1YNNA

Taq rna polymerase-rifampicin complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 39
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynnA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynnA01
2CW0A 4A3LC 3GTPK 3I4NK 2JA8K 1WCMC 2E2HK 4G7OA 4A3EK 1I3QK 5M5XK 1K83C 4A3GK 3GTMK 4C2MK 4QIWD 4A3KC 1TWCK 4NOIA 1R9TC 4A3DK 3HOZK 4A3CK 4KN7A 5FLMK 4BBRK 3HOWK 4XSXA 3I4MK 3HOVC 2E2JK 4YFKA 5TMCA 5M5WK 5IP9C 3HOXC 1XPPA 4C3IC 3PO2K 2VUMC 5C4XK 4A3MC 3S1RK 3EQLA 4C3HK 4BY7C 1IW7A 1TWHK 2NVTC 1I6VA 3M3YK 1Y1VK 2A6HA 3HOYC 3GTKK 2Y0SD 2NVXK 3S15K 4A3BK 4OIPA 3RZOC 4MEYA 4AYBL 2YU9K 1I50K 3S1MK 3HOZC 2JA7C 4G7HA 2A6EA 3FKIK 4C2MC 1TWGK 3GTGC 3HOVK 4X6AC 4KMUA 4XLPA 5FJ8K 4KN4A 4A93C 1TWAK 5FLMC 2E2HC 4Y52C 3GTMC 3GTQC 3H3VD 1WCMK 2WAQL 2PA8D 4Y7NC 1I3QC 4A3JC 2NVXC 4A3GC 3S1MC 1I6HC 3S14K 4BY1C 4A3EC 5IP7K 4A3FK 1ZYRA 1Y1VC 1TWFC 1TWHC 3HKZD 3PO2C 4C3IK 5M5YK 2BE5A 3HOXK 3GTJC 2WB1L 5M3FK 4QJVA 4LK0A 5IP9K 2NVYK 2NVTK 3GTGK 4A3JK 3M4OK 4BY7K 2E2JC 4A93K 2O5JA 2PMZD 4BBSC 4A3BC 4QIWL 2E2IC 3GTKC 3HOYK 4JK1A 1TWAC 3FKIC 3H0GC 3S2DC 2PMZL 2JA7K 1Y1WC 2YU9C 2PA8L 3RZOK 2R93K 4X6AK 1TWGC 3S1QC 5C4JK 2NVYC 5M3MK 3HOUC 2Y0SL 3S1NC 5C44K 5IP7C 4A3FC 4GZYA 1YNNA 1I6HK 4BBSK 4QJVB 1SFOK 4LJZA 4OINA 4G7ZA 3GTOC 4Y7NK 5IYDC 3S17C 3H0GK 2JA5C 2R92C 4BXXK 4BY1K 3CQZC 4XLNA 3GTQK 5C4JC 3RZDC 3GTLK 3S16C 1K83K 3S2DK 4A3IC 1TWCC 2R7ZC 4XSZA 3M4OC 4Y52K 4A3DC 2E2IK 5C3EC 5IYCC 1HQMA 3K7AC 4BBRC 2NVQC 2JA6C 3HOWC 4OIRA 2B63K 1SFOC 4MQ9A 3GTJK 2A68A 3S17K 4A3LK 2JA8C 5TMFA 4YFXA 4C3HC 1BDFA 3DXJA 4OIQA 3S1QK 3GTPC 3I4NC 3PO3K 3HOUK 2PPBA 3M3YC 1Y1WK 4Q4ZA 4C3JC 1YNJA 3K7AK 2JA6K 2NVQK 4LK1A 5IYBK 2WB1D 3S1NK 3S2HK 5C4XC 2VUMK 4Q5SA 2R93C 4A3MK 4OIOA 2B63C 1R9TK 4YFNA 4BXXC 2R92K 4AYBD 4LLGA 3GTLC 3I4MC 4A3KK 3RZDK 3CQZK 5IYDK 5IYCK 3PO3C 2A69A 4A3CC 5C3EK 2JA5K 2R7ZK 4C3JK 4A3IK 1SMYA 2O5IA 5IYBC 3S2HC 1I50C 3GTOK 4ZH4A 5C44C 4MEXA 3HKZL 3S16K 2WAQD 3S15C 3H3VL 3S14C 3WODA 5D4DA 4YG2A 3S1RC 1TWFK
chains in the Genus database with same CATH superfamily
