2CW0A

Crystal structure of thermus thermophilus rna polymerase holoenzyme at 3.3 angstroms resolution
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of bacterial RNA polymerase by streptolydigin: stabilization of a straight-bridge-helix active-center conformation
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 36
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2cw0A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2cw0A01
1TWCC 3CQZK 3M3YC 5IP9K 4A3CC 3GTJK 2VUMK 4A3JK 3S1MK 1I6HK 2R93K 2WB1D 3GTLC 3S2HC 5IYBK 4NOIA 3RZDK 1SFOK 4BBSK 3M3YK 5C3EC 2E2IC 4X6AC 1I50K 2E2HC 3S2DC 2PMZL 4A3DK 4BY7K 2BE5A 3HOUC 4A3EK 1Y1VC 4LJZA 2NVQC 3HOYC 2CW0A 2JA5C 4LK1A 2PA8L 4KN7A 2WB1L 3S1RK 2R7ZK 1Y1WC 2JA6K 4GZYA 3S2HK 4A3FK 1I6VA 3GTQK 3HOXC 3H0GK 2B63K 5IYCK 2NVQK 2PA8D 3H3VL 3S17K 4A3IK 3RZOK 1ZYRA 3GTQC 4G7ZA 4ZH4A 3HKZD 1TWHC 2R92K 1SFOC 3RZDC 3GTLK 4A3DC 4YG2A 4A3KC 2WAQL 3I4NK 5C4XC 4XLNA 2E2JK 5D4DA 4AYBL 5IYDK 2NVYC 4C3HC 3HKZL 5C4JK 4LK0A 4Q5SA 3GTPK 3HOXK 4A3JC 2JA6C 4BY1K 3K7AC 4XSXA 5C4XK 4C2MK 5IP7K 3HOZK 4KMUA 2O5JA 3S16K 2E2JC 2A6HA 4A3MC 5M5XK 3S15K 2E2IK 4BY1C 4OINA 4XSZA 4G7OA 5IP7C 2WAQD 3HOWC 3HOZC 1R9TK 5C44K 3K7AK 4JK1A 2O5IA 2A6EA 2JA5K 3S15C 4A3MK 4A3GC 3GTOK 2YU9K 3PO2C 1TWFK 1TWAK 1TWGK 4C3JK 5FJ8K 2NVXK 3I4MK 4A3BC 4QJVA 4BBSC 4Y52K 3EQLA 4YFKA 4A3EC 3GTMC 3HOUK 3I4MC 1WCMC 4BY7C 2R7ZC 2E2HK 1TWAC 1TWGC 4G7HA 4A93C 4AYBD 3HOYK 3S2DK 5M3FK 3S1NC 3GTMK 3DXJA 3H0GC 2Y0SD 4Y52C 1K83C 3M4OC 4OIOA 3GTJC 5IYBC 2A68A 4YFXA 3PO3C 4BXXC 4MQ9A 3GTKK 3FKIK 5TMFA 3S14K 4QIWL 5M5WK 3S1NK 4A93K 4X6AK 1TWFC 3PO2K 5C3EK 2YU9C 3S14C 1I50C 4YFNA 4OIRA 3PO3K 4A3LK 3GTGC 1Y1WK 3GTKC 3S1QC 4BXXK 2JA7K 5IP9C 2VUMC 3S1MC 1R9TC 1I6HC 3HOWK 3CQZC 1TWCK 1BDFA 4KN4A 4OIPA 1HQMA 4A3CK 1WCMK 3GTOC 4A3GK 3H3VD 5FLMC 1K83K 3M4OK 4BBRC 2R92C 1TWHK 5M3MK 4Y7NK 3S1QK 4C3JC 4XLPA 3WODA 4A3BK 4C3IK 2PPBA 4A3KK 4Q4ZA 2JA8C 3HOVK 2B63C 1IW7A 2PMZD 2Y0SL 4BBRK 5C44C 2JA7C 5C4JC 2NVYK 4A3IC 5TMCA 1I3QC 2NVTC 4C3HK 1SMYA 4OIQA 3RZOC 2NVXC 3GTGK 4C3IC 4QJVB 1Y1VK 1YNNA 3HOVC 2JA8K 4LLGA 4C2MC 1YNJA 4QIWD 4MEXA 3S16C 1I3QK 1XPPA 4A3FC 3FKIC 2NVTK 4MEYA 3S1RC 5M5YK 5FLMK 4Y7NC 2R93C 2A69A 5IYDC 3GTPC 3I4NC 4A3LC 5IYCC 3S17C
chains in the Genus database with same CATH superfamily
