1YNNA

Taq rna polymerase-rifampicin complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
total genus 39
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynnA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynnA01
2NVYK 3HKZL 4YFNA 1TWHK 5C4XK 4BBRC 5M5YK 4LK0A 1TWAC 3PO3K 1XPPA 4A93K 2NVXC 4NOIA 3GTMC 2PMZL 4C3JK 2JA5C 4A3LK 3HOZC 4QJVA 1TWFK 5FJ8K 2E2HK 2CW0A 2BE5A 5C44K 4A3MK 2JA6C 4GZYA 4KMUA 1Y1VC 2Y0SL 3H3VL 3M3YK 4C2MC 1WCMC 4BBSC 2NVQC 2A69A 3WODA 3S1RC 4A3BC 5IP9K 3HOWK 2R7ZK 1I6HC 1Y1WC 4X6AC 4C3IK 3S14K 2A6EA 3H0GK 1HQMA 3CQZK 2YU9K 4QIWL 4QJVB 2PA8D 3RZDK 4ZH4A 1K83C 4BY1K 3GTPC 3M4OC 4Y52K 2WAQD 4Y7NK 4OIQA 3GTQC 3S1QK 5IYBK 4C3HK 3GTKK 3RZOC 1IW7A 1YNNA 3GTGC 2NVXK 1TWGC 1I50K 1TWCC 3I4NK 3HOZK 4XSZA 3EQLA 4LLGA 3S15K 3FKIK 1SFOC 2WB1D 2E2IC 3HOYC 3S1NC 3K7AC 4BY7K 4A3FC 2NVTK 2JA6K 4A3CK 2E2JC 2VUMC 3GTLC 5IYDK 4KN7A 4YG2A 1WCMK 3PO2C 2B63C 4BBSK 2O5JA 5IP7C 1I3QC 5FLMC 4A3DC 4A3BK 2JA8C 5M3FK 4YFKA 2R92K 4X6AK 3HKZD 5TMCA 4A3KC 5IYCK 2JA7K 4G7ZA 2R93K 5C3EC 3S17K 2O5IA 4G7OA 5D4DA 3S2HC 4A3JK 3M4OK 4BXXC 4LK1A 3S2DK 3HOVC 4XLPA 5C4JC 3I4MC 3GTQK 5M3MK 4AYBD 2NVYC 3H3VD 5C4XC 3GTOC 1R9TC 1TWGK 3PO3C 4A93C 4BBRK 1TWAK 4OIOA 4C3JC 3GTJC 4A3LC 3GTMK 3HOYK 2JA5K 3HOXC 3S1NK 3K7AK 1TWFC 2WAQL 4A3IC 4OIRA 2VUMK 4QIWD 3PO2K 2B63K 1Y1VK 1I3QK 4C2MK 4A3DK 2JA8K 2PPBA 2NVQK 5IP9C 3S1RK 2A68A 4A3EC 3HOWC 2R7ZC 4C3IC 1Y1WK 1I6HK 1SMYA 3CQZC 2YU9C 5C3EK 3S1MC 1I6VA 3RZDC 3S2HK 4BXXK 2PMZD 3S16C 1K83K 3GTPK 3HOVK 4Y52C 3HOUC 4XSXA 4Q4ZA 4MEYA 4Y7NC 4A3GC 4XLNA 5M5XK 3S1QC 5IYBC 4C3HC 3GTOK 1R9TK 2Y0SD 3GTKC 3RZOK 4YFXA 4Q5SA 1TWHC 3GTGK 3GTJK 1I50C 4OINA 2PA8L 1TWCK 3I4NC 3HOXK 5TMFA 3FKIC 3S15C 1SFOK 4A3IK 4BY7C 4OIPA 2E2IK 2NVTC 2E2HC 4AYBL 4A3CC 4MEXA 4A3FK 5IYDC 1YNJA 2E2JK 3GTLK 5C44C 4A3MC 1BDFA 3M3YC 5IP7K 5FLMK 4KN4A 2A6HA 4A3EK 2R92C 4G7HA 3S14C 2WB1L 5M5WK 3I4MK 2JA7C 5IYCC 4A3KK 1ZYRA 3S1MK 3H0GC 3S17C 4JK1A 4MQ9A 2R93C 3S16K 4A3JC 3HOUK 3S2DC 4BY1C 4A3GK 5C4JK 4LJZA 3DXJA
chains in the Genus database with same CATH superfamily
