1YNNA

Taq rna polymerase-rifampicin complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
total genus 39
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynnA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynnA01
4A3IC 4A3MK 2O5JA 5IP9K 2NVQC 1R9TK 1Y1WC 4LK0A 4X6AK 4A3MC 5IP9C 1R9TC 4BY1K 3HOXK 1IW7A 5M3MK 4ZH4A 2PMZL 3HOXC 4BXXC 4A3DK 4Q5SA 5IYDK 5TMCA 3M4OK 2VUMK 4A3DC 4A3EK 2A6HA 4LK1A 5IYDC 3M4OC 2VUMC 4A3EC 3I4MK 4C3HK 4A3LK 3I4MC 1I3QC 4C3HC 5C4XK 4A3LC 2JA5K 3S1RK 4OINA 5C4XC 4YFKA 4A3JK 4MEYA 2JA5C 4C2MK 3S1RC 4A3JC 4C2MC 3K7AK 4A3FK 2Y0SD 3RZDK 4BY7K 3S1QK 3K7AC 4A3FC 3RZDC 4BY7C 2PPBA 3S1QC 4AYBD 1TWHC 1K83K 4Y52K 3S15K 5IYCK 4Y52C 1K83C 1XPPA 4C3IK 3S15C 4YG2A 2NVXK 4C3IC 2NVXC 2NVTK 2PA8L 5FLMC 3I4NK 2JA8K 3M3YK 4KN4A 4LLGA 3GTPK 3GTOK 2JA8C 2WB1L 3M3YC 2PMZD 4OIRA 3GTOC 3GTPC 4X6AC 3S2DK 5C3EK 2E2JK 4BY1C 5TMFA 5C3EC 2E2JC 3GTQK 3GTLK 3PO3K 3GTQC 4LJZA 3GTLC 3PO3C 4XSXA 4A93K 4GZYA 3HKZL 4BBRK 3HOUK 1TWCK 4OIOA 4KN7A 4BBRC 1SMYA 3HOUC 5IYBK 4QIWD 3RZOK 5IYBC 4QIWL 3RZOC 4C3JK 1I50K 2NVYK 2A6EA 4YFNA 4XLNA 5M5WK 4C3JC 1I50C 4JK1A 4Q4ZA 5IYCC 3GTMK 3HOZK 4KMUA 2PA8D 3GTMC 3HOZC 2B63K 2R93K 2A68A 2NVTC 2B63C 2WB1D 3I4NC 4G7OA 2R93C 2BE5A 3EQLA 4MQ9A 1ZYRA 3FKIK 3S1NK 1YNNA 3S1NC 3FKIC 5IP7K 4G7ZA 3S2DC 5IP7C 3H3VL 1I6HK 1I6HC 5C44K 4XLPA 4Y7NK 3HKZD 2CW0A 1TWFK 5C44C 1WCMK 4Y7NC 5FJ8K 1TWFC 3S2HK 4A93C 1WCMC 5C4JK 3S17K 3S14K 1BDFA 3S16K 5C4JC 4G7HA 2O5IA 3S17C 3S1MK 3S14C 2E2HK 3S16C 3S1MC 3GTGK 4OIPA 5M3FK 1TWCC 2E2HC 1I6VA 2WAQL 2R92K 2YU9K 2R92C 3GTJK 2YU9C 4OIQA 3GTJC 4MEXA 5D4DA 2NVYC 1Y1VK 1Y1VC 4A3GK 4A3CK 4BXXK 2JA6K 3HOVK 4A3KK 4A3GC 4A3CC 2JA6C 3HOVC 4A3KC 3DXJA 4NOIA 1HQMA 4A3BK 1I3QK 4BBSK 3H3VD 1TWGK 1TWAK 4A3BC 4BBSC 4QJVB 1TWGC 1TWAC 1SFOK 3GTKK 1SFOC 3WODA 3H0GK 3GTKC 2A69A 4XSZA 3CQZK 3H0GC 1TWHK 2Y0SL 3CQZC 3HOYK 3S2HC 2JA7K 3HOYC 5M5YK 2E2IK 3HOWK 2JA7C 4AYBL 2WAQD 1YNJA 2E2IC 4QJVA 3HOWC 3GTGC 2R7ZK 3PO2K 3PO2C 5FLMK 2R7ZC 4YFXA 4A3IK 2NVQK 5M5XK 1Y1WK
chains in the Genus database with same CATH superfamily
