2O5JA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5jA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5jA01
3GTGC 4A3IC 4KMUA 5IYCC 1I50C 2BE5A 3I4MK 1I3QK 1Y1WK 3S17C 2VUMK 3HKZD 4LJZA 2A69A 2R7ZC 5M5YK 2E2JK 3GTPK 4YFKA 4BBRK 1SFOK 3GTJC 3S1RC 4C2MC 1XPPA 3HOXK 4A3EC 4MEYA 1YNJA 5TMCA 1TWHC 2JA6K 3CQZC 2A68A 2NVYK 4A3JK 4C3HC 3H3VL 4BY7K 4C3JK 2JA8C 4C3IC 2R92C 1TWFK 3GTKK 3PO2C 2NVQK 4A3MC 2NVTC 3GTOK 4Y7NC 5IP9K 4BXXK 3HOZC 3S1QC 5IP7K 4OIQA 3S1MC 1Y1VC 4QIWL 4MQ9A 1TWAC 2NVXK 3S16C 4Q5SA 3RZOK 4A3DC 3HOYK 4G7HA 3HOUC 1TWCC 2YU9K 4A93K 4LLGA 4OINA 2JA7C 5C4XK 5FLMK 4KN4A 2B63K 3PO3C 3HOWC 2R93K 5IYBK 3RZDC 1WCMC 2A6HA 3FKIC 2WB1L 4A3KC 3EQLA 5M3FK 3M4OC 2O5JA 2CW0A 5IYDK 3S14K 4BY1C 3I4NK 3S2HK 5C44C 3S2DC 2E2HK 3M3YK 5M5WK 3HOVC 2JA5C 4A3LC 4OIPA 3I4MC 4LK0A 1I3QC 1Y1WC 3GTLK 3H3VD 2VUMC 2E2JC 1TWGK 3GTMK 3GTPC 1I6HK 3GTQK 4XSXA 3S1NK 4BBRC 1SFOC 3H0GK 4X6AK 5C3EK 3HOXC 4A3FK 4A3GK 1IW7A 1SMYA 2NVYC 4A3JC 2JA6C 2PA8L 5M3MK 4A3BK 4BY7C 4G7OA 4QIWD 4C3JC 3GTKC 1TWFC 5C4JK 4NOIA 1K83K 1R9TK 2E2IK 2NVQC 4A3CK 3K7AK 4BBSK 4MEXA 4LK1A 3GTOC 4Y52K 5IP9C 4QJVA 5IP7C 4BXXC 4ZH4A 1ZYRA 1I6VA 3S15K 5M5XK 2NVXC 3RZOC 4XLNA 3GTGK 2WB1D 3HOYC 5IYCK 4A93C 1I50K 2YU9C 2Y0SL 2A6EA 3S17K 5C4XC 4OIOA 2WAQL 5FLMC 2R7ZK 2B63C 4AYBL 2R93C 5IYBC 3WODA 3GTJK 3S1RK 4C2MK 4A3EK 5FJ8K 4YG2A 3CQZK 3HKZL 4C3HK 5IYDC 3S14C 2JA8K 3S2HC 3I4NC 2E2HC 3M3YC 4XLPA 4GZYA 4C3IK 2PPBA 2R92K 5TMFA 4A3MK 4QJVB 2NVTK 3PO2K 4Y7NK 3HOZK 3S1QK 3S1MK 5D4DA 3GTLC 1Y1VK 2PA8D 2O5IA 1TWGC 4Q4ZA 3GTMC 1I6HC 3GTQC 1TWAK 3S16K 4KN7A 3S1NC 3H0GC 4OIRA 4X6AC 4A3DK 5C3EC 3HOUK 1TWCK 4A3FC 2JA7K 4G7ZA 1YNNA 1HQMA 4A3GC 4A3IK 4YFNA 4A3BC 3HOWK 3PO3K 4XSZA 3RZDK 4A3LK 1BDFA 1WCMK 3FKIK 1R9TC 5C4JC 1K83C 3DXJA 2E2IC 4A3CC 4A3KK 4BBSC 3K7AC 3M4OK 2PMZL 4Y52C 2Y0SD 4YFXA 4BY1K 2WAQD 5C44K 3S15C 3S2DK 4AYBD 1TWHK 4JK1A 3HOVK 2JA5K 2PMZD
chains in the Genus database with same CATH superfamily
4KAWX 2L3UA 3A8IA 4BKWA 4LJZA 2E2JK 4G0VA 3BP8C 2JA7A 4C2MC 4IO9S 1AB4A 2JA6K 2NVYK 3AQOA 3FKIA 1WOPA 5HL8A 3GTKK 2ZJQS 4WJ4A 3S1MC 1FEUA 3S16C 3RZOK 4G0UA 4WILA 3HOUC 1I3QA 4WFAS 2YU9K 2B63K 3PO3C 2R93K 3Q3QA 4BLAA 5IYBK 3AQPA 1O27A 3BP3A 4A3KC 3G4AA 3EQLA 3GEEA 3QX3A 2O5JA 1BS2A 1X31C 3I4NK 3M3YK 3S2DC 4OIPA 1XXBA 2Y3PA 2P5MA 1JVIA 