2YU9A 3GTPK 3L4KA 1XZPA 2GSOA 1K83C 3T01A 4A3KC 3HOZK 1EK8A 2XCRB 1JQWA 4YFKA 5M5WK 5IP9C 1INNA 3GDZA 2GAHC 3EQLA 4BY7C 1IW7A 1TWHK 5IOQA 4KMHA 4J3NA 3AD9C 1Y1VK 1TWCA 2ZJPS 3RZOC 4AYBL 3VA7A 4C2MC 3GTGC 3HOVK 4X6AC 4XLPA 1XXBA 5FJ8K 3GTGA 2E2HC 1WCMK 3H3VD 4GT9A 4A3GC 1Y1VA 1I6HC 3S14K 4BY1C 3GEIA 3HKZD 4BKWA 1PJ6A 3GTJC 4GTCA 2WB1L 5M3FK 4LK0A 3LAJA 1B4AA 1G51A 1VRQC 4A93K 4LQYA 2O5JA 2PMZD 2XCOA 4QIWL 4GTDA 1TWAC 3FKIC 1TWGA 2YU9C 4GFQA 4PAAA 1K83A 3GIRA 1WCMA 4KC6A 4GZYA 4QJVB 1SFOK 1XXCA 5IYDC 1USMA 1J6WA 2R92C 4XLNA 3RZDC 3CQZA 3S2DK 1TWCC 1BGWA 4Y52K 5HQHA 4BBRC 3HOWC 1SFOC 4U67S 3SZZA 3V4GA 3BP8C 1J6VA 3LPXA 4GTBA 3ADAC 1IBAA 3TFJA 3HOUK 1YNJA 3K7AK 4LK1A 3S2HK 1PJ5A 2B63A 4KB4A 2VUMK 4Q5SA 2B63C 4YFNA 3TTGA 3I4MC 4A3KK 3CQZK 5C3EK 3N0CA 3FOFA 2JA5K 4A3IK 1XXAA 4WJ4A 3S2HC 2V6SA 3S16K 4MEXA 1O2AA 3S15C 3WODA 4LOWA 4YG2A 4A3MK 1XPPA 4IOCS 3L4JA 1WCMC 2E2HK 4A3EK 1O25A 4KASA 4WCES 4P9SA 4C2MK 4QIWD 3NUHA 5FLMK 4BBRK 3HOWK 2E2JK 2FQOA 3S1RK 2JA5A 2R7ZA 2NVTC 3FHZA 3M3YK 5JVOA 5E68A 3A8JA 4AH6A 2NVXK 1RU0A 3S15K 4A3BK 4OIPA 2V6UA 1I50K 1FEUA 2KPUA 3HOZC 1YX2A 1O26A 3FKIK 5DM7S 2JA7A 1TWGK 1TWAK 3T02A 4LR2A 2NVXC 3AQPA 4GTAA 4A3EC 1Y1VC 3G4CA 3PO2C 4C3IK 4QJVA 3GTGK 2CFAA 1F7VA 1I50A 2JA7K 2PMZL 3S2DC 2PA8L 4X6AK 1TWGC 1TWAA 5M3MK 2Y3PA 1YCLA 3N3YA 2Y0SL 3S1NC 3PIPS 1I6HK 2GSUA 4KMAA 1J98A 3GTOC 2EBBA 2VUMA 4KATA 2JA5C 3GTQK 1K83K 2W7VA 3M4OC 2NVQC 1ZQ1C 4G0UA 4IO9S 2ZJRS 1EFWA 3Q3QA 3S17K 1SFOA 4A3LK 5TMFA 3OEPA 3DXJA 2E2HA 3GTQA 3PO3K 4C45A 1XZPB 4C3JC 2NVQK 3S1NK 4P5BA 1TWFA 4PABA 1DCOA 2R92K 5HL7S 3RZDK 5IYDK 5IYCK 2A69A 2ZUFA 2R7ZK 4C3JK 4KM9A 1EH1A 3GTOK 1B4BA 3AD7C 3S14C 4BBSC 5D4DA 3HXAA 3S1RC 1TWFK 2CW0A 4A3LC 4GTFA 4IOAS 3JSTA 4G7OA 3FKIA 5M5XK 1Y1WA 2L3UA 3GTMK 3LYWA 4KDDA 4WILA 4NOIA 1IE0A 4KN7A 1WOOA 3GTOA 4XSXA 1EI6A 3I4MK 3AQOA 2R92A 5TMCA 1DCPA 5JVHS 4C3IC 3PO2K 2VUMC 1KQ4A 4A3MC 2RH6A 3TFHA 1I6VA 2A6HA 2Y0SD 4RMFA 3S1MK 1UV7A 4O2DA 4G7HA 2KQ1A 2XCQA 4DDQA 3GTMA 5FLMC 4Y52C 3GTMC 4KAWX 4Y7NC 1I3QC 1DCHA 3S1MC 2NVXA 1F93A 5IP7K 4A3FK 1ZYRA 1TWFC 3CAGA 4P5AA 2R93A 1X31C 4KM8A 5TJ3A 1ZBSA 3TFIA 2NVYK 2NVTK 3IPJA 1C0AA 1O29A 3M4OK 4M1XA 3GSIA 4XCHA 2E2IA 3GTKC 3HOYK 4JK1A 3FOEA 1BJTA 2L5NA 3S1QC 3GEEA 5C4JK 2NVYC 3A8IA 2P8TA 2NVYA 1WQFA 1YNNA 4KMDA 4BLBA 4G7ZA 1HI9A 1BS2A 3CQZC 1JOEA 5C4JC 4GTLA 3OPFA 4KB2A 3GTLK 1L0WA 3PIOS 1IS1A 4A3IC 2JA6A 1O2BA 2R7ZC 4A3DC 2E2IK 5IYCC 1HQMA 1XZQA 3K7AC 4OIRA 3GTJK 3SZYA 2JA8C 4YFXA 4C3HC 1ZVUA 4OIQA 3S1QK 2PHCB 3GTPC 1XZQB 1I3QA 2PPBA 3M3YC 1Y1WK 4WFNS 4Q4ZA 2ZUEA 1WQGA 5IYBK 1O24A 