3CQZK 3FHZA 1I6HK 2ZFZA 3G4CA 4LR2A 4A3JK 3PIPS 4WF9S 4P9SA 1UV7A 5HL8A 4FZBA 4KMHA 2RGRA 3S2DC 4KASA 4A3DK 4BY7K 3GTMA 1Y1VC 2R7ZK 2CW0A 2PA8L 4KN7A 3S2HK 4A3FK 2RH6A 4KC6A 4J3NA 4IOCS 3H3VL 2PA8D 4G0VA 3FOEA 1PJ5A 4YG2A 1XZPB 1IE0A 3AQOA 5C4XC 4GFQA 2E2JK 4C3HC 3HKZL 1J98A 3GTPK 3PIOS 5M5XK 3S15K 3OEPA 3L4JA 5IP7C 2WAQD 2XCRB 3GDZA 3A8KA 2NVYA 4A3MK 3GTKA 4A3GC 2YU9K 3AH5A 5FJ8K 3IPJA 4C3JK 2NVXK 4QJVA 4KMAA 1WQFA 2KWAA 2V6TA 2ZJQS 4A3EC 3GTMC 3I4MC 3CQZA 4G7HA 3H0GA 1IL2A 2E2IA 5M3FK 1FEUA 5JVOA 5JVGS 2ZJRS 3TTGA 4Y52C 4YFXA 1BGWA 3S1QK 4MQ9A 2CFAA 4O2DA 5M5WK 2GSNA 2YU9C 3PO3K 1I50C 1O26A 1ZXOA 1ISEA 2V6SA 4A3CK 3QX3A 1TWCA 4A3GK 1V5VA 2JA7A 2Y3PA 3OPFA 3LAJA 4KM9A 3WODA 4A3BK 2Y0SL 1WOSA 4BBRK 5C44C 1WQGA 2JA7C 3DLLS 4C3HK 3GTGK 1I3QC 1YNNA 1YNJA 4QIWD 3S16C 1XPPA 3FKIC 4FM9A 2R93C 5IYCC 4RMFA 4KM8A 3AD9C 5IP9K 4A3CC 1DD5A 2XCQA 4A3LC 4LQYA 3S2HC 5IYBK 4XCHA 5IORA 2E2IC 5JFEA 2KXYA 2JH3A 3HOYC 2FQOA 1HI9A 2KQ1A 4M1XA 2JA6K 3TFHA 3GTQK 1XZQB 4WILA 5IOSA 2NVQK 1JOEA 3S17K 4G7ZA 3HKZD 1TWHC 1B4BA 1SFOC 2R92K 2L3UA 3GTLK 1G51A 1WQHA 4A3KC 2WAQL 2B63A 4AYBL 2NVYC 3N0CA 3TFIA 4C2MK 5IP7K 4KMUA 1I3QA 4KARA 2A6HA 4A3MC 3GTOA 4XSZA 4G7OA 1SFOA 4WFNS 3A8IA 4JK1A 2O5IA 5DM6S 1R9TA 2A6EA 1DCOA 2JA5K 3S15C 1TWFK 3LPXA 1BS2A 3T02A 3I4MK 5HL7S 4BBSC 1DCHA 1ZBSA 4Y52K 3HOUK 3GTQA 1WCMC 4GTEA 2E2HK 4A93C 3GTMK 1F7VA 1TWGA 2Y0SD 1TWAA 3M4OC 3GEHA 4OIOA 5IYBC 1XXCA 4P5BA 3GTKK 3S14K 3G4AA 1EI6A 3S1NK 3AD8C 1EQRA 3PO2K 4OIRA 1J6VA 2R93A 3V4GA 3BP8C 1Y1WK 4BXXK 3FKIA 5IP9C 3HOWK 3CQZC 1BDFA 4KAWX 3BUEA 2EBBA 1WCMK 1DCPA 2GAGC 3GTOC 2P5MA 1BJTA 3M4OK 4BBRC 4BKWA 2R92C 1TWHK 5L46A 3CF5S 4Q4ZA 1IW7A 2W7VA 1ZQ1C 1VLOA 5C4JC 2NVTC 1SMYA 2NVXC 1Y1VK 3A8JA 4C2MC 4A3FC 5FLMK 4Y7NC 3MMLB 5IYDC 3I4NC 1TWFA 2KPUA 1ZVUA 1TWCC 2JA5A 3SZZA 1Y1VA 1F7UA 2R93K 2VUMA 2WB1D 3RZDK 5HQHA 4NOIA 4BBSK 3M3YK 1I50K 2E2HC 4GTFA 4LOWA 2BE5A 3HOUC 4LJZA 2NVQC 2JA5C 4LK1A 1XZQA 2WB1L 3S1RK 1B4AA 1XZPA 3HOXC 3HXAA 1K83A 3H0GK 1O29A 2D6FC 4A3IK 3RZOK 3GTQC 1J6XA 3CAGA 1INNA 1WORA 3RZDC 4A3DC 4GTCA 3I4NK 5IYDK 4XLNA 4G0UA 4LK0A 4Q5SA 2V6UA 2GSUA 4KATA 3HOXK 1GE9A 4A3JC 4BY1K 4XSXA 1WSRA 3S16K 1WSVA 3GIRA 2P8TA 3LAPA 3LYWA 3HOZC 4GT9A 2ZUFA 4C45A 1R9TK 3K7AK 1O2AA 4ILDA 1USMA 1WOOA 3L4KA 4YFKA 2ZUEA 3N3YA 1AB4A 3HOYK 1TWAC 1TWGC 4AYBD 1PJ6A 3S1NC 1EK8A 1JQWA 4AH6A 1RU0A 2A68A 4BXXC 5TMFA 4QIWL 4A93K 3GTJA 4WJ3M 