3L4KA 4FZBA 3DLLS 4A93K 1TWAC 4LR2A 3HOZC 1B4BA 2V6UA 3GSIA 5C44K 4GZYA 4KMUA 1ISEA 2Y0SL 2NVQC 1ZVUA 4G0UA 5IP9K 2E2HA 3TFHA 1WCMA 3GEEA 2YU9K 2PHCB 2PA8D 3ERED 1YX2A 4ZH4A 4KASA 3M4OC 4Y52K 2WAQD 1PJ7A 3S0XA 3RZOC 1IW7A 1YNNA 1G51A 2NVXK 5TJ3A 3FKIK 1USOA 2WB1D 3S1NC 4BY7K 4A3FC 1RU0A 1TWGA 2E2JC 3GTLC 4GT9A 1O28A 4G0VA 5IP7C 4YFKA 4X6AK 5TMCA 1Y1VA 4GTCA 1I3QA 1VLOA 5C3EC 3S17K 2O5IA 5JVHS 1FEUA 5D4DA 4BXXC 4LK1A 3HOVC 4XLPA 2P8TA 4AYBD 1ZBSA 3H3VD 1EK8A 3GTOC 3GIRA 1TWAK 3NUHA 3GTJC 4A3LC 4P5AA 2WAQL 2ZUFA 1R9TA 4KMHA 4FM9A 1O24A 3T01A 2ZJQS 2PPBA 4KB4A 2NVQK 1B4AA 3HOWC 2GSNA 4C3IC 1SMYA 2B63A 4PAAA 4IOAS 2EBBA 3S16C 1XXAA 4WJ3M 4C45A 4Y7NC 4A3GC 4GTEA 4WFNS 3GTKC 2FQTA 3RZOK 3I4NC 3HOXK 2XCQA 1VJEA 4A3IK 4OIPA 4GTAA 4AYBL 4A3FK 4MEXA 2E2JK 5IORA 3GTLK 5C44C 5IP7K 4G0WA 1TWFA 2V6TA 4KN4A 3T02A 3FHZA 3BP8C 5DM7S 5M5WK 4PABA 2JA7C 1BS2A 3TTGA 2R93C 1EFWA 5CJ9A 3H0GA 1EQRA 2KQ1A 1TWHK 4AH6A 2NVXC 4A3LK 2JA5C 1BGWA 2E2HK 2XCOA 2CW0A 2BE5A 4BKWA 1I50A 3M3YK 4C2MC 3WODA 3S1RC 3TFIA 3HOWK 1I6HC 1Y1WC 4X6AC 4C3IK 3OEPA 1WQGA 1HQMA 4QIWL 1EH1A 4U67S 2R92A 1K83C 1DCPA 2CFAB 3GTPC 4Y7NK 4OIQA 4KB2A 4BLBA 3LAPA 1JQWA 1ZXOA 3GTKK 2ZJRS 3GTGC 1TWCC 5EGHA 3I4NK 4XSZA 3EQLA 1SFOC 2E2IC 4KC6A 2JA6K 1WSVA 4GFQA 2CFAA 1O2FB 3GTMA 1X31C 4A3BK 1O27A 1PJ6A 3HKZD 3V4GA 1O2AA 1VRQC 2JA7K 1DCHA 2R93K 1DD5A 4BLAA 2L3UA 5C4JC 2NVYC 5C4XC 1HI9A 2JA5K 3HOXC 3GTQA 3K7AK 3GTOA 5CHPA 4A3IC 2VUMK 3GTJA 2B63K 4C2MK 3GEIA 1WIHA 3S1RK 2R7ZC 3L4JA 1I6HK 1Y1WK 3CQZC 5HQHA 1F7UA 2PMZD 1K83K 5IOTA 3GTPK 4XSXA 4WFAS 2V6SA 3S1QC 5IYBC 3IPJA 1TWHC 3GTGK 4OINA 2PA8L 2ZFZA 1TWCK 2KXYA 5TMFA 4KM8A 1SFOK 2E2IK 1O29A 2NVTC 2E2HC 4A3CC 5IYDC 1YNJA 2GSUA 4O2DA 3M3YC 1JOEA 2A6HA 4IO9S 3AQPA 2WB1L 3AD8C 5IYCC 1ZYRA 3S1MK 4A3JC 3HOUK 2RH6A 5C4JK 2YU9A 3DXJA 2NVYK 2P5MA 4YFNA 5C4XK 1XXCA 4BBRC 2PMZL 4NOIA 1C0AA 4QJVA 5FJ8K 3AH5A 2NVXA 2JH3A 2JA6C 3AD7C 1Y1VC 3H3VL 4KM9A 1IQ0A 3FKIA 3SZZA 4A3BC 3FOEA 4KDDA 2R7ZK 3S14K 3LAJA 2A6EA 3CQZK 3LPXA 4KATA 5IOSA 4BY1K 3N0BA 3QX3A 3S1QK 5IYBK 2Y3PA 5EGEA 3K7AC 1KQ4A 2NVTK 4A3CK 2VUMC 4GTLA 5IYDK 1TWAA 4KN7A 4YG2A 1WCMK 2B63C 5E68A 1WOOA 2O5JA 3SZYA 4BBSK 1IE0A 2GAHC 5FLMC 1J6VA 3JSTA 3OREA 3LYWA 5M3FK 3PIOS 1XZPB 4DDQA 3Q3QA 4A3KC 5IYCK 1WSRA 4A3JK 3A8KA 4P9SA 3GTQK 5HL8A 5M3MK 4KARA 1J6WA 1TWGK 3PO3C 4BBRK 1XZPA 3VA7A 4OIOA 4C3JC 3HOYK 4KMDA 1TWFC 3GEHA 4OIRA 2L5NA 3PO2K 5DM6S 1Y1VK 1I3QK 4WILA 4A3DK 2JA8K 1O26A 3GTLA 5JFEA 3S1MC 1I6VA 3RZDC 4RMFA 3S2HK 4GTDA 3HOUC 4Q4ZA 3HXAA 2GAGC 2RGRA 4C3HC 1R9TK 4YFXA 1I50C 3PIPS 1V5VA 4KMAA 