1XXAA 2E2JC 1TWGK 3GTMK 3H0GK 4KC6A 5C3EK 4IOAS 1IW7A 2JA6C 2NVYC 1O28A 3GTKC 5L46A 4Y52K 3NUHA 2ZJRS 3L4JA 4QJVA 5EGEA 3RZOC 4XLNA 3GTGK 2WB1D 5IYCK 1J6VA 1I50K 2CFAA 2YU9C 2Y0SL 3OREA 2B63C 4AYBL 4KARA 2R93C 5IYBC 3CF5S 2R92A 5DM7S 5FJ8K 2EBBA 3CQZK 4C3HK 4GTAA 2JA8K 3I4NC 4GZYA 3M3YC 4C3IK 1PJ5A 5TMFA 5E68A 2NVTK 2FQOA 1TWAA 1IS1A 3HOZK 1O29A 3CAGA 1IL2A 2O5IA 1TWGC 4Q4ZA 3GTMC 2XCOA 3H0GC 1DCHA 5C3EC 3TFIA 1VRQC 1WSVA 2JA7K 4G7ZA 2KWAA 1YNNA 1JQWA 3HOWK 1EFWA 4XSZA 4GT9A 4WJ3M 3PIPS 3FKIK 2P8TA 3A8KA 4KM9A 4Y52C 2ZUEA 4YFXA 3GDZA 3GIRA 2PMZD 3GTGC 4KASA 5IYCC 1I50C 1I3QK 1Y1WK 2A69A 3GTPK 4YFKA 4WFNS 3HOXK 5IOSA 1TWFA 4MEYA 4GTEA 1TWHC 3CQZC 2A68A 3N0BA 4A3JK 4C3HC 1WCMA 4BY7K 2D6FC 3FOEA 2JA8C 4C3IC 1O2AA 1ZBSA 5TJ3A 2NVTC 3FOFA 5IP9K 3HOZC 3A8JA 4MQ9A 2JA5A 5CHPA 3MMLB 3OEPA 3HOYK 1PJ6A 2JA7C 4KMDA 3V4GA 2VUMA 1J6WA 4M1XA 4KN4A 3HOWC 3T01A 1SFOA 3GEHA 2KXYA 3FKIC 2WB1L 4ILDA 1XXCA 5M3FK 1XZPB 3ERED 3S14K 2V6TA 2XCRB 1WOOA 1O24A 1I3QC 1Y1WC 4O2DA 2NVXA 3GTPC 3TFHA 3HOXC 1K83A 1KQ4A 4A3BK 4A3JC 4BY7C 2GAGC 3L4KA 4QIWD 1R9TK 2E2IK 1ZXOA 3K7AK 4FZBA 4LK1A 4PAAA 5IP9C 2CFAB 1ZYRA 1B4BA 5DM6S 4WFBS 1O2FB 3HOYC 3JSTA 3GTLA 2A6EA 3S17K 4GFQA 3GTQA 3S1RK 1WSRA 4GTDA 4A3EK 4YG2A 3S14C 1INNA 1PJ7A 3SZZA 1BJTA 2PPBA 4P9SA 1JOEA 3N0CA 4XCHA 4Y7NK 3S1QK 4WF9S 3LPXA 2PA8D 4BLBA 1EI6A 3T00A 4A3DK 4OIRA 4P5AA 2R7ZA 1ZQ1C 4A3BC 4FM9A 3RZDK 1WCMK 3GTJA 1R9TC 2E2IC 3K7AC 5HL7S 1USOA 3G4CA 3TTGA 5C44K 1TWHK 1RU0A 4A3LK 2JA5K 1ISEA 2L5NA 1G51A 1C0AA 2BE5A 1Y1VA 3S17C 2VUMK 5JVGS 5M5YK 1VH2A 5JVHS 2NVYA 4BBRK 1SFOK 2RGRA 1TWCA 4LQYA 1WQGA 3S1RC 1XPPA 3GTKA 4A3EC 4J3NA 2GAHC 4IOCS 5TMCA 1WORA 1GE9A 4C3JK 3AH5A 2NVQK 1XZQB 2XCQA 1DD5A 4Y7NC 4BXXK 3S1QC 5IP7K 4KB2A 4C45A 5JFEA 4QIWL 2PHCB 3LAJA 2NVXK 2B63A 4A3DC 4G7HA 5IORA 4DDQA 3RZDC 1WCMC 2A6HA 1IBAA 2CW0A 5IYDK 1YX2A 4KATA 5C44C 4KB4A 4A3LC 2JA5C 3GTOA 1F7VA 3H0GA 4LK0A 3GTLK 3H3VD 2VUMC 3GTQK 4BBRC 1SFOC 4X6AK 2V6UA 4A3FK 4A3GK 3LAPA 2PA8L 5M3MK 4C3JC 4NOIA 2NVQC 4GTLA 3GTGA 3DLLS 5IP7C 4BXXC 3VA7A 2E2HA 4ZH4A 1I6VA 4GTCA 1I50A 3S15K 2NVXC 4OIOA 3FHZA 2R7ZK 3HXAA 3CQZA 3WODA 1VLOA 3GTJK 1WIHA 4LOWA 1DCOA 5IYDC 1F93A 2R92K 1O2BA 3PO2K 3AD8C 4QJVB 4A3MK 2FQTA 3GTLC 1Y1VK 1TWAK 3GTQC 3SZYA 4X6AC 3GEIA 1TWCK 4A3FC 2ZUFA 4A3GC 1HQMA 4YFNA 4P5BA 