3S14C 4A3LK 4KDDA 3SZYA 3GTGC 3GTKC 2JA7K 3OREA 1I6HC 1R9TC 4BLBA 1WCMA 4G0WA 4OIPA 3H3VD 1O28A 1O27A 2JA6A 4C3IK 4GTLA 2JA8C 3HOVK 1IBAA 2R92A 2NVXA 3Q3QA 1YCLA 4A3IC 5TMCA 4OIQA 3RZOC 3GSIA 2PHCB 3JSTA 4MEXA 2NVTK 3GTGA 4MEYA 5M5YK 1O25A 2A69A 3GTPC 3VA7A 3S17C 1F93A 3M3YC 5IOQA 1JVIA 2VUMK 3GTJK 3S1MK 3ERED 4GTBA 3GTLC 1SFOK 1IQ0A 4GTDA 5C3EC 4X6AC 2PMZL 1EH1A 4A3EK 4PABA 1Y1WC 4GZYA 1I6VA 3GTPA 1WIHA 2E2HA 2B63K 3N0BA 1EFWA 5IYCK 5EGHA 4WFBS 4P5AA 1ZYRA 1PJ7A 4ZH4A 1VRQC 3ADAC 4IO9S 1O2FB 3GEIA 1XXAA 5D4DA 5C4JK 5DM7S 1USOA 2JA6C 4KMDA 3K7AC 1O24A 4KB2A 5C4XK 3HOZK 2O5JA 4U67S 1F9NA 2E2JC 4WJ4A 2E2IK 4BY1C 4OINA 1VH2A 3BP3A 1L0WA 1YX2A 3HOWC 5C44K 3AD7C 5CHPA 3T00A 1KQ4A 3GTOK 1C0AA 3PO2C 1TWAK 1TWGK 2YU9A 4A3BC 1X31C 3EQLA 4BY7C 2R7ZC 3S2DK 1O2BA 3DXJA 3GTLA 3H0GC 2R7ZA 1K83C 4BLAA 3GTJC 4PAAA 3PO3C 1Y1WA 3FKIK 2GAHC 4X6AK 1TWFC 3GEEA 4KB4A 5C3EK 2CFAB 4YFNA 5IOTA 3S1QC 3AQPA 2VUMC 3S1MC 4WCES 1TWCK 5CJ9A 4KN4A 5EGEA 1HQMA 3NUHA 1WOPA 1IS1A 1J6WA 5FLMC 2L5NA 5JVHS 1K83K 3TFJA 3S0XA 5M3MK 4Y7NK 4C3JC 1XXBA 4XLPA 4IOAS 2PPBA 4A3KK 2B63C 2PMZD 2ZJPS 5TJ3A 2FQTA 3FOFA 2GSOA 2NVYK 4DDQA 4C3IC 1TWHA 4QJVB 3HOVC 2JA8K 4LLGA 2XCOA 1I3QK 4WFAS 3S1RC 5E68A 3T01A 1I50A 1VGXA 1VJEA 4GTAA
chains in the Genus database with same CATH topology
1TWCC 3CQZK 3M3YC 5IP9K 4A3CC 3GTJK 2VUMK 4A3JK 3S1MK 1I6HK 2R93K 2WB1D 3GTLC 3S2HC 5IYBK 4NOIA 3RZDK 1SFOK 4BBSK 3M3YK 5C3EC 2E2IC 4X6AC 1I50K 2E2HC 3S2DC 2PMZL 4A3DK 4BY7K 2BE5A 3HOUC 4A3EK 1Y1VC 4LJZA 2NVQC 3HOYC 2CW0A 2JA5C 4LK1A 2PA8L 4KN7A 2WB1L 3S1RK 2R7ZK 1Y1WC 2JA6K 4GZYA 3S2HK 4A3FK 1I6VA 3GTQK 3HOXC 3H0GK 2B63K 5IYCK 2NVQK 2PA8D 3H3VL 3S17K 4A3IK 3RZOK 1ZYRA 3GTQC 4G7ZA 4ZH4A 3HKZD 1TWHC 2R92K 1SFOC 3RZDC 3GTLK 4A3DC 4YG2A 4A3KC 2WAQL 3I4NK 5C4XC 4XLNA 2E2JK 5D4DA 4AYBL 5IYDK 2NVYC 4C3HC 3HKZL 5C4JK 4LK0A 4Q5SA 3GTPK 3HOXK 4A3JC 2JA6C 4BY1K 3K7AC 4XSXA 5C4XK 4C2MK 5IP7K 3HOZK 4KMUA 2O5JA 3S16K 2E2JC 2A6HA 4A3MC 5M5XK 3S15K 2E2IK 4BY1C 4OINA 4XSZA 4G7OA 5IP7C 2WAQD 3HOWC 3HOZC 1R9TK 5C44K 3K7AK 4JK1A 2O5IA 2A6EA 2JA5K 3S15C 4A3MK 4A3GC 3GTOK 2YU9K 3PO2C 1TWFK 1TWAK 1TWGK 4C3JK 5FJ8K 2NVXK 3I4MK 4A3BC 4QJVA 4BBSC 4Y52K 3EQLA 4YFKA 4A3EC 3GTMC 3HOUK 3I4MC 1WCMC 4BY7C 2R7ZC 2E2HK 1TWAC 1TWGC 4G7HA 4A93C 4AYBD 3HOYK 3S2DK 5M3FK 3S1NC 3GTMK 3DXJA 3H0GC 2Y0SD 4Y52C 1K83C 3M4OC 4OIOA 