4A3IC 2O5JA 1IW7A 2PMZL 4KATA 1J6WA 1O24A 3CAGA 2VUMK 2A6HA 2VUMC 1PJ7A 4LQYA 2VUMA 3GTLA 4A3LK 3OREA 4A3LC 4A3JK 4A3JC 3K7AK 4A3FK 2Y0SD 3K7AC 4A3FC 3S15K 1XPPA 3S15C 4GTAA 4KC6A 3GTOK 2B63A 2WB1L 1J6XA 2PMZD 3GTOC 1KQ4A 1PJ5A 4X6AC 2E2JK 1ISEA 1XXAA 2E2JC 1F7UA 2ZJRS 3LYWA 5IORA 2GSNA 4BBRK 3OEPA 4KN7A 4BBRC 2ZUFA 3T02A 5IOSA 4LOWA 4C3JK 2NVYK 4WFAS 2A6EA 2PHCB 4C3JC 3GEIA 4Q4ZA 1XXBA 2NVYA 2V6TA 3HOZK 4KDDA 3BUEA 3HOZC 2A68A 3GEHA 2WB1D 1DCPA 4KM8A 3S1NK 3S1NC 1EH1A 2W7VA 1I6HK 3GEEA 1I6HC 1DCHA 4G0VA 5FJ8K 1BGWA 4O2DA 3ERED 1BDFA 1ZXOA 3N0BA 2E2HK 1TWCC 2L5NA 2E2HC 2V6UA 4G0UA 2FQTA 3N0CA 3GTJK 2R7ZA 3GTJC 4MEXA 3GTJA 4BLBA 1R9TA 2JA6K 2JA6C 5TJ3A 4J3NA 2JA6A 5L46A 4NOIA 1TWAK 4FM9A 1TWAC 1SFOK 3BP3A 1TWAA 3GTKK 1SFOC 3GTKC 1SFOA 4XSZA 3GTKA 1IE0A 1TWHK 4G0WA 2CFAB 5HQHA 5M5YK 2L3UA 1TWHA 3GTGC 5FLMK 3AQOA 1WQGA 4PAAA 2NVXA 4A3MK 5IP9K 4A3MC 5IP9C 4BY1K 3HOXK 5HL8A 3HOXC 4IO9S 4BXXC 5IYDK 4A3EK 4LK1A 5IYDC 4A3EC 3I4MK 4C3HK 3I4MC 5C4XK 4C3HC 1VJEA 4LR2A 4OINA 5C4XC 3ADAC 4RMFA 2V6SA 3L4JA 1B4BA 4Y52K 1K83K 4WJ3M 5IYCK 4Y52C 1K83C 4C3IK 1V5VA 4KMHA 1K83A 4C3IC 1EQRA 1UV7A 2RH6A 4BLAA 1WOOA 1WIHA 3I4NK 3GTMA 4M1XA 4LLGA 4KARA 2R93A 3IPJA 5TMFA 1XZPB 3GTQK 3GTLK 3PO3K 4U67S 4IOCS 3GTQC 3GTLC 3Q3QA 3PO3C 4XSXA 2XCOA 4BKWA 4A93K 3GTQA 3AD7C 1XZQA 1WOPA 3RZOK 1XXCA 1USMA 3RZOC 1BS2A 1O2BA 1DD5A 3PIOS 2B63K 1VRQC 3DLLS 2B63C 4MQ9A 5IP7K 4G7ZA 4KAWX 5IP7C 3AD8C 4WILA 3TFJA 5C44K 4Y7NK 1USOA 2CW0A 5C44C 4Y7NC 1EK8A 5CJ9A 4WF9S 4G7HA 1YCLA 5DM6S 3SZZA 2WAQL 1I6VA 2ZJQS 4OIQA 5D4DA 2NVYC 1Y1WA 4A3GK 3VA7A 4A3GC 3T00A 3DXJA 3HXAA 1WOSA 2GSUA 3AD9C 4A3BK 1I3QK 2P5MA 4A3BC 3CF5S 1IQ0A 1X31C 2Y3PA 4AH6A 1I3QA 2KPUA 3WODA 2JA5A 2A69A 3TFIA 2JA7K 5DM7S 1AB4A 2JA7C 4AYBL 2WAQD 3S0XA 4QJVA 2JA7A 1IBAA 2R7ZK 2R7ZC 1EFWA 4KB4A 2NVQK 1J6VA 2NVQC 1R9TK 1R9TC 4A3DK 5TMCA 4A3DC 1L0WA 3V4GA 3L4KA 4YFKA 4MEYA 4C2MK 4C2MC 4GTFA 1J98A 3S1QK 4WFNS 2PPBA 3S1QC 4AYBD 1TWHC 2ZJPS 1I50A 5E68A 1O2AA 2NVXK 3LAJA 1PJ6A 2ZUEA 3GSIA 2NVXC 2NVTK 2PA8L 5FLMC 2JA8K 3M3YK 3GTPK 2JA8C 3AQPA 3M3YC 3GTPC 4OIRA 4PABA 3S2DK 3GTPA 4BY1C 3BP8C 4LJZA 1O25A 4GZYA 3HKZL 3FOEA 3HOUK 4OIOA 1G51A 1SMYA 3HOUC 5IYBK 4QIWD 2KXYA 5IYBC 3A8KA 1INNA 5IYCC 3GTMK 1VGXA 4KMUA 2PA8D 3A8JA 3GTMC 1JQWA 2R93K 3I4NC 2R93C 4A3IK 4ILDA 1O28A 2BE5A 3EQLA 1ZYRA 4XLPA 3HKZD 1TWFK 2FQOA 1WQFA 1TWFC 2ZFZA 3S2HK 4A93C 1ZBSA 1GE9A 1TWFA 4GTBA 3S14K 3S16K 2O5IA 2GSOA 3S14C 3S16C 4OIPA 5M3FK 2R92K 2R92C 1O27A 2R92A 2KQ1A 2P8TA 5JVHS 3HOVK 4XCHA 3A8IA 3HOVC 1HQMA 1C0AA 3G4AA 1O29A 5EGEA 3FHZA 1O2FB 3H0GK 