWC C;  2JA6 K;  4FM9 A;  4WFN S;  3S14 K;  4KAW X;  1FEU A;  4GTA A;  3HOY K;  1C0A A;  5FLM K;  3HOY C;  1IS1 A;  3GIR A;  3TFH A;  1BJT A;  1EH1 A;  4KN7 A;  1VH2 A;  4AYB L;  1PJ7 A;  4BBS C;  3AD7 C;  2O5I A;  2GAH C;  4KB2 A;  4KAT A;  3GTQ K;  2JA5 K;  1PJ5 A;  1UV7 A;  4Y52 C;  4GZY A;  4GTB A;  3CQZ A;  4YFK A;  1O28 A;  2CFA B;  1ZXO A;  2E2J K;  5IOS A;  1F7V A;  3GTG K;  3FKI A;  3GTG C;  3FKI C;  5M5Y K;  3S16 K;  5C44 K;  2ZJP S;  1J6W A;  2WAQ L;  1XXB A;  2R92 K;  4OIN A;  1F93 A;  1WCM A;  3QX3 A;  1J6X A;  3ERE D;  4PAA A;  1YNN A;  1TWH C;  5JVG S;  3JST A;  2FQT A;  2A69 A;  3HOW K;  5E68 A;  5IYB K;  3S1Q K;  5IYB C;  4G0V A;  3S2H K;  2BE5 A;  1O27 A;  3FOE A;  2R93 C;  4A3J K;  3ORE A;  1JVI A;  5CJ9 A;  4NOI A;  2NVT C;  1EFW A;  3GTL K;  4A3M C;  3TFJ A;  2NVX K;  2NVX A;  3GSI A;  1I50 K;  2ZUE A;  3GTM A;  1YCL A;  3H3V L;  1DCO A;  3L4J A;  1TWA K;  3RZD K;  3S1N C;  2ZJQ S;  4A3C C;  1EQR A;  5HL7 S;  2NVY K;  2B63 K;  2B63 A;  3G4A A;  3AD8 C;  2A6E A;  4XLN A;  2B63 C;  2YU9 C;  1WQH A;  2KXY A;  1IW7 A;  4OIO A;  1VLO A;  4MEY A;  3T02 A;  1RU0 A;  1BDF A;  3GTM K;  4MQ9 A;  3S15 C;  2KQ1 A;  5M5X K;  3A8K A;  1WSR A;  4A3K K;  2PPB A;  4X6A C;  3ADA C;  1R9T K;  3I4M K;  3HKZ L;  2P8T A;  2KPU A;  3S17 K;  4WJ3 M;  4WFA S;  3PIO S;  1WQF A;  5L46 A;  2JA7 A;  1TWC A;  2RGR A;  3S14 C;  1K83 A;  4PAB A;  5FLM C;  1ZBS A;  4BY1 K;  2GAG C;  4XSZ A;  2ZJR S;  1Y1W C;  4YFN A;  1XZQ A;  1Y1V C;  3LYW A;  4WF9 S;  1BGW A;  4Q5S A;  3GTO K;  4QJV B;  4LJZ A;  4ZH4 A;  4Y7N C;  2ZFZ A;  1IL2 A;  3HOU K;  1WOP A;  3LAJ A;  4MEX A;  3H0G K;  1EK8 A;  3K7A C;  3AH5 A;  3N3Y A;  3S1R K;  1WQG A;  4IO9 S;  3K7A K;  3VA7 A;  4KN4 A;  5JVO A;  1ISE A;  3GTO A;  3G4C A;  1AB4 A;  3MML B;  3L4K A;  1INN A;  4KMD A;  1I3Q A;  4M1X A;  4GTL A;  2JA8 K;  1GE9 A;  3A8J A;  3AQO A;  2Y0S D;  3CF5 S;  5IYD C;  3PO2 K;  3TFI A;  4YFX A;  3PO2 C;  4A3I K;  5IYD K;  3HOW C;  3GTP A;  4A3F C;  4C3H K;  5M3M K;  1I6H K;  3I4N K;  1Y1V A;  2R7Z C;  1YX2 A;  1SFO K;  2JA7 K;  2XCO A;  3S2H C;  4P9S A;  4C3J K;  1O29 A;  3T00 A;  1O26 A;  4KMH A;  3NUH A;  2V6S A;  2E2H A;  4BKW A;  4Q4Z A;  3S0X A;  2P5M A;  3GTL C;  3GEH A;  5IYC K;  4IOC S;  