3GTJC 5IYBC 2A68A 4YFXA 3PO3C 4BXXC 4MQ9A 3GTKK 3FKIK 5TMFA 3S14K 4QIWL 5M5WK 3S1NK 4A93K 4X6AK 1TWFC 3PO2K 5C3EK 2YU9C 3S14C 1I50C 4YFNA 4OIRA 3PO3K 4A3LK 3GTGC 1Y1WK 3GTKC 3S1QC 4BXXK 2JA7K 5IP9C 2VUMC 3S1MC 1R9TC 1I6HC 3HOWK 3CQZC 1TWCK 1BDFA 4KN4A 4OIPA 1HQMA 4A3CK 1WCMK 3GTOC 4A3GK 3H3VD 5FLMC 1K83K 3M4OK 4BBRC 2R92C 1TWHK 5M3MK 4Y7NK 3S1QK 4C3JC 4XLPA 3WODA 4A3BK 4C3IK 2PPBA 4A3KK 4Q4ZA 2JA8C 3HOVK 2B63C 1IW7A 2PMZD 2Y0SL 4BBRK 5C44C 2JA7C 5C4JC 2NVYK 4A3IC 5TMCA 1I3QC 2NVTC 4C3HK 1SMYA 4OIQA 3RZOC 2NVXC 3GTGK 4C3IC 4QJVB 1Y1VK 1YNNA 3HOVC 2JA8K 4LLGA 4C2MC 1YNJA 4QIWD 4MEXA 3S16C 1I3QK 1XPPA 4A3FC 3FKIC 2NVTK 4MEYA 3S1RC 5M5YK 5FLMK 4Y7NC 2R93C 2A69A 5IYDC 3GTPC 3I4NC 4A3LC 5IYCC 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC C;  3CQZ K;  3M3Y C;  5IP9 K;  4A3C C;  3GTJ K;  2VUM K;  4A3J K;  3S1M K;  1I6H K;  2R93 K;  2WB1 D;  3GTL C;  3S2H C;  5IYB K;  4NOI A;  3RZD K;  1SFO K;  4BBS K;  3M3Y K;  5C3E C;  2E2I C;  4X6A C;  1I50 K;  2E2H C;  3S2D C;  2PMZ L;  4A3D K;  4BY7 K;  2BE5 A;  3HOU C;  4A3E K;  1Y1V C;  4LJZ A;  2NVQ C;  3HOY C;  2CW0 A;  2JA5 C;  4LK1 A;  2PA8 L;  4KN7 A;  2WB1 L;  3S1R K;  2R7Z K;  1Y1W C;  2JA6 K;  4GZY A;  3S2H K;  4A3F K;  1I6V A;  3GTQ K;  3HOX C;  3H0G K;  2B63 K;  5IYC K;  2NVQ K;  2PA8 D;  3H3V L;  3S17 K;  4A3I K;  3RZO K;  1ZYR A;  3GTQ C;  4G7Z A;  4ZH4 A;  3HKZ D;  1TWH C;  2R92 K;  1SFO C;  3RZD C;  3GTL K;  4A3D C;  4YG2 A;  4A3K C;  2WAQ L;  3I4N K;  5C4X C;  4XLN A;  2E2J K;  5D4D A;  4AYB L;  5IYD K;  2NVY C;  4C3H C;  3HKZ L;  5C4J K;  4LK0 A;  4Q5S A;  3GTP K;  3HOX K;  4A3J C;  2JA6 C;  4BY1 K;  3K7A C;  4XSX A;  5C4X K;  4C2M K;  5IP7 K;  3HOZ K;  4KMU A;  2O5J A;  3S16 K;  2E2J C;  2A6H A;  4A3M C;  5M5X K;  3S15 K;  2E2I K;  4BY1 C;  4OIN A;  4XSZ A;  4G7O A;  5IP7 C;  2WAQ D;  3HOW C;  3HOZ C;  1R9T K;  5C44 K;  3K7A K;  4JK1 A;  2O5I A;  2A6E A;  2JA5 K;  3S15 C;  4A3M K;  4A3G C;  3GTO K;  2YU9 K;  3PO2 C;  1TWF K;  1TWA K;  1TWG K;  4C3J K;  5FJ8 K;  2NVX K;  3I4M K;  4A3B C;  4QJV A;  4BBS C;  4Y52 K;  3EQL A;  4YFK A;  4A3E C;  3GTM C;  3HOU K;  3I4M C;  1WCM C;  4BY7 C;  2R7Z C;  2E2H K;  1TWA C;  1TWG C;  4G7H A;  4A93 C;  4AYB D;  3HOY K;  3S2D K;  5M3F K;  3S1N C;  3GTM K;  3DXJ A;  3H0G C;  2Y0S D;  4Y52 C;  1K83 C;  3M4O C;  4OIO A;  