3G4CA 3CQZK 3H0GC 5EGHA 3CQZC 3H0GA 1F9NA 3CQZA 5IOTA 2E2IK 1WSVA 5HL7S 1YNJA 2E2IC 3PO2K 2E2IA 3PO2C 3OPFA 5M5XK 1Y1WK 1Y1WC 4LK0A 4KMAA 4X6AK 2CFAA 1RU0A 3TTGA 4ZH4A 5M3MK 3GTOA 5IOQA 4P5AA 4Q5SA 1DCOA 3M4OK 1F93A 3M4OC 1I3QC 4C45A 1ZQ1C 2JA5K 4KASA 3S1RK 4P5BA 4WFBS 1HI9A 2JA5C 3S1RC 3RZDK 1WSRA 4BY7K 3RZDC 4BY7C 4GFQA 5CHPA 3QX3A 1IL2A 4YG2A 3MMLB 4WJ4A 3N3YA 1FEUA 1JOEA 1WQHA 4KN4A 5JFEA 3SZYA 1XZQB 5C3EK 1VH2A 1F7VA 5C3EC 4GTEA 5JVOA 2GAGC 2D6FC 3LPXA 2XCRB 1TWCK 3PIPS 2GAHC 1XZPA 1YX2A 1TWCA 4QIWL 2E2HA 1I50K 4YFNA 4XLNA 5M5WK 1I50C 4JK1A 1VLOA 4GTDA 1ZVUA 3T01A 5JVGS 4GT9A 2NVTC 4G7OA 4IOAS 3FKIK 1BJTA 1YNNA 3FKIC 1B4AA 4KMDA 3FKIA 3S2DC 3H3VL 3GDZA 4P9SA 1O26A 4KB2A 3TFHA 4DDQA 1WCMK 2XCQA 1WCMC 5C4JK 3S17K 1WCMA 4KM9A 3S1MK 5C4JC 3S17C 1WORA 3GTGK 3S1MC 3GTGA 2YU9K 3JSTA 1IS1A 2YU9C 3NUHA 4GTCA 2YU9A 1Y1VK 1Y1VC 3FOFA 1Y1VA 4A3CK 4BXXK 3AH5A 4A3KK 4A3CC 4A3KC 2KWAA 4FZBA 4BBSK 2RGRA 3H3VD 1TWGK 3LAPA 4BBSC 2EBBA 4QJVB 1TWGC 1TWGA 1JVIA 4GTLA 4WCES 2Y0SL 3HOYK 3S2HC 3HOYC 3HOWK 3HOWC 2JH3A 1EI6A 4YFXA 3GIRA
chains in the Genus database with same CATH topology
4A3IC 4A3MK 2O5JA 5IP9K 2NVQC 1R9TK 1Y1WC 4LK0A 4X6AK 4A3MC 5IP9C 1R9TC 4BY1K 3HOXK 1IW7A 5M3MK 4ZH4A 2PMZL 3HOXC 4BXXC 4A3DK 4Q5SA 5IYDK 5TMCA 3M4OK 2VUMK 4A3DC 4A3EK 2A6HA 4LK1A 5IYDC 3M4OC 2VUMC 4A3EC 3I4MK 4C3HK 4A3LK 3I4MC 1I3QC 4C3HC 5C4XK 4A3LC 2JA5K 3S1RK 4OINA 5C4XC 4YFKA 4A3JK 4MEYA 2JA5C 4C2MK 3S1RC 4A3JC 4C2MC 3K7AK 4A3FK 2Y0SD 3RZDK 4BY7K 3S1QK 3K7AC 4A3FC 3RZDC 4BY7C 2PPBA 3S1QC 4AYBD 1TWHC 1K83K 4Y52K 3S15K 5IYCK 4Y52C 1K83C 1XPPA 4C3IK 3S15C 4YG2A 2NVXK 4C3IC 2NVXC 2NVTK 2PA8L 5FLMC 3I4NK 2JA8K 3M3YK 4KN4A 4LLGA 3GTPK 3GTOK 2JA8C 2WB1L 3M3YC 2PMZD 4OIRA 3GTOC 3GTPC 4X6AC 3S2DK 5C3EK 2E2JK 4BY1C 5TMFA 5C3EC 2E2JC 3GTQK 3GTLK 3PO3K 3GTQC 4LJZA 3GTLC 3PO3C 4XSXA 4A93K 4GZYA 3HKZL 4BBRK 3HOUK 1TWCK 4OIOA 4KN7A 4BBRC 1SMYA 3HOUC 5IYBK 4QIWD 3RZOK 5IYBC 4QIWL 3RZOC 4C3JK 1I50K 2NVYK 2A6EA 4YFNA 4XLNA 5M5WK 4C3JC 1I50C 4JK1A 4Q4ZA 5IYCC 3GTMK 3HOZK 4KMUA 2PA8D 3GTMC 3HOZC 2B63K 2R93K 2A68A 2NVTC 2B63C 2WB1D 3I4NC 4G7OA 2R93C 2BE5A 3EQLA 4MQ9A 1ZYRA 3FKIK 3S1NK 1YNNA 3S1NC 3FKIC 5IP7K 4G7ZA 3S2DC 5IP7C 3H3VL 1I6HK 1I6HC 5C44K 4XLPA 4Y7NK 3HKZD 2CW0A 1TWFK 5C44C 1WCMK 4Y7NC 5FJ8K 1TWFC 3S2HK 4A93C 1WCMC 5C4JK 3S17K 