4OIR A;  3GTQ C;  4LR2 A;  4XCH A;  4AYB D;  1HQM A;  4A3B K;  4BY7 C;  3OPF A;  1XXA A;  4A93 K;  2JA5 A;  5JFE A;  3PO3 K;  4Y52 K;  2CW0 A;  3GEE A;  3FHZ A;  3SZY A;  1WIH A;  2YU9 K;  5C3E K;  4G7O A;  3N0C A;  5C3E C;  2E2I C;  1ZQ1 C;  4A3G C;  4BXX K;  4U67 S;  4A3G K;  4A3L K;  1V5V A;  4GTC A;  3GTL A;  2R92 C;  5IP7 C;  1HI9 A;  1XXC A;  1F9N A;  5IP7 K;  4YG2 A;  3I4M C;  2WB1 L;  3S1Q C;  2VUM C;  3S17 C;  1SFO A;  1WOR A;  4WJ4 A;  5C4X K;  4DDQ A;  2PHC B;  3GTK C;  1TWF K;  3GTJ A;  3FOF A;  3DXJ A;  2R93 K;  2NVT K;  2VUM A;  1Y1W A;  1YNJ A;  4GTE A;  4A3M K;  3V4G A;  4GTF A;  5IOT A;  1TWH A;  4XSX A;  1TWA C;  1WSV A;  4KMA A;  4Y7N K;  2O5J A;  3H0G C;  4P5A A;  4GFQ A;  3S1R C;  2NVY C;  2PA8 D;  3CQZ C;  4KB4 A;  3GTK K;  3S1N K;  3CQZ K;  4BBR K;  5IOR A;  3HOX C;  2Y3P A;  2E2H C;  4BBR C;  3DLL S;  1G51 A;  4KMU A;  3CAG A;  2E2H K;  4IOA S;  1B4B A;  2GSO A;  4J3N A;  1O2F B;  3AD9 C;  4AH6 A;  4KDD A;  1VJE A;  2JA8 C;  3HOV C;  1XZP B;  1VGX A;  1JQW A;  2NVQ C;  3HOV K;  1K83 C;  4BLB A;  4OIP A;  1K83 K;  3WOD A;  2CFA A;  2W7V A;  3I4N C;  2WAQ D;  2JA6 A;  3H0G A;  3S1M K;  3HKZ D;  2JA6 C;  2R92 A;  4BLA A;  2R7Z A;  3S2D K;  3A8I A;  4GT9 A;  1IQ0 A;  3PIP S;  1TWG K;  3H3V D;  3HOZ K;  1TWF A;  3GTJ K;  3HOZ C;  3GTJ C;  3GTK A;  4A93 C;  1IBA A;  2JA5 C;  1VRQ C;  3M4O K;  3PO3 C;  1J6V A;  3SZZ A;  1USM A;  1XZP A;  1DCH A;  3HOU C;  1L0W A;  4G0U A;  4XLP A;  2PA8 L;  1R9T A;  2EBB A;  2E2J C;  3RZO C;  4A3L C;  3RZO K;  1BS2 A;  1DD5 A;  1SMY A;  3GTP K;  1J98 A;  1IE0 A;  1X31 C;  4C2M K;  4QIW L;  4C2M C;  3S16 C;  3GEI A;  4C45 A;  4KAS A;  1TWH K;  2XCQ A;  1TWG A;  1EI6 A;  2Y0S L;  4A3I C;  3LAP A;  3TTG A;  1F7U A;  1WOO A;  3BP8 C;  1TWF C; 
#chains in the Genus database with same CATH homology
 5C4X K;  2JA7 C;  2WB1 D;  3EQL A;  1SFO C;  1TWC C;  2JA6 K;  2R7Z K;  3GTK C;  1TWF K;  4A3J C;  1TWC K;  3S14 C;  3S14 K;  3DXJ A;  5FLM C;  4QJV A;  2PMZ D;  3HOY K;  2NVT K;  5IYC C;  2R93 K;  1YNJ A;  4BY1 K;  5FLM K;  3HOY C;  4XSZ A;  1Y1W C;  4YFN A;  4A3M K;  1Y1V C;  4KN7 A;  4AYB L;  5TMF A;  4BBS C;  1I50 C;  2O5I A;  4BY7 K;  4BBS K;  4XSX A;  4Q5S A;  1TWA C;  3GTQ K;  3GTO K;  5M3F K;  4Y7N K;  