4PABA 3DXJA 3M4OK 2PMZL 4BY1K 2WAQD 4AH6A 3GSIA 3S15C 1B4AA 3OPFA 1Y1WA 3HOVK 3GTPA 4A3IC 4KMUA 3LYWA 3I4MK 3N3YA 2ZJPS 3HKZD 2R7ZC 1DCPA 4KMHA 1UV7A 3GTJC 4KM8A 1YNJA 3H3VL 4KDDA 1XZPA 2GSOA 2R92C 1TWFK 3PO2C 4A3MC 3GTOK 5JVOA 4OIQA 1Y1VC 1TWAC 4Q5SA 5CJ9A 4A93K 1TWCC 4LLGA 4OINA 5C4XK 5FLMK 4G0WA 4U67S 1WOSA 2GSUA 3IPJA 1BGWA 2JA6A 3M4OC 3S0XA 4BY1C 3S2HK 2W7VA 2E2HK 5HQHA 5IOTA 3T02A 5M5WK 3HOVC 1F7UA 1IQ0A 2ZFZA 3I4MC 4GTFA 4WCES 1I6HK 1V5VA 3AD7C 1USMA 4XSXA 3S1NK 1O25A 1WQFA 3AD9C 5IOQA 2YU9A 1EH1A 1R9TA 2E2IA 4GTBA 1SMYA 2R93A 4G7OA 1TWFC 1VGXA 1K83K 2GSNA 5C4JK 4A3CK 1HI9A 3TFJA 4BBSK 1WQHA 4LR2A 4MEXA 3GTOC 1IE0A 2RH6A 3BUEA 5M5XK 2KQ1A 3ADAC 4A93C 1EK8A 5C4XC 2WAQL 1TWGA 5FLMC 3GTMA 4C2MK 1EQRA 3HKZL 1ZVUA 3S2HC 2E2HC 4XLPA 1YCLA 1F9NA 1O26A 4KMAA 2V6SA 3S1MK 5D4DA 3PIOS 1I6HC 3S16K 4KN7A 3S1NC 2JH3A 1L0WA 3HOUK 4RMFA 5EGHA 4A3IK 3PO3K 1BDFA 5C4JC 1K83C 4A3CC 4A3KK 4BBSC 1TWHA 1J98A 1XZQA 2Y0SD 1J6XA 1VJEA 3S2DK 4AYBD 4JK1A 2KPUA
chains in the Genus database with same CATH topology
3GTGC 4A3IC 4KMUA 5IYCC 1I50C 2BE5A 3I4MK 1I3QK 1Y1WK 3S17C 2VUMK 3HKZD 4LJZA 2A69A 2R7ZC 5M5YK 2E2JK 3GTPK 4YFKA 4BBRK 1SFOK 3GTJC 3S1RC 4C2MC 1XPPA 3HOXK 4A3EC 4MEYA 1YNJA 5TMCA 1TWHC 2JA6K 3CQZC 2A68A 2NVYK 4A3JK 4C3HC 3H3VL 4BY7K 4C3JK 2JA8C 4C3IC 2R92C 1TWFK 3GTKK 3PO2C 2NVQK 4A3MC 2NVTC 3GTOK 4Y7NC 5IP9K 4BXXK 3HOZC 3S1QC 5IP7K 4OIQA 3S1MC 1Y1VC 4QIWL 4MQ9A 1TWAC 2NVXK 3S16C 4Q5SA 3RZOK 4A3DC 3HOYK 4G7HA 3HOUC 1TWCC 2YU9K 4A93K 4LLGA 4OINA 2JA7C 5C4XK 5FLMK 4KN4A 2B63K 3PO3C 3HOWC 2R93K 5IYBK 3RZDC 1WCMC 2A6HA 3FKIC 2WB1L 4A3KC 3EQLA 5M3FK 3M4OC 2O5JA 2CW0A 5IYDK 3S14K 4BY1C 3I4NK 3S2HK 5C44C 3S2DC 2E2HK 3M3YK 5M5WK 3HOVC 2JA5C 4A3LC 4OIPA 3I4MC 4LK0A 1I3QC 1Y1WC 3GTLK 3H3VD 2VUMC 2E2JC 1TWGK 3GTMK 3GTPC 1I6HK 3GTQK 4XSXA 3S1NK 4BBRC 1SFOC 3H0GK 4X6AK 5C3EK 3HOXC 4A3FK 4A3GK 1IW7A 1SMYA 2NVYC 4A3JC 2JA6C 2PA8L 5M3MK 4A3BK 4BY7C 4G7OA 4QIWD 4C3JC 3GTKC 1TWFC 5C4JK 4NOIA 1K83K 1R9TK 2E2IK 2NVQC 4A3CK 3K7AK 4BBSK 4MEXA 4LK1A 3GTOC 4Y52K 5IP9C 4QJVA 5IP7C 4BXXC 4ZH4A 1ZYRA 1I6VA 3S15K 5M5XK 2NVXC 3RZOC 4XLNA 3GTGK 2WB1D 3HOYC 5IYCK 4A93C 1I50K 2YU9C 2Y0SL 2A6EA 3S17K 5C4XC 4OIOA 2WAQL 5FLMC 2R7ZK 2B63C 4AYBL 2R93C 5IYBC 3WODA 3GTJK 3S1RK 4C2MK 4A3EK 5FJ8K 4YG2A 3CQZK 3HKZL 4C3HK 5IYDC 