3S14K 1BDFA 3S16K 5C4JC 4G7HA 2O5IA 3S17C 3S1MK 3S14C 2E2HK 3S16C 3S1MC 3GTGK 4OIPA 5M3FK 1TWCC 2E2HC 1I6VA 2WAQL 2R92K 2YU9K 2R92C 3GTJK 2YU9C 4OIQA 3GTJC 4MEXA 5D4DA 2NVYC 1Y1VK 1Y1VC 4A3GK 4A3CK 4BXXK 2JA6K 3HOVK 4A3KK 4A3GC 4A3CC 2JA6C 3HOVC 4A3KC 3DXJA 4NOIA 1HQMA 4A3BK 1I3QK 4BBSK 3H3VD 1TWGK 1TWAK 4A3BC 4BBSC 4QJVB 1TWGC 1TWAC 1SFOK 3GTKK 1SFOC 3WODA 3H0GK 3GTKC 2A69A 4XSZA 3CQZK 3H0GC 1TWHK 2Y0SL 3CQZC 3HOYK 3S2HC 2JA7K 3HOYC 5M5YK 2E2IK 3HOWK 2JA7C 4AYBL 2WAQD 1YNJA 2E2IC 4QJVA 3HOWC 3GTGC 2R7ZK 3PO2K 3PO2C 5FLMK 2R7ZC 4YFXA 4A3IK 2NVQK 5M5XK 1Y1WK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3I C;  4A3M K;  2O5J A;  5IP9 K;  2NVQ C;  1R9T K;  1Y1W C;  4LK0 A;  4X6A K;  4A3M C;  5IP9 C;  1R9T C;  4BY1 K;  3HOX K;  1IW7 A;  5M3M K;  4ZH4 A;  2PMZ L;  3HOX C;  4BXX C;  4A3D K;  4Q5S A;  5IYD K;  5TMC A;  3M4O K;  2VUM K;  4A3D C;  4A3E K;  2A6H A;  4LK1 A;  5IYD C;  3M4O C;  2VUM C;  4A3E C;  3I4M K;  4C3H K;  4A3L K;  3I4M C;  1I3Q C;  4C3H C;  5C4X K;  4A3L C;  2JA5 K;  3S1R K;  4OIN A;  5C4X C;  4YFK A;  4A3J K;  4MEY A;  2JA5 C;  4C2M K;  3S1R C;  4A3J C;  4C2M C;  3K7A K;  4A3F K;  2Y0S D;  3RZD K;  4BY7 K;  3S1Q K;  3K7A C;  4A3F C;  3RZD C;  4BY7 C;  2PPB A;  3S1Q C;  4AYB D;  1TWH C;  1K83 K;  4Y52 K;  3S15 K;  5IYC K;  4Y52 C;  1K83 C;  1XPP A;  4C3I K;  3S15 C;  4YG2 A;  2NVX K;  4C3I C;  2NVX C;  2NVT K;  2PA8 L;  5FLM C;  3I4N K;  2JA8 K;  3M3Y K;  4KN4 A;  4LLG A;  3GTP K;  3GTO K;  2JA8 C;  2WB1 L;  3M3Y C;  2PMZ D;  4OIR A;  3GTO C;  3GTP C;  4X6A C;  3S2D K;  5C3E K;  2E2J K;  4BY1 C;  5TMF A;  5C3E C;  2E2J C;  3GTQ K;  3GTL K;  3PO3 K;  3GTQ C;  4LJZ A;  3GTL C;  3PO3 C;  4XSX A;  4A93 K;  4GZY A;  3HKZ L;  4BBR K;  3HOU K;  1TWC K;  4OIO A;  4KN7 A;  4BBR C;  1SMY A;  3HOU C;  5IYB K;  4QIW D;  3RZO K;  5IYB C;  4QIW L;  3RZO C;  4C3J K;  1I50 K;  2NVY K;  2A6E A;  4YFN A;  4XLN A;  5M5W K;  4C3J C;  1I50 C;  4JK1 A;  4Q4Z A;  5IYC C;  3GTM K;  3HOZ K;  4KMU A;  2PA8 D;  3GTM C;  3HOZ C;  2B63 K;  2R93 K;  2A68 A;  2NVT C;  2B63 C;  2WB1 D;  3I4N C;  4G7O A;  2R93 C;  2BE5 A;  3EQL A;  4MQ9 A;  1ZYR A;  3FKI K;  3S1N K;  1YNN A;  3S1N C;  3FKI C;  5IP7 K;  4G7Z A;  3S2D C;  5IP7 C;  3H3V L;  1I6H K;  1I6H C;  5C44 K;  4XLP A;  4Y7N K;  3HKZ D;  2CW0 A;  1TWF