1VH2A 5EGEA 3CF5S 3T00A 4BXXC 4AYBD 1J6XA 4LLGA 5DM6S 1WIHA 4WFBS 1PJ7A 1SMYA 5IYBC 5CHPA 3HKZL 3H3VL 3GTKA 2A6EA 3I4NK 2JA8K 1DD5A 3S0XA 1I3QK 3ERED 2CFAB 4GTEA 4A3GK 1WSRA 1TWCK 1R9TC 4A3DK 4A3CK 1R9TA 1WOPA 3QX3A 2KXYA 3HOVC 3HOXC 1O28A 4WJ3M 5C4XK 1VJEA 4WFAS 4C3HK 3HOYC 3GTKK 4KARA 1IQ0A 1F7UA 2YU9K 4MEYA 4BLAA 1WORA 2JA7C 3AD8C 3BUEA 4KMUA 4KN4A 4A93C 1WQHA 4WF9S 3GTQC 2WAQL 2PA8D 4A3JC 1EQRA 2JH3A 1JVIA 1TWHC 5M5YK 2BE5A 3HOXK 1TWHA 2KWAA 5HL8A 5IP9K 3GTLA 4FM9A 4A3JK 3BP3A 4BY7K 2E2JC 4G0WA 5EGHA 4A3BC 3H0GA 2E2IC 5JFEA 3H0GC 1VGXA 1Y1WC 3RZOK 2R93K 2GSNA 5IOTA 3HOUC 5C44K 5IP7C 4A3FC 4BBSK 4LJZA 4OINA 5JVGS 4Y7NK 3A8KA 2P5MA 3S17C 1O27A 3H0GK 3AH5A 4BXXK 1ZXOA 2ZJQS 4BY1K 1ISEA 3S16C 1USOA 1IL2A 4XSZA 1WSVA 5C3EC 2JA6C 2B63K 3G4AA 1O2FB 3GEHA 1F9NA 4MQ9A 2A68A 2V6TA 1VLOA 3GTPA 3LAPA 1BDFA 3I4NC 1WOSA 3DLLS 2FQTA 4ILDA 2ZFZA 2JA6K 5IOSA 2WB1D 2GAGC 1GE9A 5C4XC 2R93C 1R9TK 4G0VA 4OIOA 3MMLB 5CJ9A 2D6FC 3GTJA 3OREA 3GTLC 4FZBA 3PO3C 4A3CC 2RGRA 1AB4A 2O5IA 1I50C 5L46A 4ZH4A 5C44C 3N0BA 2WAQD 1V5VA 5IORA
chains in the Genus database with same CATH topology
2CW0A 4A3LC 3GTPK 3I4NK 2JA8K 1WCMC 2E2HK 4G7OA 4A3EK 1I3QK 5M5XK 1K83C 4A3GK 3GTMK 4C2MK 4QIWD 4A3KC 1TWCK 4NOIA 1R9TC 4A3DK 3HOZK 4A3CK 4KN7A 5FLMK 4BBRK 3HOWK 4XSXA 3I4MK 3HOVC 2E2JK 4YFKA 5TMCA 5M5WK 5IP9C 3HOXC 1XPPA 4C3IC 3PO2K 2VUMC 5C4XK 4A3MC 3S1RK 3EQLA 4C3HK 4BY7C 1IW7A 1TWHK 2NVTC 1I6VA 3M3YK 1Y1VK 2A6HA 3HOYC 3GTKK 2Y0SD 2NVXK 3S15K 4A3BK 4OIPA 3RZOC 4MEYA 4AYBL 2YU9K 1I50K 3S1MK 3HOZC 2JA7C 4G7HA 2A6EA 3FKIK 4C2MC 1TWGK 3GTGC 3HOVK 4X6AC 4KMUA 4XLPA 5FJ8K 4KN4A 4A93C 1TWAK 5FLMC 2E2HC 4Y52C 3GTMC 3GTQC 3H3VD 1WCMK 2WAQL 2PA8D 4Y7NC 1I3QC 4A3JC 2NVXC 4A3GC 3S1MC 1I6HC 3S14K 4BY1C 4A3EC 5IP7K 4A3FK 1ZYRA 1Y1VC 1TWFC 1TWHC 3HKZD 3PO2C 4C3IK 5M5YK 2BE5A 3HOXK 3GTJC 2WB1L 5M3FK 4QJVA 4LK0A 5IP9K 2NVYK 2NVTK 3GTGK 4A3JK 3M4OK 4BY7K 2E2JC 4A93K 2O5JA 2PMZD 4BBSC 4A3BC 4QIWL 2E2IC 3GTKC 3HOYK 4JK1A 1TWAC 3FKIC 3H0GC 3S2DC 2PMZL 2JA7K 1Y1WC 2YU9C 2PA8L 3RZOK 2R93K 4X6AK 1TWGC 3S1QC 5C4JK 2NVYC 5M3MK 3HOUC 2Y0SL 3S1NC 5C44K 5IP7C 4A3FC 4GZYA 1YNNA 1I6HK 4BBSK 4QJVB 1SFOK 4LJZA 4OINA 4G7ZA 3GTOC 4Y7NK 5IYDC 3S17C 3H0GK 2JA5C 2R92C 4BXXK 4BY1K 3CQZC 4XLNA 3GTQK 5C4JC 3RZDC 3GTLK 3S16C 1K83K 3S2DK 4A3IC 1TWCC 2R7ZC 4XSZA 3M4OC 