3S14C 2JA8K 3S2HC 3I4NC 2E2HC 3M3YC 4XLPA 4GZYA 4C3IK 2PPBA 2R92K 5TMFA 4A3MK 4QJVB 2NVTK 3PO2K 4Y7NK 3HOZK 3S1QK 3S1MK 5D4DA 3GTLC 1Y1VK 2PA8D 2O5IA 1TWGC 4Q4ZA 3GTMC 1I6HC 3GTQC 1TWAK 3S16K 4KN7A 3S1NC 3H0GC 4OIRA 4X6AC 4A3DK 5C3EC 3HOUK 1TWCK 4A3FC 2JA7K 4G7ZA 1YNNA 1HQMA 4A3GC 4A3IK 4YFNA 4A3BC 3HOWK 3PO3K 4XSZA 3RZDK 4A3LK 1BDFA 1WCMK 3FKIK 1R9TC 5C4JC 1K83C 3DXJA 2E2IC 4A3CC 4A3KK 4BBSC 3K7AC 3M4OK 2PMZL 4Y52C 2Y0SD 4YFXA 4BY1K 2WAQD 5C44K 3S15C 3S2DK 4AYBD 1TWHK 4JK1A 3HOVK 2JA5K 2PMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTG C;  4A3I C;  4KMU A;  5IYC C;  1I50 C;  2BE5 A;  3I4M K;  1I3Q K;  1Y1W K;  3S17 C;  2VUM K;  3HKZ D;  4LJZ A;  2A69 A;  2R7Z C;  5M5Y K;  2E2J K;  3GTP K;  4YFK A;  4BBR K;  1SFO K;  3GTJ C;  3S1R C;  4C2M C;  1XPP A;  3HOX K;  4A3E C;  4MEY A;  1YNJ A;  5TMC A;  1TWH C;  2JA6 K;  3CQZ C;  2A68 A;  2NVY K;  4A3J K;  4C3H C;  3H3V L;  4BY7 K;  4C3J K;  2JA8 C;  4C3I C;  2R92 C;  1TWF K;  3GTK K;  3PO2 C;  2NVQ K;  4A3M C;  2NVT C;  3GTO K;  4Y7N C;  5IP9 K;  4BXX K;  3HOZ C;  3S1Q C;  5IP7 K;  4OIQ A;  3S1M C;  1Y1V C;  4QIW L;  4MQ9 A;  1TWA C;  2NVX K;  3S16 C;  4Q5S A;  3RZO K;  4A3D C;  3HOY K;  4G7H A;  3HOU C;  1TWC C;  2YU9 K;  4A93 K;  4LLG A;  4OIN A;  2JA7 C;  5C4X K;  5FLM K;  4KN4 A;  2B63 K;  3PO3 C;  3HOW C;  2R93 K;  5IYB K;  3RZD C;  1WCM C;  2A6H A;  3FKI C;  2WB1 L;  4A3K C;  3EQL A;  5M3F K;  3M4O C;  2O5J A;  2CW0 A;  5IYD K;  3S14 K;  4BY1 C;  3I4N K;  3S2H K;  5C44 C;  3S2D C;  2E2H K;  3M3Y K;  5M5W K;  3HOV C;  2JA5 C;  4A3L C;  4OIP A;  3I4M C;  4LK0 A;  1I3Q C;  1Y1W C;  3GTL K;  3H3V D;  2VUM C;  2E2J C;  1TWG K;  3GTM K;  3GTP C;  1I6H K;  3GTQ K;  4XSX A;  3S1N K;  4BBR C;  1SFO C;  3H0G K;  4X6A K;  5C3E K;  3HOX C;  4A3F K;  4A3G K;  1IW7 A;  1SMY A;  2NVY C;  4A3J C;  2JA6 C;  2PA8 L;  5M3M K;  4A3B K;  4BY7 C;  4G7O A;  4QIW D;  4C3J C;  3GTK C;  1TWF C;  5C4J K;  4NOI A;  1K83 K;  1R9T K;  2E2I K;  2NVQ C;  4A3C K;  3K7A K;  4BBS K;  4MEX A;  4LK1 A;  3GTO C;  4Y52 K;  5IP9 C;  4QJV A;  5IP7 C;  4BXX C;  4ZH4 A;  1ZYR A;  1I6V A;  3S15 K;  5M5X K;  2NVX C;  3RZO C;  4XLN A;  3GTG K;  2WB1 D;  3HOY C;  5IYC K;  4A93 C;  1I50 K;  2YU9 C;  2Y0S L;  2A6E A;  3S17 K;  5C4X C;  4OIO A;  2WAQ L;  5FLM C;  2R7Z