3S15C 1TWHA 1J98A 3A8JA 1O25A 1BDFA 5FLMK 1WQHA 4A3EK 2R92C 3N0CA 2D6FC 3S14C 2GSOA 4A3KK 4JK1A 4MQ9A 4LQYA 1IBAA 3S2DC 4BY1C 4LJZA 3CAGA 3HKZL 1DCOA 1JVIA 1AB4A 4GTBA 5M5YK 4LK0A 3PO3K 1XPPA 4XCHA 3GTMC 1BJTA 2KWAA 4C3JK 1WQFA 3A8IA 1TWFK 2W7VA 3GTKA 2FQOA 4A3MK 1WCMC 4BBSC 2A69A 2JA6A 3H0GK 1PJ5A 4ILDA 3CF5S 4QJVB 1IS1A 1F9NA 3RZDK 5HL7S 2ZUEA 1F93A 2JA7A 3GTQC 1IL2A 2R93A 4C3HK 3MMLB 1TWGC 2ZJPS 1I50K 3HOZK 4LLGA 3S15K 3HOYC 4WJ4A 3GDZA 1VGXA 1YCLA 5L46A 3PO2C 1WOSA 1EI6A 2JA5A 1I3QC 4A3DC 4LOWA 2JA8C 3N3YA 2VUMA 2R92K 1UV7A 2KPUA 4P5BA 1O2BA 4G7ZA 1J6XA 4G7OA 3M4OK 3S2HC 1XZQB 1Y1WA 1USMA 3S2DK 3I4MC 3AD9C 3G4CA 4J3NA 1VH2A 4M1XA 1K83A 1R9TC 1WOPA 3GTPA 4A93C 5JVGS 4KAWX 3GTMK 3S1NK 3T00A 4QIWD 3GTGA 1XZQA 1TWCA 1SFOA 2E2IA 5IP9C 2A68A 3G4AA 4A3EC 1F7VA 2XCRB 3OPFA 2YU9C 5C3EK 1WORA 4BXXK 1ZQ1C 4GTFA 3HOVK 4Y52C 4MEYA 4XLNA 5M5XK 3GTOK 2Y0SD 1GE9A 4WFBS 1XXBA 4Q5SA 3GTJK 5JVOA 3FKIC 2NVYA 4BY7C 4WCES 1INNA 4A3MC 3BUEA 4G7HA 3TFJA 1L0WA 3AQOA 3H0GC 3S17C 3FOFA 3BP3A 3S16K 2R7ZA 5IOQA 4WF9S 3ADAC 4IOCS 4A3GK 3I4MK 3CQZA
chains in the Genus database with same CATH topology
2NVYK 3HKZL 4YFNA 1TWHK 5C4XK 4BBRC 5M5YK 4LK0A 1TWAC 3PO3K 1XPPA 4A93K 2NVXC 4NOIA 3GTMC 2PMZL 4C3JK 2JA5C 4A3LK 3HOZC 4QJVA 1TWFK 5FJ8K 2E2HK 2CW0A 2BE5A 5C44K 4A3MK 2JA6C 4GZYA 4KMUA 1Y1VC 2Y0SL 3H3VL 3M3YK 4C2MC 1WCMC 4BBSC 2NVQC 2A69A 3WODA 3S1RC 4A3BC 5IP9K 3HOWK 2R7ZK 1I6HC 1Y1WC 4X6AC 4C3IK 3S14K 2A6EA 3H0GK 1HQMA 3CQZK 2YU9K 4QIWL 4QJVB 2PA8D 3RZDK 4ZH4A 1K83C 4BY1K 3GTPC 3M4OC 4Y52K 2WAQD 4Y7NK 4OIQA 3GTQC 3S1QK 5IYBK 4C3HK 3GTKK 3RZOC 1IW7A 1YNNA 3GTGC 2NVXK 1TWGC 1I50K 1TWCC 3I4NK 3HOZK 4XSZA 3EQLA 4LLGA 3S15K 3FKIK 1SFOC 2WB1D 2E2IC 3HOYC 3S1NC 3K7AC 4BY7K 4A3FC 2NVTK 2JA6K 4A3CK 2E2JC 2VUMC 3GTLC 5IYDK 4KN7A 4YG2A 1WCMK 3PO2C 2B63C 4BBSK 2O5JA 5IP7C 1I3QC 5FLMC 4A3DC 4A3BK 2JA8C 5M3FK 4YFKA 2R92K 4X6AK 3HKZD 5TMCA 4A3KC 5IYCK 2JA7K 4G7ZA 2R93K 5C3EC 3S17K 2O5IA 4G7OA 5D4DA 3S2HC 4A3JK 3M4OK 4BXXC 4LK1A 3S2DK 3HOVC 4XLPA 5C4JC 3I4MC 3GTQK 5M3MK 4AYBD 2NVYC 3H3VD 5C4XC 3GTOC 1R9TC 1TWGK 3PO3C 4A93C 4BBRK 1TWAK 4OIOA 4C3JC 3GTJC 4A3LC 3GTMK 3HOYK 2JA5K 3HOXC 3S1NK 3K7AK 1TWFC 2WAQL 4A3IC 4OIRA 2VUMK 4QIWD 3PO2K 2B63K 1Y1VK 1I3QK 4C2MK 4A3DK 2JA8K 2PPBA 2NVQK 5IP9C 3S1RK 2A68A 4A3EC 3HOWC 2R7ZC 4C3IC 1Y1WK 1I6HK 