4Y52K 4A3DC 2E2IK 5C3EC 5IYCC 1HQMA 3K7AC 4BBRC 2NVQC 2JA6C 3HOWC 4OIRA 2B63K 1SFOC 4MQ9A 3GTJK 2A68A 3S17K 4A3LK 2JA8C 5TMFA 4YFXA 4C3HC 1BDFA 3DXJA 4OIQA 3S1QK 3GTPC 3I4NC 3PO3K 3HOUK 2PPBA 3M3YC 1Y1WK 4Q4ZA 4C3JC 1YNJA 3K7AK 2JA6K 2NVQK 4LK1A 5IYBK 2WB1D 3S1NK 3S2HK 5C4XC 2VUMK 4Q5SA 2R93C 4A3MK 4OIOA 2B63C 1R9TK 4YFNA 4BXXC 2R92K 4AYBD 4LLGA 3GTLC 3I4MC 4A3KK 3RZDK 3CQZK 5IYDK 5IYCK 3PO3C 2A69A 4A3CC 5C3EK 2JA5K 2R7ZK 4C3JK 4A3IK 1SMYA 2O5IA 5IYBC 3S2HC 1I50C 3GTOK 4ZH4A 5C44C 4MEXA 3HKZL 3S16K 2WAQD 3S15C 3H3VL 3S14C 3WODA 5D4DA 4YG2A 3S1RC 1TWFK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 A;  4A3L C;  3GTP K;  3I4N K;  2JA8 K;  1WCM C;  2E2H K;  4G7O A;  4A3E K;  1I3Q K;  5M5X K;  1K83 C;  4A3G K;  3GTM K;  4C2M K;  4QIW D;  4A3K C;  1TWC K;  4NOI A;  1R9T C;  4A3D K;  3HOZ K;  4A3C K;  4KN7 A;  5FLM K;  4BBR K;  3HOW K;  4XSX A;  3I4M K;  3HOV C;  2E2J K;  4YFK A;  5TMC A;  5M5W K;  5IP9 C;  3HOX C;  1XPP A;  4C3I C;  3PO2 K;  2VUM C;  5C4X K;  4A3M C;  3S1R K;  3EQL A;  4C3H K;  4BY7 C;  1IW7 A;  1TWH K;  2NVT C;  1I6V A;  3M3Y K;  1Y1V K;  2A6H A;  3HOY C;  3GTK K;  2Y0S D;  2NVX K;  3S15 K;  4A3B K;  4OIP A;  3RZO C;  4MEY A;  4AYB L;  2YU9 K;  1I50 K;  3S1M K;  3HOZ C;  2JA7 C;  4G7H A;  2A6E A;  3FKI K;  4C2M C;  1TWG K;  3GTG C;  3HOV K;  4X6A C;  4KMU A;  4XLP A;  5FJ8 K;  4KN4 A;  4A93 C;  1TWA K;  5FLM C;  2E2H C;  4Y52 C;  3GTM C;  3GTQ C;  3H3V D;  1WCM K;  2WAQ L;  2PA8 D;  4Y7N C;  1I3Q C;  4A3J C;  2NVX C;  4A3G C;  3S1M C;  1I6H C;  3S14 K;  4BY1 C;  4A3E C;  5IP7 K;  4A3F K;  1ZYR A;  1Y1V C;  1TWF C;  1TWH C;  3HKZ D;  3PO2 C;  4C3I K;  5M5Y K;  2BE5 A;  3HOX K;  3GTJ C;  2WB1 L;  5M3F K;  4QJV A;  4LK0 A;  5IP9 K;  2NVY K;  2NVT K;  3GTG K;  4A3J K;  3M4O K;  4BY7 K;  2E2J C;  4A93 K;  2O5J A;  2PMZ D;  4BBS C;  4A3B C;  4QIW L;  2E2I C;  3GTK C;  3HOY K;  4JK1 A;  1TWA C;  3FKI C;  3H0G C;  3S2D C;  2PMZ L;  2JA7 K;  1Y1W C;  2YU9 C;  2PA8 L;  3RZO K;  2R93 K;  4X6A K;  1TWG C;  3S1Q C;  5C4J K;  2NVY C;  5M3M K;  3HOU C;  2Y0S L;  3S1N C;  5C44 K;  5IP7 C;  4A3F C;  4GZY A;  1YNN A;  1I6H K;  4BBS K;  4QJV B;  1SFO K;  4LJZ A;  4OIN A;  4G7Z A;  3GTO C;  4Y7N K;  5IYD C;  3S17 C;  3H0G K;  2JA5 C;  2R92 C;  4BXX K;  4BY1 K;  3CQZ C;  4XLN A;  3GTQ K;  5C4J