K;  2B63 C;  4AYB L;  2R93 C;  5IYB C;  3WOD A;  3GTJ K;  3S1R K;  4C2M K;  4A3E K;  5FJ8 K;  4YG2 A;  3CQZ K;  3HKZ L;  4C3H K;  5IYD C;  3S14 C;  2JA8 K;  3S2H C;  3I4N C;  2E2H C;  3M3Y C;  4XLP A;  4GZY A;  4C3I K;  2PPB A;  2R92 K;  5TMF A;  4A3M K;  4QJV B;  2NVT K;  3PO2 K;  4Y7N K;  3HOZ K;  3S1Q K;  3S1M K;  5D4D A;  3GTL C;  1Y1V K;  2PA8 D;  2O5I A;  1TWG C;  4Q4Z A;  3GTM C;  1I6H C;  3GTQ C;  1TWA K;  3S16 K;  4KN7 A;  3S1N C;  3H0G C;  4OIR A;  4X6A C;  4A3D K;  5C3E C;  3HOU K;  1TWC K;  4A3F C;  2JA7 K;  4G7Z A;  1YNN A;  1HQM A;  4A3G C;  4A3I K;  4YFN A;  4A3B C;  3HOW K;  3PO3 K;  4XSZ A;  3RZD K;  4A3L K;  1BDF A;  1WCM K;  3FKI K;  1R9T C;  5C4J C;  1K83 C;  3DXJ A;  2E2I C;  4A3C C;  4A3K K;  4BBS C;  3K7A C;  3M4O K;  2PMZ L;  4Y52 C;  2Y0S D;  4YFX A;  4BY1 K;  2WAQ D;  5C44 K;  3S15 C;  3S2D K;  4AYB D;  1TWH K;  4JK1 A;  3HOV K;  2JA5 K;  2PMZ D; 
#chains in the Genus database with same CATH topology
 4KAW X;  2L3U A;  3A8I A;  4BKW A;  4LJZ A;  2E2J K;  4G0V A;  3BP8 C;  2JA7 A;  4C2M C;  4IO9 S;  1AB4 A;  2JA6 K;  2NVY K;  3AQO A;  3FKI A;  1WOP A;  5HL8 A;  3GTK K;  2ZJQ S;  4WJ4 A;  3S1M C;  1FEU A;  3S16 C;  3RZO K;  4G0U A;  4WIL A;  3HOU C;  1I3Q A;  4WFA S;  2YU9 K;  2B63 K;  3PO3 C;  2R93 K;  3Q3Q A;  4BLA A;  5IYB K;  3AQP A;  1O27 A;  3BP3 A;  4A3K C;  3G4A A;  3EQL A;  3GEE A;  3QX3 A;  2O5J A;  1BS2 A;  1X31 C;  3I4N K;  3M3Y K;  3S2D C;  4OIP A;  1XXB A;  2Y3P A;  2P5M A;  1JVI A;  1XXA A;  2E2J C;  1TWG K;  3GTM K;  3H0G K;  4KC6 A;  5C3E K;  4IOA S;  1IW7 A;  2JA6 C;  2NVY C;  1O28 A;  3GTK C;  5L46 A;  4Y52 K;  3NUH A;  2ZJR S;  3L4J A;  4QJV A;  5EGE A;  3RZO C;  4XLN A;  3GTG K;  2WB1 D;  5IYC K;  1J6V A;  1I50 K;  2CFA A;  2YU9 C;  2Y0S L;  3ORE A;  2B63 C;  4AYB L;  4KAR A;  2R93 C;  5IYB C;  3CF5 S;  2R92 A;  5DM7 S;  5FJ8 K;  2EBB A;  3CQZ K;  4C3H K;  4GTA A;  2JA8 K;  3I4N C;  4GZY A;  3M3Y C;  4C3I K;  1PJ5 A;  5TMF A;  5E68 A;  2NVT K;  2FQO A;  1TWA A;  1IS1 A;  3HOZ K;  1O29 A;  3CAG A;  1IL2 A;  2O5I A;  1TWG C;  4Q4Z A;  3GTM C;  2XCO A;  3H0G C;  1DCH A;  5C3E C;  3TFI A;  1VRQ C;  1WSV A;  2JA7 K;  4G7Z A;  2KWA A;  1YNN A;  1JQW A;  3HOW K;  1EFW A;  4XSZ A;  4GT9 A;  4WJ3 M;  3PIP S;  3FKI K;  2P8T A;  3A8K A;  4KM9 