1SMYA 3CQZC 2YU9C 5C3EK 3S1MC 1I6VA 3RZDC 3S2HK 4BXXK 2PMZD 3S16C 1K83K 3GTPK 3HOVK 4Y52C 3HOUC 4XSXA 4Q4ZA 4MEYA 4Y7NC 4A3GC 4XLNA 5M5XK 3S1QC 5IYBC 4C3HC 3GTOK 1R9TK 2Y0SD 3GTKC 3RZOK 4YFXA 4Q5SA 1TWHC 3GTGK 3GTJK 1I50C 4OINA 2PA8L 1TWCK 3I4NC 3HOXK 5TMFA 3FKIC 3S15C 1SFOK 4A3IK 4BY7C 4OIPA 2E2IK 2NVTC 2E2HC 4AYBL 4A3CC 4MEXA 4A3FK 5IYDC 1YNJA 2E2JK 3GTLK 5C44C 4A3MC 1BDFA 3M3YC 5IP7K 5FLMK 4KN4A 2A6HA 4A3EK 2R92C 4G7HA 3S14C 2WB1L 5M5WK 3I4MK 2JA7C 5IYCC 4A3KK 1ZYRA 3S1MK 3H0GC 3S17C 4JK1A 4MQ9A 2R93C 3S16K 4A3JC 3HOUK 3S2DC 4BY1C 4A3GK 5C4JK 4LJZA 3DXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY K;  3HKZ L;  4YFN A;  1TWH K;  5C4X K;  4BBR C;  5M5Y K;  4LK0 A;  1TWA C;  3PO3 K;  1XPP A;  4A93 K;  2NVX C;  4NOI A;  3GTM C;  2PMZ L;  4C3J K;  2JA5 C;  4A3L K;  3HOZ C;  4QJV A;  1TWF K;  5FJ8 K;  2E2H K;  2CW0 A;  2BE5 A;  5C44 K;  4A3M K;  2JA6 C;  4GZY A;  4KMU A;  1Y1V C;  2Y0S L;  3H3V L;  3M3Y K;  4C2M C;  1WCM C;  4BBS C;  2NVQ C;  2A69 A;  3WOD A;  3S1R C;  4A3B C;  5IP9 K;  3HOW K;  2R7Z K;  1I6H C;  1Y1W C;  4X6A C;  4C3I K;  3S14 K;  2A6E A;  3H0G K;  1HQM A;  3CQZ K;  2YU9 K;  4QIW L;  4QJV B;  2PA8 D;  3RZD K;  4ZH4 A;  1K83 C;  4BY1 K;  3GTP C;  3M4O C;  4Y52 K;  2WAQ D;  4Y7N K;  4OIQ A;  3GTQ C;  3S1Q K;  5IYB K;  4C3H K;  3GTK K;  3RZO C;  1IW7 A;  1YNN A;  3GTG C;  2NVX K;  1TWG C;  1I50 K;  1TWC C;  3I4N K;  3HOZ K;  4XSZ A;  3EQL A;  4LLG A;  3S15 K;  3FKI K;  1SFO C;  2WB1 D;  2E2I C;  3HOY C;  3S1N C;  3K7A C;  4BY7 K;  4A3F C;  2NVT K;  2JA6 K;  4A3C K;  2E2J C;  2VUM C;  3GTL C;  5IYD K;  4KN7 A;  4YG2 A;  1WCM K;  3PO2 C;  2B63 C;  4BBS K;  2O5J A;  5IP7 C;  1I3Q C;  5FLM C;  4A3D C;  4A3B K;  2JA8 C;  5M3F K;  4YFK A;  2R92 K;  4X6A K;  3HKZ D;  5TMC A;  4A3K C;  5IYC K;  2JA7 K;  4G7Z A;  2R93 K;  5C3E C;  3S17 K;  2O5I A;  4G7O A;  5D4D A;  3S2H C;  4A3J K;  3M4O K;  4BXX C;  4LK1 A;  3S2D K;  3HOV C;  4XLP A;  5C4J C;  3I4M C;  3GTQ K;  5M3M K;  4AYB D;  2NVY C;  3H3V D;  5C4X C;  3GTO C;  1R9T C;  1TWG K;  3PO3 C;  4A93 C;  4BBR K;  1TWA K;  4OIO A;  4C3J C;  3GTJ C;  4A3L C;  3GTM K;  3HOY K;  2JA5 K;  3HOX C;  3S1N K;  3K7A K;  1TWF C;  2WAQ L;  4A3I C;  4OIR A;  2VUM K;  4QIW D;  3PO2 K;  2B63 K;  1Y1V K;  1I3Q K;  4C2M K;  4A3D K;  2JA8 K;  2PPB