C;  3RZD C;  3GTL K;  3S16 C;  1K83 K;  3S2D K;  4A3I C;  1TWC C;  2R7Z C;  4XSZ A;  3M4O C;  4Y52 K;  4A3D C;  2E2I K;  5C3E C;  5IYC C;  1HQM A;  3K7A C;  4BBR C;  2NVQ C;  2JA6 C;  3HOW C;  4OIR A;  2B63 K;  1SFO C;  4MQ9 A;  3GTJ K;  2A68 A;  3S17 K;  4A3L K;  2JA8 C;  5TMF A;  4YFX A;  4C3H C;  1BDF A;  3DXJ A;  4OIQ A;  3S1Q K;  3GTP C;  3I4N C;  3PO3 K;  3HOU K;  2PPB A;  3M3Y C;  1Y1W K;  4Q4Z A;  4C3J C;  1YNJ A;  3K7A K;  2JA6 K;  2NVQ K;  4LK1 A;  5IYB K;  2WB1 D;  3S1N K;  3S2H K;  5C4X C;  2VUM K;  4Q5S A;  2R93 C;  4A3M K;  4OIO A;  2B63 C;  1R9T K;  4YFN A;  4BXX C;  2R92 K;  4AYB D;  4LLG A;  3GTL C;  3I4M C;  4A3K K;  3RZD K;  3CQZ K;  5IYD K;  5IYC K;  3PO3 C;  2A69 A;  4A3C C;  5C3E K;  2JA5 K;  2R7Z K;  4C3J K;  4A3I K;  1SMY A;  2O5I A;  5IYB C;  3S2H C;  1I50 C;  3GTO K;  4ZH4 A;  5C44 C;  4MEX A;  3HKZ L;  3S16 K;  2WAQ D;  3S15 C;  3H3V L;  3S14 C;  3WOD A;  5D4D A;  4YG2 A;  3S1R C;  1TWF K; 
#chains in the Genus database with same CATH topology
 2YU9 A;  3GTP K;  3L4K A;  1XZP A;  2GSO A;  1K83 C;  3T01 A;  4A3K C;  3HOZ K;  1EK8 A;  2XCR B;  1JQW A;  4YFK A;  5M5W K;  5IP9 C;  1INN A;  3GDZ A;  2GAH C;  3EQL A;  4BY7 C;  1IW7 A;  1TWH K;  5IOQ A;  4KMH A;  4J3N A;  3AD9 C;  1Y1V K;  1TWC A;  2ZJP S;  3RZO C;  4AYB L;  3VA7 A;  4C2M C;  3GTG C;  3HOV K;  4X6A C;  4XLP A;  1XXB A;  5FJ8 K;  3GTG A;  2E2H C;  1WCM K;  3H3V D;  4GT9 A;  4A3G C;  1Y1V A;  1I6H C;  3S14 K;  4BY1 C;  3GEI A;  3HKZ D;  4BKW A;  1PJ6 A;  3GTJ C;  4GTC A;  2WB1 L;  5M3F K;  4LK0 A;  3LAJ A;  1B4A A;  1G51 A;  1VRQ C;  4A93 K;  4LQY A;  2O5J A;  2PMZ D;  2XCO A;  4QIW L;  4GTD A;  1TWA C;  3FKI C;  1TWG A;  2YU9 C;  4GFQ A;  4PAA A;  1K83 A;  3GIR A;  1WCM A;  4KC6 A;  4GZY A;  4QJV B;  1SFO K;  1XXC A;  5IYD C;  1USM A;  1J6W A;  2R92 C;  4XLN A;  3RZD C;  3CQZ A;  3S2D K;  1TWC C;  1BGW A;  4Y52 K;  5HQH A;  4BBR C;  3HOW C;  1SFO C;  4U67 S;  3SZZ A;  3V4G A;  3BP8 C;  1J6V A;  3LPX A;  4GTB A;  3ADA C;  1IBA A;  3TFJ A;  3HOU K;  1YNJ A;  3K7A K;  4LK1 A;  3S2H K;  1PJ5 A;  2B63 A;  4KB4 A;  2VUM K;  4Q5S A;  2B63 C;  4YFN A;  3TTG A;  3I4M C;  4A3K K;  3CQZ K;  5C3E K;  3N0C A;  3FOF A;  2JA5 K;  4A3I K;  1XXA A;  4WJ4 A;  3S2H C;  2V6S A;  3S16 K;  4MEX A;  1O2A A;  3S15 C;  3WOD