4A3B C;  2JA5 K;  2O5J A;  3H0G C;  4QJV B;  4A3C K;  4LJZ A;  4ZH4 A;  4Y7N C;  3S1R C;  5FJ8 K;  3HOU K;  2NVY C;  4MEX A;  3RZD C;  3H0G K;  2PA8 D;  3CQZ C;  3K7A C;  3S1R K;  4Y52 C;  4GZY A;  3GTK K;  3S1N K;  4LK0 A;  3CQZ K;  3K7A K;  4BBR K;  4KN4 A;  3HOX C;  2E2H C;  4BBR C;  4YFK A;  4BXX K;  4KMU A;  4JK1 A;  2E2H K;  3GTM C;  3GTG K;  4BXX C;  2E2J K;  2E2I K;  3S15 K;  1I3Q K;  3GTG C;  3FKI C;  1I3Q C;  4A3D C;  5M5Y K;  4A3E K;  2JA8 C;  5C44 K;  4A3K C;  3S16 K;  3FKI K;  2WAQ L;  4A3E C;  3HOV C;  2NVQ K;  5C44 C;  2JA8 K;  2R92 K;  4A3D K;  5TMC A;  4OIN A;  4QIW D;  4X6A K;  2Y0S D;  2NVQ C;  1XPP A;  1R9T C;  1K83 C;  5IYD C;  3HOV K;  3PO2 K;  4OIP A;  1WCM C;  4YFX A;  3PO2 C;  1K83 K;  1YNN A;  1TWH C;  3WOD A;  4A3I K;  3HOW C;  2VUM K;  1WCM K;  5IYD K;  4A3F C;  3I4N C;  4C3H K;  4OIQ A;  5M3M K;  2WAQ D;  2A69 A;  3HOW K;  5IYB K;  1I6H K;  3I4N K;  5C4X C;  3S1M K;  3HKZ D;  2JA6 C;  2R7Z C;  1SFO K;  2JA7 K;  3S1Q K;  3S2H C;  5IYB C;  4C3J K;  3M3Y K;  3S2H K;  3S2D K;  2A68 A;  2BE5 A;  3M3Y C;  2R93 C;  4A3J K;  1TWG C;  4BY1 C;  4Q4Z A;  1Y1W K;  4NOI A;  1TWG K;  3GTL C;  1Y1V K;  2NVT C;  5IYC K;  3H3V D;  2PMZ L;  3GTL K;  3HOZ K;  4A3M C;  3GTJ K;  2NVX K;  3HOZ C;  4OIR A;  3GTQ C;  3M4O C;  3GTO C;  3GTJ C;  1I50 K;  2NVX C;  4AYB D;  4A93 C;  1HQM A;  2JA5 C;  4A3B K;  3M4O K;  4BY7 C;  3PO3 C;  3H3V L;  4A93 K;  1TWA K;  5M5W K;  4C3I K;  4LK1 A;  3RZD K;  3PO3 K;  4Y52 K;  3S1N C;  4C3I C;  4A3C C;  2CW0 A;  5C4J C;  3HOU C;  2NVY K;  4LLG A;  5C4J K;  2B63 K;  2YU9 K;  5C3E K;  4XLP A;  2PA8 L;  2A6H A;  2A6E A;  4XLN A;  2B63 C;  2YU9 C;  4G7O A;  5C3E C;  2E2I C;  1ZYR A;  2E2J C;  5D4D A;  1IW7 A;  4G7H A;  3RZO C;  4A3L C;  4A3G C;  3HOX K;  4OIO A;  3GTP C;  3RZO K;  4MEY A;  4A3G K;  4A3L K;  1BDF A;  1SMY A;  3GTP K;  3GTM K;  4MQ9 A;  3S15 C;  4C2M K;  5M5X K;  4QIW L;  2R92 C;  4C2M C;  5IP7 C;  3S16 C;  4A3K K;  5IP7 K;  5IP9 C;  4YG2 A;  2PPB A;  3I4M C;  1TWH K;  4X6A C;  2WB1 L;  5IP9 K;  4G7Z A;  1R9T K;  3I4M K;  1I6V A;  2Y0S L;  3HKZ L;  1I6H C;  4A3I C;  3S1M C;  2VUM C;  3S1Q C;  3S17 C;  4C3H C;  4A3F K;  4C3J C;  3S17 K;  3S2D C;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...