A;  2NVQ K;  5IP9 C;  3S1R K;  2A68 A;  4A3E C;  3HOW C;  2R7Z C;  4C3I C;  1Y1W K;  1I6H K;  1SMY A;  3CQZ C;  2YU9 C;  5C3E K;  3S1M C;  1I6V A;  3RZD C;  3S2H K;  4BXX K;  2PMZ D;  3S16 C;  1K83 K;  3GTP K;  3HOV K;  4Y52 C;  3HOU C;  4XSX A;  4Q4Z A;  4MEY A;  4Y7N C;  4A3G C;  4XLN A;  5M5X K;  3S1Q C;  5IYB C;  4C3H C;  3GTO K;  1R9T K;  2Y0S D;  3GTK C;  3RZO K;  4YFX A;  4Q5S A;  1TWH C;  3GTG K;  3GTJ K;  1I50 C;  4OIN A;  2PA8 L;  1TWC K;  3I4N C;  3HOX K;  5TMF A;  3FKI C;  3S15 C;  1SFO K;  4A3I K;  4BY7 C;  4OIP A;  2E2I K;  2NVT C;  2E2H C;  4AYB L;  4A3C C;  4MEX A;  4A3F K;  5IYD C;  1YNJ A;  2E2J K;  3GTL K;  5C44 C;  4A3M C;  1BDF A;  3M3Y C;  5IP7 K;  5FLM K;  4KN4 A;  2A6H A;  4A3E K;  2R92 C;  4G7H A;  3S14 C;  2WB1 L;  5M5W K;  3I4M K;  2JA7 C;  5IYC C;  4A3K K;  1ZYR A;  3S1M K;  3H0G C;  3S17 C;  4JK1 A;  4MQ9 A;  2R93 C;  3S16 K;  4A3J C;  3HOU K;  3S2D C;  4BY1 C;  4A3G K;  5C4J K;  4LJZ A;  3DXJ A; 
#chains in the Genus database with same CATH topology
 3L4K A;  4FZB A;  3DLL S;  4A93 K;  1TWA C;  4LR2 A;  3HOZ C;  1B4B A;  2V6U A;  3GSI A;  5C44 K;  4GZY A;  4KMU A;  1ISE A;  2Y0S L;  2NVQ C;  1ZVU A;  4G0U A;  5IP9 K;  2E2H A;  3TFH A;  1WCM A;  3GEE A;  2YU9 K;  2PHC B;  2PA8 D;  3ERE D;  1YX2 A;  4ZH4 A;  4KAS A;  3M4O C;  4Y52 K;  2WAQ D;  1PJ7 A;  3S0X A;  3RZO C;  1IW7 A;  1YNN A;  1G51 A;  2NVX K;  5TJ3 A;  3FKI K;  1USO A;  2WB1 D;  3S1N C;  4BY7 K;  4A3F C;  1RU0 A;  1TWG A;  2E2J C;  3GTL C;  4GT9 A;  1O28 A;  4G0V A;  5IP7 C;  4YFK A;  4X6A K;  5TMC A;  1Y1V A;  4GTC A;  1I3Q A;  1VLO A;  5C3E C;  3S17 K;  2O5I A;  5JVH S;  1FEU A;  5D4D A;  4BXX C;  4LK1 A;  3HOV C;  4XLP A;  2P8T A;  4AYB D;  1ZBS A;  3H3V D;  1EK8 A;  3GTO C;  3GIR A;  1TWA K;  3NUH A;  3GTJ C;  4A3L C;  4P5A A;  2WAQ L;  2ZUF A;  1R9T A;  4KMH A;  4FM9 A;  1O24 A;  3T01 A;  2ZJQ S;  2PPB A;  4KB4 A;  2NVQ K;  1B4A A;  3HOW C;  2GSN A;  4C3I C;  1SMY A;  2B63 A;  4PAA A;  4IOA S;  2EBB A;  3S16 C;  1XXA A;  4WJ3 M;  4C45 A;  4Y7N C;  4A3G C;  4GTE A;  4WFN S;  3GTK C;  2FQT A;  3RZO K;  3I4N C;  3HOX K;  2XCQ A;  1VJE A;  4A3I K;  4OIP A;  4GTA A;  4AYB L;  4A3F K;  4MEX A;  2E2J K;  5IOR A;  3GTL K;  5C44 C;  5IP7 K;  4G0W A;  1TWF A;  2V6T A;  4KN4 A;  3T02 A;  3FHZ A;  3BP8 C;  