K;  5C44 C;  1WCM K;  4Y7N C;  5FJ8 K;  1TWF C;  3S2H K;  4A93 C;  1WCM C;  5C4J K;  3S17 K;  3S14 K;  1BDF A;  3S16 K;  5C4J C;  4G7H A;  2O5I A;  3S17 C;  3S1M K;  3S14 C;  2E2H K;  3S16 C;  3S1M C;  3GTG K;  4OIP A;  5M3F K;  1TWC C;  2E2H C;  1I6V A;  2WAQ L;  2R92 K;  2YU9 K;  2R92 C;  3GTJ K;  2YU9 C;  4OIQ A;  3GTJ C;  4MEX A;  5D4D A;  2NVY C;  1Y1V K;  1Y1V C;  4A3G K;  4A3C K;  4BXX K;  2JA6 K;  3HOV K;  4A3K K;  4A3G C;  4A3C C;  2JA6 C;  3HOV C;  4A3K C;  3DXJ A;  4NOI A;  1HQM A;  4A3B K;  1I3Q K;  4BBS K;  3H3V D;  1TWG K;  1TWA K;  4A3B C;  4BBS C;  4QJV B;  1TWG C;  1TWA C;  1SFO K;  3GTK K;  1SFO C;  3WOD A;  3H0G K;  3GTK C;  2A69 A;  4XSZ A;  3CQZ K;  3H0G C;  1TWH K;  2Y0S L;  3CQZ C;  3HOY K;  3S2H C;  2JA7 K;  3HOY C;  5M5Y K;  2E2I K;  3HOW K;  2JA7 C;  4AYB L;  2WAQ D;  1YNJ A;  2E2I C;  4QJV A;  3HOW C;  3GTG C;  2R7Z K;  3PO2 K;  3PO2 C;  5FLM K;  2R7Z C;  4YFX A;  4A3I K;  2NVQ K;  5M5X K;  1Y1W K; 
#chains in the Genus database with same CATH topology
 4A3I C;  2O5J A;  1IW7 A;  2PMZ L;  4KAT A;  1J6W A;  1O24 A;  3CAG A;  2VUM K;  2A6H A;  2VUM C;  1PJ7 A;  4LQY A;  2VUM A;  3GTL A;  4A3L K;  3ORE A;  4A3L C;  4A3J K;  4A3J C;  3K7A K;  4A3F K;  2Y0S D;  3K7A C;  4A3F C;  3S15 K;  1XPP A;  3S15 C;  4GTA A;  4KC6 A;  3GTO K;  2B63 A;  2WB1 L;  1J6X A;  2PMZ D;  3GTO C;  1KQ4 A;  1PJ5 A;  4X6A C;  2E2J K;  1ISE A;  1XXA A;  2E2J C;  1F7U A;  2ZJR S;  3LYW A;  5IOR A;  2GSN A;  4BBR K;  3OEP A;  4KN7 A;  4BBR C;  2ZUF A;  3T02 A;  5IOS A;  4LOW A;  4C3J K;  2NVY K;  4WFA S;  2A6E A;  2PHC B;  4C3J C;  3GEI A;  4Q4Z A;  1XXB A;  2NVY A;  2V6T A;  3HOZ K;  4KDD A;  3BUE A;  3HOZ C;  2A68 A;  3GEH A;  2WB1 D;  1DCP A;  4KM8 A;  3S1N K;  3S1N C;  1EH1 A;  2W7V A;  1I6H K;  3GEE A;  1I6H C;  1DCH A;  4G0V A;  5FJ8 K;  1BGW A;  4O2D A;  3ERE D;  1BDF A;  1ZXO A;  3N0B A;  2E2H K;  1TWC C;  2L5N A;  2E2H C;  2V6U A;  4G0U A;  2FQT A;  3N0C A;  3GTJ K;  2R7Z A;  3GTJ C;  4MEX A;  3GTJ A;  4BLB A;  1R9T A;  2JA6 K;  2JA6 C;  5TJ3 A;  4J3N A;  2JA6 A;  5L46 A;  4NOI A;  1TWA K;  4FM9 A;  1TWA C;  1SFO K;  3BP3 A;  1TWA A;  3GTK K;  1SFO C;  3GTK C;  1SFO A;  4XSZ A;  3GTK A;  1IE0 A;  1TWH K;  4G0W A;  2CFA B;  5HQH A;  5M5Y K;  2L3U A;  1TWH A;  3GTG C;  5FLM K;  3AQO A;  