3GTJ C;  5IYB C;  2A68 A;  4YFX A;  3PO3 C;  4BXX C;  4MQ9 A;  3GTK K;  3FKI K;  5TMF A;  3S14 K;  4QIW L;  5M5W K;  3S1N K;  4A93 K;  4X6A K;  1TWF C;  3PO2 K;  5C3E K;  2YU9 C;  3S14 C;  1I50 C;  4YFN A;  4OIR A;  3PO3 K;  4A3L K;  3GTG C;  1Y1W K;  3GTK C;  3S1Q C;  4BXX K;  2JA7 K;  5IP9 C;  2VUM C;  3S1M C;  1R9T C;  1I6H C;  3HOW K;  3CQZ C;  1TWC K;  1BDF A;  4KN4 A;  4OIP A;  1HQM A;  4A3C K;  1WCM K;  3GTO C;  4A3G K;  3H3V D;  5FLM C;  1K83 K;  3M4O K;  4BBR C;  2R92 C;  1TWH K;  5M3M K;  4Y7N K;  3S1Q K;  4C3J C;  4XLP A;  3WOD A;  4A3B K;  4C3I K;  2PPB A;  4A3K K;  4Q4Z A;  2JA8 C;  3HOV K;  2B63 C;  1IW7 A;  2PMZ D;  2Y0S L;  4BBR K;  5C44 C;  2JA7 C;  5C4J C;  2NVY K;  4A3I C;  5TMC A;  1I3Q C;  2NVT C;  4C3H K;  1SMY A;  4OIQ A;  3RZO C;  2NVX C;  3GTG K;  4C3I C;  4QJV B;  1Y1V K;  1YNN A;  3HOV C;  2JA8 K;  4LLG A;  4C2M C;  1YNJ A;  4QIW D;  4MEX A;  3S16 C;  1I3Q K;  1XPP A;  4A3F C;  3FKI C;  2NVT K;  4MEY A;  3S1R C;  5M5Y K;  5FLM K;  4Y7N C;  2R93 C;  2A69 A;  5IYD C;  3GTP C;  3I4N C;  4A3L C;  5IYC C;  3S17 C; 
#chains in the Genus database with same CATH topology
 3CQZ K;  3FHZ A;  1I6H K;  2ZFZ A;  3G4C A;  4LR2 A;  4A3J K;  3PIP S;  4WF9 S;  4P9S A;  1UV7 A;  5HL8 A;  4FZB A;  4KMH A;  2RGR A;  3S2D C;  4KAS A;  4A3D K;  4BY7 K;  3GTM A;  1Y1V C;  2R7Z K;  2CW0 A;  2PA8 L;  4KN7 A;  3S2H K;  4A3F K;  2RH6 A;  4KC6 A;  4J3N A;  4IOC S;  3H3V L;  2PA8 D;  4G0V A;  3FOE A;  1PJ5 A;  4YG2 A;  1XZP B;  1IE0 A;  3AQO A;  5C4X C;  4GFQ A;  2E2J K;  4C3H C;  3HKZ L;  1J98 A;  3GTP K;  3PIO S;  5M5X K;  3S15 K;  3OEP A;  3L4J A;  5IP7 C;  2WAQ D;  2XCR B;  3GDZ A;  3A8K A;  2NVY A;  4A3M K;  3GTK A;  4A3G C;  2YU9 K;  3AH5 A;  5FJ8 K;  3IPJ A;  4C3J K;  2NVX K;  4QJV A;  4KMA A;  1WQF A;  2KWA A;  2V6T A;  2ZJQ S;  4A3E C;  3GTM C;  3I4M C;  3CQZ A;  4G7H A;  3H0G A;  1IL2 A;  2E2I A;  5M3F K;  1FEU A;  5JVO A;  5JVG S;  2ZJR S;  3TTG A;  4Y52 C;  4YFX A;  1BGW A;  3S1Q K;  4MQ9 A;  2CFA A;  4O2D A;  5M5W K;  2GSN A;  2YU9 C;  3PO3 K;  1I50 C;  1O26 A;  1ZXO A;  1ISE A;  2V6S A;  4A3C K;  3QX3 A;  1TWC A;  4A3G K;  1V5V A;  2JA7 A;  2Y3P A;  3OPF A;  3LAJ A;  4KM9 A;  3WOD A;  4A3B K;  2Y0S L;  1WOS A;  4BBR K;  5C44 C;  1WQG A;  2JA7 C;  3DLL S;  4C3H K;  3GTG K;  1I3Q C;  1YNN A;  1YNJ A;  4QIW