A;  4LOW A;  4YG2 A;  4A3M K;  1XPP A;  4IOC S;  3L4J A;  1WCM C;  2E2H K;  4A3E K;  1O25 A;  4KAS A;  4WCE S;  4P9S A;  4C2M K;  4QIW D;  3NUH A;  5FLM K;  4BBR K;  3HOW K;  2E2J K;  2FQO A;  3S1R K;  2JA5 A;  2R7Z A;  2NVT C;  3FHZ A;  3M3Y K;  5JVO A;  5E68 A;  3A8J A;  4AH6 A;  2NVX K;  1RU0 A;  3S15 K;  4A3B K;  4OIP A;  2V6U A;  1I50 K;  1FEU A;  2KPU A;  3HOZ C;  1YX2 A;  1O26 A;  3FKI K;  5DM7 S;  2JA7 A;  1TWG K;  1TWA K;  3T02 A;  4LR2 A;  2NVX C;  3AQP A;  4GTA A;  4A3E C;  1Y1V C;  3G4C A;  3PO2 C;  4C3I K;  4QJV A;  3GTG K;  2CFA A;  1F7V A;  1I50 A;  2JA7 K;  2PMZ L;  3S2D C;  2PA8 L;  4X6A K;  1TWG C;  1TWA A;  5M3M K;  2Y3P A;  1YCL A;  3N3Y A;  2Y0S L;  3S1N C;  3PIP S;  1I6H K;  2GSU A;  4KMA A;  1J98 A;  3GTO C;  2EBB A;  2VUM A;  4KAT A;  2JA5 C;  3GTQ K;  1K83 K;  2W7V A;  3M4O C;  2NVQ C;  1ZQ1 C;  4G0U A;  4IO9 S;  2ZJR S;  1EFW A;  3Q3Q A;  3S17 K;  1SFO A;  4A3L K;  5TMF A;  3OEP A;  3DXJ A;  2E2H A;  3GTQ A;  3PO3 K;  4C45 A;  1XZP B;  4C3J C;  2NVQ K;  3S1N K;  4P5B A;  1TWF A;  4PAB A;  1DCO A;  2R92 K;  5HL7 S;  3RZD K;  5IYD K;  5IYC K;  2A69 A;  2ZUF A;  2R7Z K;  4C3J K;  4KM9 A;  1EH1 A;  3GTO K;  1B4B A;  3AD7 C;  3S14 C;  4BBS C;  5D4D A;  3HXA A;  3S1R C;  1TWF K;  2CW0 A;  4A3L C;  4GTF A;  4IOA S;  3JST A;  4G7O A;  3FKI A;  5M5X K;  1Y1W A;  2L3U A;  3GTM K;  3LYW A;  4KDD A;  4WIL A;  4NOI A;  1IE0 A;  4KN7 A;  1WOO A;  3GTO A;  4XSX A;  1EI6 A;  3I4M K;  3AQO A;  2R92 A;  5TMC A;  1DCP A;  5JVH S;  4C3I C;  3PO2 K;  2VUM C;  1KQ4 A;  4A3M C;  2RH6 A;  3TFH A;  1I6V A;  2A6H A;  2Y0S D;  4RMF A;  3S1M K;  1UV7 A;  4O2D A;  4G7H A;  2KQ1 A;  2XCQ A;  4DDQ A;  3GTM A;  5FLM C;  4Y52 C;  3GTM C;  4KAW X;  4Y7N C;  1I3Q C;  1DCH A;  3S1M C;  2NVX A;  1F93 A;  5IP7 K;  4A3F K;  1ZYR A;  1TWF C;  3CAG A;  4P5A A;  2R93 A;  1X31 C;  4KM8 A;  5TJ3 A;  1ZBS A;  3TFI A;  2NVY K;  2NVT K;  3IPJ A;  1C0A A;  1O29 A;  3M4O K;  4M1X A;  3GSI A;  4XCH A;  2E2I A;  3GTK C;  3HOY K;  4JK1 A;  3FOE A;  1BJT A;  2L5N A;  3S1Q C;  3GEE A;  5C4J K;  2NVY C;  3A8I A;  2P8T A;  2NVY A;  1WQF A;  1YNN A;  4KMD A;  4BLB A;  4G7Z A;  1HI9 A;  1BS2 A;  3CQZ C;  1JOE A;  5C4J C;  4GTL A;  3OPF A;  4KB2 A;  3GTL K;  1L0W A;  3PIO S;  1IS1 A;  4A3I C;  2JA6 A;  1O2B A;  2R7Z C;  