5DM7 S;  5M5W K;  4PAB A;  2JA7 C;  1BS2 A;  3TTG A;  2R93 C;  1EFW A;  5CJ9 A;  3H0G A;  1EQR A;  2KQ1 A;  1TWH K;  4AH6 A;  2NVX C;  4A3L K;  2JA5 C;  1BGW A;  2E2H K;  2XCO A;  2CW0 A;  2BE5 A;  4BKW A;  1I50 A;  3M3Y K;  4C2M C;  3WOD A;  3S1R C;  3TFI A;  3HOW K;  1I6H C;  1Y1W C;  4X6A C;  4C3I K;  3OEP A;  1WQG A;  1HQM A;  4QIW L;  1EH1 A;  4U67 S;  2R92 A;  1K83 C;  1DCP A;  2CFA B;  3GTP C;  4Y7N K;  4OIQ A;  4KB2 A;  4BLB A;  3LAP A;  1JQW A;  1ZXO A;  3GTK K;  2ZJR S;  3GTG C;  1TWC C;  5EGH A;  3I4N K;  4XSZ A;  3EQL A;  1SFO C;  2E2I C;  4KC6 A;  2JA6 K;  1WSV A;  4GFQ A;  2CFA A;  1O2F B;  3GTM A;  1X31 C;  4A3B K;  1O27 A;  1PJ6 A;  3HKZ D;  3V4G A;  1O2A A;  1VRQ C;  2JA7 K;  1DCH A;  2R93 K;  1DD5 A;  4BLA A;  2L3U A;  5C4J C;  2NVY C;  5C4X C;  1HI9 A;  2JA5 K;  3HOX C;  3GTQ A;  3K7A K;  3GTO A;  5CHP A;  4A3I C;  2VUM K;  3GTJ A;  2B63 K;  4C2M K;  3GEI A;  1WIH A;  3S1R K;  2R7Z C;  3L4J A;  1I6H K;  1Y1W K;  3CQZ C;  5HQH A;  1F7U A;  2PMZ D;  1K83 K;  5IOT A;  3GTP K;  4XSX A;  4WFA S;  2V6S A;  3S1Q C;  5IYB C;  3IPJ A;  1TWH C;  3GTG K;  4OIN A;  2PA8 L;  2ZFZ A;  1TWC K;  2KXY A;  5TMF A;  4KM8 A;  1SFO K;  2E2I K;  1O29 A;  2NVT C;  2E2H C;  4A3C C;  5IYD C;  1YNJ A;  2GSU A;  4O2D A;  3M3Y C;  1JOE A;  2A6H A;  4IO9 S;  3AQP A;  2WB1 L;  3AD8 C;  5IYC C;  1ZYR A;  3S1M K;  4A3J C;  3HOU K;  2RH6 A;  5C4J K;  2YU9 A;  3DXJ A;  2NVY K;  2P5M A;  4YFN A;  5C4X K;  1XXC A;  4BBR C;  2PMZ L;  4NOI A;  1C0A A;  4QJV A;  5FJ8 K;  3AH5 A;  2NVX A;  2JH3 A;  2JA6 C;  3AD7 C;  1Y1V C;  3H3V L;  4KM9 A;  1IQ0 A;  3FKI A;  3SZZ A;  4A3B C;  3FOE A;  4KDD A;  2R7Z K;  3S14 K;  3LAJ A;  2A6E A;  3CQZ K;  3LPX A;  4KAT A;  5IOS A;  4BY1 K;  3N0B A;  3QX3 A;  3S1Q K;  5IYB K;  2Y3P A;  5EGE A;  3K7A C;  1KQ4 A;  2NVT K;  4A3C K;  2VUM C;  4GTL A;  5IYD K;  1TWA A;  4KN7 A;  4YG2 A;  1WCM K;  2B63 C;  5E68 A;  1WOO A;  2O5J A;  3SZY A;  4BBS K;  1IE0 A;  2GAH C;  5FLM C;  1J6V A;  3JST A;  3ORE A;  3LYW A;  5M3F K;  3PIO S;  1XZP B;  4DDQ A;  3Q3Q A;  4A3K C;  5IYC K;  1WSR A;  4A3J K;  3A8K A;  4P9S A;  3GTQ K;  5HL8 A;  5M3M K;  4KAR A;  1J6W A;  1TWG K;  3PO3 C;  4BBR K;  1XZP A;  3VA7 A;  4OIO A;  4C3J C;  3HOY K;  4KMD A;  1TWF C;  3GEH A;  4OIR A;  2L5N A;  3PO2 K;  5DM6 