1WQG A;  4PAA A;  2NVX A;  4A3M K;  5IP9 K;  4A3M C;  5IP9 C;  4BY1 K;  3HOX K;  5HL8 A;  3HOX C;  4IO9 S;  4BXX C;  5IYD K;  4A3E K;  4LK1 A;  5IYD C;  4A3E C;  3I4M K;  4C3H K;  3I4M C;  5C4X K;  4C3H C;  1VJE A;  4LR2 A;  4OIN A;  5C4X C;  3ADA C;  4RMF A;  2V6S A;  3L4J A;  1B4B A;  4Y52 K;  1K83 K;  4WJ3 M;  5IYC K;  4Y52 C;  1K83 C;  4C3I K;  1V5V A;  4KMH A;  1K83 A;  4C3I C;  1EQR A;  1UV7 A;  2RH6 A;  4BLA A;  1WOO A;  1WIH A;  3I4N K;  3GTM A;  4M1X A;  4LLG A;  4KAR A;  2R93 A;  3IPJ A;  5TMF A;  1XZP B;  3GTQ K;  3GTL K;  3PO3 K;  4U67 S;  4IOC S;  3GTQ C;  3GTL C;  3Q3Q A;  3PO3 C;  4XSX A;  2XCO A;  4BKW A;  4A93 K;  3GTQ A;  3AD7 C;  1XZQ A;  1WOP A;  3RZO K;  1XXC A;  1USM A;  3RZO C;  1BS2 A;  1O2B A;  1DD5 A;  3PIO S;  2B63 K;  1VRQ C;  3DLL S;  2B63 C;  4MQ9 A;  5IP7 K;  4G7Z A;  4KAW X;  5IP7 C;  3AD8 C;  4WIL A;  3TFJ A;  5C44 K;  4Y7N K;  1USO A;  2CW0 A;  5C44 C;  4Y7N C;  1EK8 A;  5CJ9 A;  4WF9 S;  4G7H A;  1YCL A;  5DM6 S;  3SZZ A;  2WAQ L;  1I6V A;  2ZJQ S;  4OIQ A;  5D4D A;  2NVY C;  1Y1W A;  4A3G K;  3VA7 A;  4A3G C;  3T00 A;  3DXJ A;  3HXA A;  1WOS A;  2GSU A;  3AD9 C;  4A3B K;  1I3Q K;  2P5M A;  4A3B C;  3CF5 S;  1IQ0 A;  1X31 C;  2Y3P A;  4AH6 A;  1I3Q A;  2KPU A;  3WOD A;  2JA5 A;  2A69 A;  3TFI A;  2JA7 K;  5DM7 S;  1AB4 A;  2JA7 C;  4AYB L;  2WAQ D;  3S0X A;  4QJV A;  2JA7 A;  1IBA A;  2R7Z K;  2R7Z C;  1EFW A;  4KB4 A;  2NVQ K;  1J6V A;  2NVQ C;  1R9T K;  1R9T C;  4A3D K;  5TMC A;  4A3D C;  1L0W A;  3V4G A;  3L4K A;  4YFK A;  4MEY A;  4C2M K;  4C2M C;  4GTF A;  1J98 A;  3S1Q K;  4WFN S;  2PPB A;  3S1Q C;  4AYB D;  1TWH C;  2ZJP S;  1I50 A;  5E68 A;  1O2A A;  2NVX K;  3LAJ A;  1PJ6 A;  2ZUE A;  3GSI A;  2NVX C;  2NVT K;  2PA8 L;  5FLM C;  2JA8 K;  3M3Y K;  3GTP K;  2JA8 C;  3AQP A;  3M3Y C;  3GTP C;  4OIR A;  4PAB A;  3S2D K;  3GTP A;  4BY1 C;  3BP8 C;  4LJZ A;  1O25 A;  4GZY A;  3HKZ L;  3FOE A;  3HOU K;  4OIO A;  1G51 A;  1SMY A;  3HOU C;  5IYB K;  4QIW D;  2KXY A;  5IYB C;  3A8K A;  1INN A;  5IYC C;  3GTM K;  1VGX A;  4KMU A;  2PA8 D;  3A8J A;  3GTM C;  1JQW A;  2R93 K;  3I4N C;  2R93 C;  4A3I K;  4ILD A;  1O28 A;  2BE5 A;  3EQL A;  1ZYR A;  4XLP A;  3HKZ D;  1TWF K;  2FQO A;  1WQF A;  1TWF C;  2ZFZ A;  3S2H K;  4A93 C;  1ZBS A;  1GE9 A;  1TWF A;  4GTB