4A3D C;  2E2I K;  5IYC C;  1HQM A;  1XZQ A;  3K7A C;  4OIR A;  3GTJ K;  3SZY A;  2JA8 C;  4YFX A;  4C3H C;  1ZVU A;  4OIQ A;  3S1Q K;  2PHC B;  3GTP C;  1XZQ B;  1I3Q A;  2PPB A;  3M3Y C;  1Y1W K;  4WFN S;  4Q4Z A;  2ZUE A;  1WQG A;  5IYB K;  1O24 A;  1VH2 A;  5EGE A;  3CF5 S;  3T00 A;  4BXX C;  4AYB D;  1J6X A;  4LLG A;  5DM6 S;  1WIH A;  4WFB S;  1PJ7 A;  1SMY A;  5IYB C;  5CHP A;  3HKZ L;  3H3V L;  3GTK A;  2A6E A;  3I4N K;  2JA8 K;  1DD5 A;  3S0X A;  1I3Q K;  3ERE D;  2CFA B;  4GTE A;  4A3G K;  1WSR A;  1TWC K;  1R9T C;  4A3D K;  4A3C K;  1R9T A;  1WOP A;  3QX3 A;  2KXY A;  3HOV C;  3HOX C;  1O28 A;  4WJ3 M;  5C4X K;  1VJE A;  4WFA S;  4C3H K;  3HOY C;  3GTK K;  4KAR A;  1IQ0 A;  1F7U A;  2YU9 K;  4MEY A;  4BLA A;  1WOR A;  2JA7 C;  3AD8 C;  3BUE A;  4KMU A;  4KN4 A;  4A93 C;  1WQH A;  4WF9 S;  3GTQ C;  2WAQ L;  2PA8 D;  4A3J C;  1EQR A;  2JH3 A;  1JVI A;  1TWH C;  5M5Y K;  2BE5 A;  3HOX K;  1TWH A;  2KWA A;  5HL8 A;  5IP9 K;  3GTL A;  4FM9 A;  4A3J K;  3BP3 A;  4BY7 K;  2E2J C;  4G0W A;  5EGH A;  4A3B C;  3H0G A;  2E2I C;  5JFE A;  3H0G C;  1VGX A;  1Y1W C;  3RZO K;  2R93 K;  2GSN A;  5IOT A;  3HOU C;  5C44 K;  5IP7 C;  4A3F C;  4BBS K;  4LJZ A;  4OIN A;  5JVG S;  4Y7N K;  3A8K A;  2P5M A;  3S17 C;  1O27 A;  3H0G K;  3AH5 A;  4BXX K;  1ZXO A;  2ZJQ S;  4BY1 K;  1ISE A;  3S16 C;  1USO A;  1IL2 A;  4XSZ A;  1WSV A;  5C3E C;  2JA6 C;  2B63 K;  3G4A A;  1O2F B;  3GEH A;  1F9N A;  4MQ9 A;  2A68 A;  2V6T A;  1VLO A;  3GTP A;  3LAP A;  1BDF A;  3I4N C;  1WOS A;  3DLL S;  2FQT A;  4ILD A;  2ZFZ A;  2JA6 K;  5IOS A;  2WB1 D;  2GAG C;  1GE9 A;  5C4X C;  2R93 C;  1R9T K;  4G0V A;  4OIO A;  3MML B;  5CJ9 A;  2D6F C;  3GTJ A;  3ORE A;  3GTL C;  4FZB A;  3PO3 C;  4A3C C;  2RGR A;  1AB4 A;  2O5I A;  1I50 C;  5L46 A;  4ZH4 A;  5C44 C;  3N0B A;  2WAQ D;  1V5V A;  5IOR A; 
#chains in the Genus database with same CATH homology
 2CW0 A;  4A3L C;  3GTP K;  3I4N K;  2JA8 K;  1WCM C;  2E2H K;  4G7O A;  4A3E K;  1I3Q K;  5M5X K;  1K83 C;  4A3G K;  3GTM K;  4C2M K;  4QIW D;  4A3K C;  1TWC K;  4NOI A;  1R9T C;  4A3D K;  3HOZ K;  4A3C K;  4KN7 A;  5FLM K;  4BBR K;  3HOW K;  4XSX A;  3I4M K;  3HOV C;  2E2J K;  4YFK A;  5TMC A;  5M5W K;  5IP9 C;  3HOX C;  1XPP A;  4C3I C;  3PO2 K;  2VUM C;  5C4X K;  4A3M C;  3S1R