S;  1Y1V K;  1I3Q K;  4WIL A;  4A3D K;  2JA8 K;  1O26 A;  3GTL A;  5JFE A;  3S1M C;  1I6V A;  3RZD C;  4RMF A;  3S2H K;  4GTD A;  3HOU C;  4Q4Z A;  3HXA A;  2GAG C;  2RGR A;  4C3H C;  1R9T K;  4YFX A;  1I50 C;  3PIP S;  1V5V A;  4KMA A;  3S15 C;  1TWH A;  1J98 A;  3A8J A;  1O25 A;  1BDF A;  5FLM K;  1WQH A;  4A3E K;  2R92 C;  3N0C A;  2D6F C;  3S14 C;  2GSO A;  4A3K K;  4JK1 A;  4MQ9 A;  4LQY A;  1IBA A;  3S2D C;  4BY1 C;  4LJZ A;  3CAG A;  3HKZ L;  1DCO A;  1JVI A;  1AB4 A;  4GTB A;  5M5Y K;  4LK0 A;  3PO3 K;  1XPP A;  4XCH A;  3GTM C;  1BJT A;  2KWA A;  4C3J K;  1WQF A;  3A8I A;  1TWF K;  2W7V A;  3GTK A;  2FQO A;  4A3M K;  1WCM C;  4BBS C;  2A69 A;  2JA6 A;  3H0G K;  1PJ5 A;  4ILD A;  3CF5 S;  4QJV B;  1IS1 A;  1F9N A;  3RZD K;  5HL7 S;  2ZUE A;  1F93 A;  2JA7 A;  3GTQ C;  1IL2 A;  2R93 A;  4C3H K;  3MML B;  1TWG C;  2ZJP S;  1I50 K;  3HOZ K;  4LLG A;  3S15 K;  3HOY C;  4WJ4 A;  3GDZ A;  1VGX A;  1YCL A;  5L46 A;  3PO2 C;  1WOS A;  1EI6 A;  2JA5 A;  1I3Q C;  4A3D C;  4LOW A;  2JA8 C;  3N3Y A;  2VUM A;  2R92 K;  1UV7 A;  2KPU A;  4P5B A;  1O2B A;  4G7Z A;  1J6X A;  4G7O A;  3M4O K;  3S2H C;  1XZQ B;  1Y1W A;  1USM A;  3S2D K;  3I4M C;  3AD9 C;  3G4C A;  4J3N A;  1VH2 A;  4M1X A;  1K83 A;  1R9T C;  1WOP A;  3GTP A;  4A93 C;  5JVG S;  4KAW X;  3GTM K;  3S1N K;  3T00 A;  4QIW D;  3GTG A;  1XZQ A;  1TWC A;  1SFO A;  2E2I A;  5IP9 C;  2A68 A;  3G4A A;  4A3E C;  1F7V A;  2XCR B;  3OPF A;  2YU9 C;  5C3E K;  1WOR A;  4BXX K;  1ZQ1 C;  4GTF A;  3HOV K;  4Y52 C;  4MEY A;  4XLN A;  5M5X K;  3GTO K;  2Y0S D;  1GE9 A;  4WFB S;  1XXB A;  4Q5S A;  3GTJ K;  5JVO A;  3FKI C;  2NVY A;  4BY7 C;  4WCE S;  1INN A;  4A3M C;  3BUE A;  4G7H A;  3TFJ A;  1L0W A;  3AQO A;  3H0G C;  3S17 C;  3FOF A;  3BP3 A;  3S16 K;  2R7Z A;  5IOQ A;  4WF9 S;  3ADA C;  4IOC S;  4A3G K;  3I4M K;  3CQZ A; 
#chains in the Genus database with same CATH homology
 2NVY K;  3HKZ L;  4YFN A;  1TWH K;  5C4X K;  4BBR C;  5M5Y K;  4LK0 A;  1TWA C;  3PO3 K;  1XPP A;  4A93 K;  2NVX C;  4NOI A;  3GTM C;  2PMZ L;  4C3J K;  2JA5 C;  4A3L K;  3HOZ C;  4QJV A;  1TWF K;  5FJ8 K;  2E2H K;  2CW0 A;  2BE5 A;  5C44 K;  4A3M K;  2JA6 C;  4GZY A;  4KMU A;  1Y1V C;  2Y0S L;  3H3V L;  3M3Y K;  4C2M C;  1WCM C;  4BBS C;  2NVQ C;  2A69 A;  3WOD A;  3S1R C;  