A;  3S14 K;  3S16 K;  2O5I A;  2GSO A;  3S14 C;  3S16 C;  4OIP A;  5M3F K;  2R92 K;  2R92 C;  1O27 A;  2R92 A;  2KQ1 A;  2P8T A;  5JVH S;  3HOV K;  4XCH A;  3A8I A;  3HOV C;  1HQM A;  1C0A A;  3G4A A;  1O29 A;  5EGE A;  3FHZ A;  1O2F B;  3H0G K;  3G4C A;  3CQZ K;  3H0G C;  5EGH A;  3CQZ C;  3H0G A;  1F9N A;  3CQZ A;  5IOT A;  2E2I K;  1WSV A;  5HL7 S;  1YNJ A;  2E2I C;  3PO2 K;  2E2I A;  3PO2 C;  3OPF A;  5M5X K;  1Y1W K;  1Y1W C;  4LK0 A;  4KMA A;  4X6A K;  2CFA A;  1RU0 A;  3TTG A;  4ZH4 A;  5M3M K;  3GTO A;  5IOQ A;  4P5A A;  4Q5S A;  1DCO A;  3M4O K;  1F93 A;  3M4O C;  1I3Q C;  4C45 A;  1ZQ1 C;  2JA5 K;  4KAS A;  3S1R K;  4P5B A;  4WFB S;  1HI9 A;  2JA5 C;  3S1R C;  3RZD K;  1WSR A;  4BY7 K;  3RZD C;  4BY7 C;  4GFQ A;  5CHP A;  3QX3 A;  1IL2 A;  4YG2 A;  3MML B;  4WJ4 A;  3N3Y A;  1FEU A;  1JOE A;  1WQH A;  4KN4 A;  5JFE A;  3SZY A;  1XZQ B;  5C3E K;  1VH2 A;  1F7V A;  5C3E C;  4GTE A;  5JVO A;  2GAG C;  2D6F C;  3LPX A;  2XCR B;  1TWC K;  3PIP S;  2GAH C;  1XZP A;  1YX2 A;  1TWC A;  4QIW L;  2E2H A;  1I50 K;  4YFN A;  4XLN A;  5M5W K;  1I50 C;  4JK1 A;  1VLO A;  4GTD A;  1ZVU A;  3T01 A;  5JVG S;  4GT9 A;  2NVT C;  4G7O A;  4IOA S;  3FKI K;  1BJT A;  1YNN A;  3FKI C;  1B4A A;  4KMD A;  3FKI A;  3S2D C;  3H3V L;  3GDZ A;  4P9S A;  1O26 A;  4KB2 A;  3TFH A;  4DDQ A;  1WCM K;  2XCQ A;  1WCM C;  5C4J K;  3S17 K;  1WCM A;  4KM9 A;  3S1M K;  5C4J C;  3S17 C;  1WOR A;  3GTG K;  3S1M C;  3GTG A;  2YU9 K;  3JST A;  1IS1 A;  2YU9 C;  3NUH A;  4GTC A;  2YU9 A;  1Y1V K;  1Y1V C;  3FOF A;  1Y1V A;  4A3C K;  4BXX K;  3AH5 A;  4A3K K;  4A3C C;  4A3K C;  2KWA A;  4FZB A;  4BBS K;  2RGR A;  3H3V D;  1TWG K;  3LAP A;  4BBS C;  2EBB A;  4QJV B;  1TWG C;  1TWG A;  1JVI A;  4GTL A;  4WCE S;  2Y0S L;  3HOY K;  3S2H C;  3HOY C;  3HOW K;  3HOW C;  2JH3 A;  1EI6 A;  4YFX A;  3GIR A; 
#chains in the Genus database with same CATH homology
 4A3I C;  4A3M K;  2O5J A;  5IP9 K;  2NVQ C;  1R9T K;  1Y1W C;  4LK0 A;  4X6A K;  4A3M C;  5IP9 C;  1R9T C;  4BY1 K;  3HOX K;  1IW7 A;  5M3M K;  4ZH4 A;  2PMZ L;  3HOX C;  4BXX C;  4A3D K;  4Q5S A;  5IYD K;  5TMC A;  3M4O K;  2VUM K;  4A3D C;  4A3E K;  2A6H A;  4LK1 A;  5IYD C;  3M4O C;  2VUM C;  4A3E C;  3I4M K;  4C3H K;  4A3L K;  3I4M C;  1I3Q C;  4C3H C;  5C4X K;  4A3L C;  