D;  3S16 C;  1XPP A;  3FKI C;  4FM9 A;  2R93 C;  5IYC C;  4RMF A;  4KM8 A;  3AD9 C;  5IP9 K;  4A3C C;  1DD5 A;  2XCQ A;  4A3L C;  4LQY A;  3S2H C;  5IYB K;  4XCH A;  5IOR A;  2E2I C;  5JFE A;  2KXY A;  2JH3 A;  3HOY C;  2FQO A;  1HI9 A;  2KQ1 A;  4M1X A;  2JA6 K;  3TFH A;  3GTQ K;  1XZQ B;  4WIL A;  5IOS A;  2NVQ K;  1JOE A;  3S17 K;  4G7Z A;  3HKZ D;  1TWH C;  1B4B A;  1SFO C;  2R92 K;  2L3U A;  3GTL K;  1G51 A;  1WQH A;  4A3K C;  2WAQ L;  2B63 A;  4AYB L;  2NVY C;  3N0C A;  3TFI A;  4C2M K;  5IP7 K;  4KMU A;  1I3Q A;  4KAR A;  2A6H A;  4A3M C;  3GTO A;  4XSZ A;  4G7O A;  1SFO A;  4WFN S;  3A8I A;  4JK1 A;  2O5I A;  5DM6 S;  1R9T A;  2A6E A;  1DCO A;  2JA5 K;  3S15 C;  1TWF K;  3LPX A;  1BS2 A;  3T02 A;  3I4M K;  5HL7 S;  4BBS C;  1DCH A;  1ZBS A;  4Y52 K;  3HOU K;  3GTQ A;  1WCM C;  4GTE A;  2E2H K;  4A93 C;  3GTM K;  1F7V A;  1TWG A;  2Y0S D;  1TWA A;  3M4O C;  3GEH A;  4OIO A;  5IYB C;  1XXC A;  4P5B A;  3GTK K;  3S14 K;  3G4A A;  1EI6 A;  3S1N K;  3AD8 C;  1EQR A;  3PO2 K;  4OIR A;  1J6V A;  2R93 A;  3V4G A;  3BP8 C;  1Y1W K;  4BXX K;  3FKI A;  5IP9 C;  3HOW K;  3CQZ C;  1BDF A;  4KAW X;  3BUE A;  2EBB A;  1WCM K;  1DCP A;  2GAG C;  3GTO C;  2P5M A;  1BJT A;  3M4O K;  4BBR C;  4BKW A;  2R92 C;  1TWH K;  5L46 A;  3CF5 S;  4Q4Z A;  1IW7 A;  2W7V A;  1ZQ1 C;  1VLO A;  5C4J C;  2NVT C;  1SMY A;  2NVX C;  1Y1V K;  3A8J A;  4C2M C;  4A3F C;  5FLM K;  4Y7N C;  3MML B;  5IYD C;  3I4N C;  1TWF A;  2KPU A;  1ZVU A;  1TWC C;  2JA5 A;  3SZZ A;  1Y1V A;  1F7U A;  2R93 K;  2VUM A;  2WB1 D;  3RZD K;  5HQH A;  4NOI A;  4BBS K;  3M3Y K;  1I50 K;  2E2H C;  4GTF A;  4LOW A;  2BE5 A;  3HOU C;  4LJZ A;  2NVQ C;  2JA5 C;  4LK1 A;  1XZQ A;  2WB1 L;  3S1R K;  1B4A A;  1XZP A;  3HOX C;  3HXA A;  1K83 A;  3H0G K;  1O29 A;  2D6F C;  4A3I K;  3RZO K;  3GTQ C;  1J6X A;  3CAG A;  1INN A;  1WOR A;  3RZD C;  4A3D C;  4GTC A;  3I4N K;  5IYD K;  4XLN A;  4G0U A;  4LK0 A;  4Q5S A;  2V6U A;  2GSU A;  4KAT A;  3HOX K;  1GE9 A;  4A3J C;  4BY1 K;  4XSX A;  1WSR A;  3S16 K;  1WSV A;  3GIR A;  2P8T A;  3LAP A;  3LYW A;  3HOZ C;  4GT9 A;  2ZUF A;  4C45 A;  1R9T K;  3K7A K;  1O2A A;  4ILD A;  1USM A;  1WOO A;  3L4K A;  4YFK A;  2ZUE A;  3N3Y A;  1AB4 A;  3HOY K;  1TWA C;  1TWG C;  4AYB D;  1PJ6 A;  3S1N C;  1EK8 A;  1JQW A;  4AH6 A;  1RU0 A;  2A68 A;  