4A3B C;  5IP9 K;  3HOW K;  2R7Z K;  1I6H C;  1Y1W C;  4X6A C;  4C3I K;  3S14 K;  2A6E A;  3H0G K;  1HQM A;  3CQZ K;  2YU9 K;  4QIW L;  4QJV B;  2PA8 D;  3RZD K;  4ZH4 A;  1K83 C;  4BY1 K;  3GTP C;  3M4O C;  4Y52 K;  2WAQ D;  4Y7N K;  4OIQ A;  3GTQ C;  3S1Q K;  5IYB K;  4C3H K;  3GTK K;  3RZO C;  1IW7 A;  1YNN A;  3GTG C;  2NVX K;  1TWG C;  1I50 K;  1TWC C;  3I4N K;  3HOZ K;  4XSZ A;  3EQL A;  4LLG A;  3S15 K;  3FKI K;  1SFO C;  2WB1 D;  2E2I C;  3HOY C;  3S1N C;  3K7A C;  4BY7 K;  4A3F C;  2NVT K;  2JA6 K;  4A3C K;  2E2J C;  2VUM C;  3GTL C;  5IYD K;  4KN7 A;  4YG2 A;  1WCM K;  3PO2 C;  2B63 C;  4BBS K;  2O5J A;  5IP7 C;  1I3Q C;  5FLM C;  4A3D C;  4A3B K;  2JA8 C;  5M3F K;  4YFK A;  2R92 K;  4X6A K;  3HKZ D;  5TMC A;  4A3K C;  5IYC K;  2JA7 K;  4G7Z A;  2R93 K;  5C3E C;  3S17 K;  2O5I A;  4G7O A;  5D4D A;  3S2H C;  4A3J K;  3M4O K;  4BXX C;  4LK1 A;  3S2D K;  3HOV C;  4XLP A;  5C4J C;  3I4M C;  3GTQ K;  5M3M K;  4AYB D;  2NVY C;  3H3V D;  5C4X C;  3GTO C;  1R9T C;  1TWG K;  3PO3 C;  4A93 C;  4BBR K;  1TWA K;  4OIO A;  4C3J C;  3GTJ C;  4A3L C;  3GTM K;  3HOY K;  2JA5 K;  3HOX C;  3S1N K;  3K7A K;  1TWF C;  2WAQ L;  4A3I C;  4OIR A;  2VUM K;  4QIW D;  3PO2 K;  2B63 K;  1Y1V K;  1I3Q K;  4C2M K;  4A3D K;  2JA8 K;  2PPB A;  2NVQ K;  5IP9 C;  3S1R K;  2A68 A;  4A3E C;  3HOW C;  2R7Z C;  4C3I C;  1Y1W K;  1I6H K;  1SMY A;  3CQZ C;  2YU9 C;  5C3E K;  3S1M C;  1I6V A;  3RZD C;  3S2H K;  4BXX K;  2PMZ D;  3S16 C;  1K83 K;  3GTP K;  3HOV K;  4Y52 C;  3HOU C;  4XSX A;  4Q4Z A;  4MEY A;  4Y7N C;  4A3G C;  4XLN A;  5M5X K;  3S1Q C;  5IYB C;  4C3H C;  3GTO K;  1R9T K;  2Y0S D;  3GTK C;  3RZO K;  4YFX A;  4Q5S A;  1TWH C;  3GTG K;  3GTJ K;  1I50 C;  4OIN A;  2PA8 L;  1TWC K;  3I4N C;  3HOX K;  5TMF A;  3FKI C;  3S15 C;  1SFO K;  4A3I K;  4BY7 C;  4OIP A;  2E2I K;  2NVT C;  2E2H C;  4AYB L;  4A3C C;  4MEX A;  4A3F K;  5IYD C;  1YNJ A;  2E2J K;  3GTL K;  5C44 C;  4A3M C;  1BDF A;  3M3Y C;  5IP7 K;  5FLM K;  4KN4 A;  2A6H A;  4A3E K;  2R92 C;  4G7H A;  3S14 C;  2WB1 L;  5M5W K;  3I4M K;  2JA7 C;  5IYC C;  4A3K K;  1ZYR A;  3S1M K;  3H0G C;  3S17 C;  4JK1 A;  4MQ9 A;  2R93 C;  3S16 K;  4A3J C;  3HOU K;  3S2D C;  4BY1 C;  4A3G K;  5C4J K;  4LJZ A;  3DXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...