2JA5 K;  3S1R K;  4OIN A;  5C4X C;  4YFK A;  4A3J K;  4MEY A;  2JA5 C;  4C2M K;  3S1R C;  4A3J C;  4C2M C;  3K7A K;  4A3F K;  2Y0S D;  3RZD K;  4BY7 K;  3S1Q K;  3K7A C;  4A3F C;  3RZD C;  4BY7 C;  2PPB A;  3S1Q C;  4AYB D;  1TWH C;  1K83 K;  4Y52 K;  3S15 K;  5IYC K;  4Y52 C;  1K83 C;  1XPP A;  4C3I K;  3S15 C;  4YG2 A;  2NVX K;  4C3I C;  2NVX C;  2NVT K;  2PA8 L;  5FLM C;  3I4N K;  2JA8 K;  3M3Y K;  4KN4 A;  4LLG A;  3GTP K;  3GTO K;  2JA8 C;  2WB1 L;  3M3Y C;  2PMZ D;  4OIR A;  3GTO C;  3GTP C;  4X6A C;  3S2D K;  5C3E K;  2E2J K;  4BY1 C;  5TMF A;  5C3E C;  2E2J C;  3GTQ K;  3GTL K;  3PO3 K;  3GTQ C;  4LJZ A;  3GTL C;  3PO3 C;  4XSX A;  4A93 K;  4GZY A;  3HKZ L;  4BBR K;  3HOU K;  1TWC K;  4OIO A;  4KN7 A;  4BBR C;  1SMY A;  3HOU C;  5IYB K;  4QIW D;  3RZO K;  5IYB C;  4QIW L;  3RZO C;  4C3J K;  1I50 K;  2NVY K;  2A6E A;  4YFN A;  4XLN A;  5M5W K;  4C3J C;  1I50 C;  4JK1 A;  4Q4Z A;  5IYC C;  3GTM K;  3HOZ K;  4KMU A;  2PA8 D;  3GTM C;  3HOZ C;  2B63 K;  2R93 K;  2A68 A;  2NVT C;  2B63 C;  2WB1 D;  3I4N C;  4G7O A;  2R93 C;  2BE5 A;  3EQL A;  4MQ9 A;  1ZYR A;  3FKI K;  3S1N K;  1YNN A;  3S1N C;  3FKI C;  5IP7 K;  4G7Z A;  3S2D C;  5IP7 C;  3H3V L;  1I6H K;  1I6H C;  5C44 K;  4XLP A;  4Y7N K;  3HKZ D;  2CW0 A;  1TWF K;  5C44 C;  1WCM K;  4Y7N C;  5FJ8 K;  1TWF C;  3S2H K;  4A93 C;  1WCM C;  5C4J K;  3S17 K;  3S14 K;  1BDF A;  3S16 K;  5C4J C;  4G7H A;  2O5I A;  3S17 C;  3S1M K;  3S14 C;  2E2H K;  3S16 C;  3S1M C;  3GTG K;  4OIP A;  5M3F K;  1TWC C;  2E2H C;  1I6V A;  2WAQ L;  2R92 K;  2YU9 K;  2R92 C;  3GTJ K;  2YU9 C;  4OIQ A;  3GTJ C;  4MEX A;  5D4D A;  2NVY C;  1Y1V K;  1Y1V C;  4A3G K;  4A3C K;  4BXX K;  2JA6 K;  3HOV K;  4A3K K;  4A3G C;  4A3C C;  2JA6 C;  3HOV C;  4A3K C;  3DXJ A;  4NOI A;  1HQM A;  4A3B K;  1I3Q K;  4BBS K;  3H3V D;  1TWG K;  1TWA K;  4A3B C;  4BBS C;  4QJV B;  1TWG C;  1TWA C;  1SFO K;  3GTK K;  1SFO C;  3WOD A;  3H0G K;  3GTK C;  2A69 A;  4XSZ A;  3CQZ K;  3H0G C;  1TWH K;  2Y0S L;  3CQZ C;  3HOY K;  3S2H C;  2JA7 K;  3HOY C;  5M5Y K;  2E2I K;  3HOW K;  2JA7 C;  4AYB L;  2WAQ D;  1YNJ A;  2E2I C;  4QJV A;  3HOW C;  3GTG C;  2R7Z K;  3PO2 K;  3PO2 C;  5FLM K;  2R7Z C;  4YFX A;  4A3I K;  2NVQ K;  5M5X K;  1Y1W K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...