4BXX C;  5TMF A;  4QIW L;  4A93 K;  3GTJ A;  4WJ3 M;  3S14 C;  4A3L K;  4KDD A;  3SZY A;  3GTG C;  3GTK C;  2JA7 K;  3ORE A;  1I6H C;  1R9T C;  4BLB A;  1WCM A;  4G0W A;  4OIP A;  3H3V D;  1O28 A;  1O27 A;  2JA6 A;  4C3I K;  4GTL A;  2JA8 C;  3HOV K;  1IBA A;  2R92 A;  2NVX A;  3Q3Q A;  1YCL A;  4A3I C;  5TMC A;  4OIQ A;  3RZO C;  3GSI A;  2PHC B;  3JST A;  4MEX A;  2NVT K;  3GTG A;  4MEY A;  5M5Y K;  1O25 A;  2A69 A;  3GTP C;  3VA7 A;  3S17 C;  1F93 A;  3M3Y C;  5IOQ A;  1JVI A;  2VUM K;  3GTJ K;  3S1M K;  3ERE D;  4GTB A;  3GTL C;  1SFO K;  1IQ0 A;  4GTD A;  5C3E C;  4X6A C;  2PMZ L;  1EH1 A;  4A3E K;  4PAB A;  1Y1W C;  4GZY A;  1I6V A;  3GTP A;  1WIH A;  2E2H A;  2B63 K;  3N0B A;  1EFW A;  5IYC K;  5EGH A;  4WFB S;  4P5A A;  1ZYR A;  1PJ7 A;  4ZH4 A;  1VRQ C;  3ADA C;  4IO9 S;  1O2F B;  3GEI A;  1XXA A;  5D4D A;  5C4J K;  5DM7 S;  1USO A;  2JA6 C;  4KMD A;  3K7A C;  1O24 A;  4KB2 A;  5C4X K;  3HOZ K;  2O5J A;  4U67 S;  1F9N A;  2E2J C;  4WJ4 A;  2E2I K;  4BY1 C;  4OIN A;  1VH2 A;  3BP3 A;  1L0W A;  1YX2 A;  3HOW C;  5C44 K;  3AD7 C;  5CHP A;  3T00 A;  1KQ4 A;  3GTO K;  1C0A A;  3PO2 C;  1TWA K;  1TWG K;  2YU9 A;  4A3B C;  1X31 C;  3EQL A;  4BY7 C;  2R7Z C;  3S2D K;  1O2B A;  3DXJ A;  3GTL A;  3H0G C;  2R7Z A;  1K83 C;  4BLA A;  3GTJ C;  4PAA A;  3PO3 C;  1Y1W A;  3FKI K;  2GAH C;  4X6A K;  1TWF C;  3GEE A;  4KB4 A;  5C3E K;  2CFA B;  4YFN A;  5IOT A;  3S1Q C;  3AQP A;  2VUM C;  3S1M C;  4WCE S;  1TWC K;  5CJ9 A;  4KN4 A;  5EGE A;  1HQM A;  3NUH A;  1WOP A;  1IS1 A;  1J6W A;  5FLM C;  2L5N A;  5JVH S;  1K83 K;  3TFJ A;  3S0X A;  5M3M K;  4Y7N K;  4C3J C;  1XXB A;  4XLP A;  4IOA S;  2PPB A;  4A3K K;  2B63 C;  2PMZ D;  2ZJP S;  5TJ3 A;  2FQT A;  3FOF A;  2GSO A;  2NVY K;  4DDQ A;  4C3I C;  1TWH A;  4QJV B;  3HOV C;  2JA8 K;  4LLG A;  2XCO A;  1I3Q K;  4WFA S;  3S1R C;  5E68 A;  3T01 A;  1I50 A;  1VGX A;  1VJE A;  4GTA A; 
#chains in the Genus database with same CATH homology
 1TWC C;  3CQZ K;  3M3Y C;  5IP9 K;  4A3C C;  3GTJ K;  2VUM K;  4A3J K;  3S1M K;  1I6H K;  2R93 K;  2WB1 D;  3GTL C;  3S2H C;  5IYB K;  4NOI A;  3RZD K;  1SFO K;  4BBS K;  3M3Y K;  5C3E C;  2E2I C;  4X6A C;  1I50 K;  2E2H C;  3S2D C;  2PMZ L;  4A3D K;  4BY7 K;  2BE5 A;  3HOU C;  4A3E K;  1Y1V C;  4LJZ A;  2NVQ C;  3HOY C;  2CW0 A;  2JA5 C;  4LK1 