A;  4Y52 C;  2ZUE A;  4YFX A;  3GDZ A;  3GIR A;  2PMZ D;  3GTG C;  4KAS A;  5IYC C;  1I50 C;  1I3Q K;  1Y1W K;  2A69 A;  3GTP K;  4YFK A;  4WFN S;  3HOX K;  5IOS A;  1TWF A;  4MEY A;  4GTE A;  1TWH C;  3CQZ C;  2A68 A;  3N0B A;  4A3J K;  4C3H C;  1WCM A;  4BY7 K;  2D6F C;  3FOE A;  2JA8 C;  4C3I C;  1O2A A;  1ZBS A;  5TJ3 A;  2NVT C;  3FOF A;  5IP9 K;  3HOZ C;  3A8J A;  4MQ9 A;  2JA5 A;  5CHP A;  3MML B;  3OEP A;  3HOY K;  1PJ6 A;  2JA7 C;  4KMD A;  3V4G A;  2VUM A;  1J6W A;  4M1X A;  4KN4 A;  3HOW C;  3T01 A;  1SFO A;  3GEH A;  2KXY A;  3FKI C;  2WB1 L;  4ILD A;  1XXC A;  5M3F K;  1XZP B;  3ERE D;  3S14 K;  2V6T A;  2XCR B;  1WOO A;  1O24 A;  1I3Q C;  1Y1W C;  4O2D A;  2NVX A;  3GTP C;  3TFH A;  3HOX C;  1K83 A;  1KQ4 A;  4A3B K;  4A3J C;  4BY7 C;  2GAG C;  3L4K A;  4QIW D;  1R9T K;  2E2I K;  1ZXO A;  3K7A K;  4FZB A;  4LK1 A;  4PAA A;  5IP9 C;  2CFA B;  1ZYR A;  1B4B A;  5DM6 S;  4WFB S;  1O2F B;  3HOY C;  3JST A;  3GTL A;  2A6E A;  3S17 K;  4GFQ A;  3GTQ A;  3S1R K;  1WSR A;  4GTD A;  4A3E K;  4YG2 A;  3S14 C;  1INN A;  1PJ7 A;  3SZZ A;  1BJT A;  2PPB A;  4P9S A;  1JOE A;  3N0C A;  4XCH A;  4Y7N K;  3S1Q K;  4WF9 S;  3LPX A;  2PA8 D;  4BLB A;  1EI6 A;  3T00 A;  4A3D K;  4OIR A;  4P5A A;  2R7Z A;  1ZQ1 C;  4A3B C;  4FM9 A;  3RZD K;  1WCM K;  3GTJ A;  1R9T C;  2E2I C;  3K7A C;  5HL7 S;  1USO A;  3G4C A;  3TTG A;  5C44 K;  1TWH K;  1RU0 A;  4A3L K;  2JA5 K;  1ISE A;  2L5N A;  1G51 A;  1C0A A;  2BE5 A;  1Y1V A;  3S17 C;  2VUM K;  5JVG S;  5M5Y K;  1VH2 A;  5JVH S;  2NVY A;  4BBR K;  1SFO K;  2RGR A;  1TWC A;  4LQY A;  1WQG A;  3S1R C;  1XPP A;  3GTK A;  4A3E C;  4J3N A;  2GAH C;  4IOC S;  5TMC A;  1WOR A;  1GE9 A;  4C3J K;  3AH5 A;  2NVQ K;  1XZQ B;  2XCQ A;  1DD5 A;  4Y7N C;  4BXX K;  3S1Q C;  5IP7 K;  4KB2 A;  4C45 A;  5JFE A;  4QIW L;  2PHC B;  3LAJ A;  2NVX K;  2B63 A;  4A3D C;  4G7H A;  5IOR A;  4DDQ A;  3RZD C;  1WCM C;  2A6H A;  1IBA A;  2CW0 A;  5IYD K;  1YX2 A;  4KAT A;  5C44 C;  4KB4 A;  4A3L C;  2JA5 C;  3GTO A;  1F7V A;  3H0G A;  4LK0 A;  3GTL K;  3H3V D;  2VUM C;  3GTQ K;  4BBR C;  1SFO C;  4X6A K;  2V6U A;  4A3F K;  4A3G K;  3LAP A;  2PA8 L;  5M3M K;  4C3J C;  4NOI A;  2NVQ C;  4GTL A;  3GTG A;  3DLL S;  5IP7 C;  4BXX C;  3VA7 A;  2E2H A;  4ZH4 A;  1I6V A;  4GTC