K;  3EQL A;  4C3H K;  4BY7 C;  1IW7 A;  1TWH K;  2NVT C;  1I6V A;  3M3Y K;  1Y1V K;  2A6H A;  3HOY C;  3GTK K;  2Y0S D;  2NVX K;  3S15 K;  4A3B K;  4OIP A;  3RZO C;  4MEY A;  4AYB L;  2YU9 K;  1I50 K;  3S1M K;  3HOZ C;  2JA7 C;  4G7H A;  2A6E A;  3FKI K;  4C2M C;  1TWG K;  3GTG C;  3HOV K;  4X6A C;  4KMU A;  4XLP A;  5FJ8 K;  4KN4 A;  4A93 C;  1TWA K;  5FLM C;  2E2H C;  4Y52 C;  3GTM C;  3GTQ C;  3H3V D;  1WCM K;  2WAQ L;  2PA8 D;  4Y7N C;  1I3Q C;  4A3J C;  2NVX C;  4A3G C;  3S1M C;  1I6H C;  3S14 K;  4BY1 C;  4A3E C;  5IP7 K;  4A3F K;  1ZYR A;  1Y1V C;  1TWF C;  1TWH C;  3HKZ D;  3PO2 C;  4C3I K;  5M5Y K;  2BE5 A;  3HOX K;  3GTJ C;  2WB1 L;  5M3F K;  4QJV A;  4LK0 A;  5IP9 K;  2NVY K;  2NVT K;  3GTG K;  4A3J K;  3M4O K;  4BY7 K;  2E2J C;  4A93 K;  2O5J A;  2PMZ D;  4BBS C;  4A3B C;  4QIW L;  2E2I C;  3GTK C;  3HOY K;  4JK1 A;  1TWA C;  3FKI C;  3H0G C;  3S2D C;  2PMZ L;  2JA7 K;  1Y1W C;  2YU9 C;  2PA8 L;  3RZO K;  2R93 K;  4X6A K;  1TWG C;  3S1Q C;  5C4J K;  2NVY C;  5M3M K;  3HOU C;  2Y0S L;  3S1N C;  5C44 K;  5IP7 C;  4A3F C;  4GZY A;  1YNN A;  1I6H K;  4BBS K;  4QJV B;  1SFO K;  4LJZ A;  4OIN A;  4G7Z A;  3GTO C;  4Y7N K;  5IYD C;  3S17 C;  3H0G K;  2JA5 C;  2R92 C;  4BXX K;  4BY1 K;  3CQZ C;  4XLN A;  3GTQ K;  5C4J C;  3RZD C;  3GTL K;  3S16 C;  1K83 K;  3S2D K;  4A3I C;  1TWC C;  2R7Z C;  4XSZ A;  3M4O C;  4Y52 K;  4A3D C;  2E2I K;  5C3E C;  5IYC C;  1HQM A;  3K7A C;  4BBR C;  2NVQ C;  2JA6 C;  3HOW C;  4OIR A;  2B63 K;  1SFO C;  4MQ9 A;  3GTJ K;  2A68 A;  3S17 K;  4A3L K;  2JA8 C;  5TMF A;  4YFX A;  4C3H C;  1BDF A;  3DXJ A;  4OIQ A;  3S1Q K;  3GTP C;  3I4N C;  3PO3 K;  3HOU K;  2PPB A;  3M3Y C;  1Y1W K;  4Q4Z A;  4C3J C;  1YNJ A;  3K7A K;  2JA6 K;  2NVQ K;  4LK1 A;  5IYB K;  2WB1 D;  3S1N K;  3S2H K;  5C4X C;  2VUM K;  4Q5S A;  2R93 C;  4A3M K;  4OIO A;  2B63 C;  1R9T K;  4YFN A;  4BXX C;  2R92 K;  4AYB D;  4LLG A;  3GTL C;  3I4M C;  4A3K K;  3RZD K;  3CQZ K;  5IYD K;  5IYC K;  3PO3 C;  2A69 A;  4A3C C;  5C3E K;  2JA5 K;  2R7Z K;  4C3J K;  4A3I K;  1SMY A;  2O5I A;  5IYB C;  3S2H C;  1I50 C;  3GTO K;  4ZH4 A;  5C44 C;  4MEX A;  3HKZ L;  3S16 K;  2WAQ D;  3S15 C;  3H3V L;  3S14 C;  3WOD A;  5D4D A;  4YG2 A;  3S1R C;  1TWF K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...