A;  2PA8 L;  4KN7 A;  2WB1 L;  3S1R K;  2R7Z K;  1Y1W C;  2JA6 K;  4GZY A;  3S2H K;  4A3F K;  1I6V A;  3GTQ K;  3HOX C;  3H0G K;  2B63 K;  5IYC K;  2NVQ K;  2PA8 D;  3H3V L;  3S17 K;  4A3I K;  3RZO K;  1ZYR A;  3GTQ C;  4G7Z A;  4ZH4 A;  3HKZ D;  1TWH C;  2R92 K;  1SFO C;  3RZD C;  3GTL K;  4A3D C;  4YG2 A;  4A3K C;  2WAQ L;  3I4N K;  5C4X C;  4XLN A;  2E2J K;  5D4D A;  4AYB L;  5IYD K;  2NVY C;  4C3H C;  3HKZ L;  5C4J K;  4LK0 A;  4Q5S A;  3GTP K;  3HOX K;  4A3J C;  2JA6 C;  4BY1 K;  3K7A C;  4XSX A;  5C4X K;  4C2M K;  5IP7 K;  3HOZ K;  4KMU A;  2O5J A;  3S16 K;  2E2J C;  2A6H A;  4A3M C;  5M5X K;  3S15 K;  2E2I K;  4BY1 C;  4OIN A;  4XSZ A;  4G7O A;  5IP7 C;  2WAQ D;  3HOW C;  3HOZ C;  1R9T K;  5C44 K;  3K7A K;  4JK1 A;  2O5I A;  2A6E A;  2JA5 K;  3S15 C;  4A3M K;  4A3G C;  3GTO K;  2YU9 K;  3PO2 C;  1TWF K;  1TWA K;  1TWG K;  4C3J K;  5FJ8 K;  2NVX K;  3I4M K;  4A3B C;  4QJV A;  4BBS C;  4Y52 K;  3EQL A;  4YFK A;  4A3E C;  3GTM C;  3HOU K;  3I4M C;  1WCM C;  4BY7 C;  2R7Z C;  2E2H K;  1TWA C;  1TWG C;  4G7H A;  4A93 C;  4AYB D;  3HOY K;  3S2D K;  5M3F K;  3S1N C;  3GTM K;  3DXJ A;  3H0G C;  2Y0S D;  4Y52 C;  1K83 C;  3M4O C;  4OIO A;  3GTJ C;  5IYB C;  2A68 A;  4YFX A;  3PO3 C;  4BXX C;  4MQ9 A;  3GTK K;  3FKI K;  5TMF A;  3S14 K;  4QIW L;  5M5W K;  3S1N K;  4A93 K;  4X6A K;  1TWF C;  3PO2 K;  5C3E K;  2YU9 C;  3S14 C;  1I50 C;  4YFN A;  4OIR A;  3PO3 K;  4A3L K;  3GTG C;  1Y1W K;  3GTK C;  3S1Q C;  4BXX K;  2JA7 K;  5IP9 C;  2VUM C;  3S1M C;  1R9T C;  1I6H C;  3HOW K;  3CQZ C;  1TWC K;  1BDF A;  4KN4 A;  4OIP A;  1HQM A;  4A3C K;  1WCM K;  3GTO C;  4A3G K;  3H3V D;  5FLM C;  1K83 K;  3M4O K;  4BBR C;  2R92 C;  1TWH K;  5M3M K;  4Y7N K;  3S1Q K;  4C3J C;  4XLP A;  3WOD A;  4A3B K;  4C3I K;  2PPB A;  4A3K K;  4Q4Z A;  2JA8 C;  3HOV K;  2B63 C;  1IW7 A;  2PMZ D;  2Y0S L;  4BBR K;  5C44 C;  2JA7 C;  5C4J C;  2NVY K;  4A3I C;  5TMC A;  1I3Q C;  2NVT C;  4C3H K;  1SMY A;  4OIQ A;  3RZO C;  2NVX C;  3GTG K;  4C3I C;  4QJV B;  1Y1V K;  1YNN A;  3HOV C;  2JA8 K;  4LLG A;  4C2M C;  1YNJ A;  4QIW D;  4MEX A;  3S16 C;  1I3Q K;  1XPP A;  4A3F C;  3FKI C;  2NVT K;  4MEY A;  3S1R C;  5M5Y K;  5FLM K;  4Y7N C;  2R93 C;  2A69 A;  5IYD C;  3GTP C;  3I4N C;  4A3L C;  5IYC C;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...