A;  1I50 A;  3S15 K;  2NVX C;  4OIO A;  3FHZ A;  2R7Z K;  3HXA A;  3CQZ A;  3WOD A;  1VLO A;  3GTJ K;  1WIH A;  4LOW A;  1DCO A;  5IYD C;  1F93 A;  2R92 K;  1O2B A;  3PO2 K;  3AD8 C;  4QJV B;  4A3M K;  2FQT A;  3GTL C;  1Y1V K;  1TWA K;  3GTQ C;  3SZY A;  4X6A C;  3GEI A;  1TWC K;  4A3F C;  2ZUF A;  4A3G C;  1HQM A;  4YFN A;  4P5B A;  4PAB A;  3DXJ A;  3M4O K;  2PMZ L;  4BY1 K;  2WAQ D;  4AH6 A;  3GSI A;  3S15 C;  1B4A A;  3OPF A;  1Y1W A;  3HOV K;  3GTP A;  4A3I C;  4KMU A;  3LYW A;  3I4M K;  3N3Y A;  2ZJP S;  3HKZ D;  2R7Z C;  1DCP A;  4KMH A;  1UV7 A;  3GTJ C;  4KM8 A;  1YNJ A;  3H3V L;  4KDD A;  1XZP A;  2GSO A;  2R92 C;  1TWF K;  3PO2 C;  4A3M C;  3GTO K;  5JVO A;  4OIQ A;  1Y1V C;  1TWA C;  4Q5S A;  5CJ9 A;  4A93 K;  1TWC C;  4LLG A;  4OIN A;  5C4X K;  5FLM K;  4G0W A;  4U67 S;  1WOS A;  2GSU A;  3IPJ A;  1BGW A;  2JA6 A;  3M4O C;  3S0X A;  4BY1 C;  3S2H K;  2W7V A;  2E2H K;  5HQH A;  5IOT A;  3T02 A;  5M5W K;  3HOV C;  1F7U A;  1IQ0 A;  2ZFZ A;  3I4M C;  4GTF A;  4WCE S;  1I6H K;  1V5V A;  3AD7 C;  1USM A;  4XSX A;  3S1N K;  1O25 A;  1WQF A;  3AD9 C;  5IOQ A;  2YU9 A;  1EH1 A;  1R9T A;  2E2I A;  4GTB A;  1SMY A;  2R93 A;  4G7O A;  1TWF C;  1VGX A;  1K83 K;  2GSN A;  5C4J K;  4A3C K;  1HI9 A;  3TFJ A;  4BBS K;  1WQH A;  4LR2 A;  4MEX A;  3GTO C;  1IE0 A;  2RH6 A;  3BUE A;  5M5X K;  2KQ1 A;  3ADA C;  4A93 C;  1EK8 A;  5C4X C;  2WAQ L;  1TWG A;  5FLM C;  3GTM A;  4C2M K;  1EQR A;  3HKZ L;  1ZVU A;  3S2H C;  2E2H C;  4XLP A;  1YCL A;  1F9N A;  1O26 A;  4KMA A;  2V6S A;  3S1M K;  5D4D A;  3PIO S;  1I6H C;  3S16 K;  4KN7 A;  3S1N C;  2JH3 A;  1L0W A;  3HOU K;  4RMF A;  5EGH A;  4A3I K;  3PO3 K;  1BDF A;  5C4J C;  1K83 C;  4A3C C;  4A3K K;  4BBS C;  1TWH A;  1J98 A;  1XZQ A;  2Y0S D;  1J6X A;  1VJE A;  3S2D K;  4AYB D;  4JK1 A;  2KPU A; 
#chains in the Genus database with same CATH homology
 3GTG C;  4A3I C;  4KMU A;  5IYC C;  1I50 C;  2BE5 A;  3I4M K;  1I3Q K;  1Y1W K;  3S17 C;  2VUM K;  3HKZ D;  4LJZ A;  2A69 A;  2R7Z C;  5M5Y K;  2E2J K;  3GTP K;  4YFK A;  4BBR K;  1SFO K;  3GTJ C;  3S1R C;  4C2M C;  1XPP A;  3HOX K;  4A3E C;  4MEY A;  1YNJ A;  5TMC A;  1TWH C;  2JA6 K;  3CQZ C;  2A68 A;  2NVY K;  4A3J K;  4C3H C;  3H3V L;  4BY7 K;  4C3J K;  2JA8 C;  4C3I C;  2R92 C;  1TWF K;  3GTK K;  3PO2 C;  2NVQ K;  4A3M C;  2NVT C;  3GTO K;  4Y7N C;  5IP9 K;  4BXX K;  3HOZ C;  3S1Q C;  5IP7 K;  4OIQ A;  3S1M C;  1Y1V C;  4QIW L;  4MQ9 A;  1TWA C;  2NVX K;  3S16 C;  4Q5S A;  3RZO K;  4A3D C;  3HOY K;  4G7H A;  3HOU C;  1TWC C;  2YU9 K;  4A93 K;  4LLG A;  4OIN A;  2JA7 C;  5C4X K;  5FLM K;  4KN4 A;  2B63 K;  3PO3 C;  3HOW C;  2R93 K;  5IYB K;  3RZD C;  1WCM C;  2A6H A;  3FKI C;  2WB1 L;  4A3K C;  3EQL A;  5M3F K;  3M4O C;  2O5J A;  2CW0 A;  5IYD K;  3S14 K;  4BY1 C;  3I4N K;  3S2H K;  5C44 C;  3S2D C;  2E2H K;  3M3Y K;  5M5W K;  3HOV C;  2JA5 C;  4A3L C;  4OIP A;  3I4M C;  4LK0 A;  1I3Q C;  1Y1W C;  3GTL K;  3H3V D;  2VUM C;  2E2J C;  1TWG K;  3GTM K;  3GTP C;  1I6H K;  3GTQ K;  4XSX A;  3S1N K;  4BBR C;  1SFO C;  3H0G K;  4X6A K;  5C3E K;  3HOX C;  4A3F K;  4A3G K;  1IW7 A;  1SMY A;  2NVY C;  4A3J C;  2JA6 C;  2PA8 L;  5M3M K;  4A3B K;  4BY7 C;  4G7O A;  4QIW D;  4C3J C;  3GTK C;  1TWF C;  5C4J K;  4NOI A;  1K83 K;  1R9T K;  2E2I K;  2NVQ C;  4A3C K;  3K7A K;  4BBS K;  4MEX A;  4LK1 A;  3GTO C;  4Y52 K;  5IP9 C;  4QJV A;  5IP7 C;  4BXX C;  4ZH4 A;  1ZYR A;  1I6V A;  3S15 K;  5M5X K;  2NVX C;  3RZO C;  4XLN A;  3GTG K;  2WB1 D;  3HOY C;  5IYC K;  4A93 C;  1I50 K;  2YU9 C;  2Y0S L;  2A6E A;  3S17 K;  5C4X C;  4OIO A;  2WAQ L;  5FLM C;  2R7Z K;  2B63 C;  4AYB L;  2R93 C;  5IYB C;  3WOD A;  3GTJ K;  3S1R K;  4C2M K;  4A3E K;  5FJ8 K;  4YG2 A;  3CQZ K;  3HKZ L;  4C3H K;  5IYD C;  3S14 C;  2JA8 K;  3S2H C;  3I4N C;  2E2H C;  3M3Y C;  4XLP A;  4GZY A;  4C3I K;  2PPB A;  2R92 K;  5TMF A;  4A3M K;  4QJV B;  2NVT K;  3PO2 K;  4Y7N K;  3HOZ K;  3S1Q K;  3S1M K;  5D4D A;  3GTL C;  1Y1V K;  2PA8 D;  2O5I A;  1TWG C;  4Q4Z A;  3GTM C;  1I6H C;  3GTQ C;  1TWA K;  3S16 K;  4KN7 A;  3S1N C;  3H0G C;  4OIR A;  4X6A C;  4A3D K;  5C3E C;  3HOU K;  1TWC K;  4A3F C;  2JA7 K;  4G7Z A;  1YNN A;  1HQM A;  4A3G C;  4A3I K;  4YFN A;  4A3B C;  3HOW K;  3PO3 K;  4XSZ A;  3RZD K;  4A3L K;  1BDF A;  1WCM K;  3FKI K;  1R9T C;  5C4J C;  1K83 C;  3DXJ A;  2E2I C;  4A3C C;  4A3K K;  4BBS C;  3K7A C;  3M4O K;  2PMZ L;  4Y52 C;  2Y0S D;  4YFX A;  4BY1 K;  2WAQ D;  5C44 K;  3S15 C;  3S2D K;  4AYB D;  1TWH K;  4JK1 A;  3HOV K;  2JA5 K;  2PMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...