2O5JA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5jA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5jA01
4YFXA 4A3KK 3HOYC 2YU9K 4AYBD 2R93C 2PMZL 3S1MC 4QJVA 4C2MK 1R9TK 2E2JK 3S17K 5C44K 1HQMA 4A3GC 3GTGC 3HOWK 4C3IK 3FKIC 2NVTK 2R92K 4Y7NC 1YNJA 2VUMC 2Y0SL 3I4MK 4OIPA 2NVYK 4YFNA 4LK1A 5IP7K 3S1QC 1I50C 2E2HK 2WB1L 4QIWL 3S2HC 4C3JK 4A3IK 3S1RK 1TWGC 5TMFA 3GTPK 4A3GK 4ZH4A 4YFKA 2CW0A 4AYBL 4Y7NK 2WAQD 5IP9K 1Y1WK 3HOVK 3HOZC 1IW7A 4X6AK 1SFOC 4A3CK 3H3VD 4MQ9A 4LJZA 4GZYA 4A3MK 4JK1A 4BBSK 4C3JC 1I6HC 4XSZA 4Y52K 3HKZD 2PMZD 3HOUC 4LK0A 4A3BC 3GTQC 2PA8L 3H0GC 4BXXC 4A3DC 5C4JK 3GTKC 3HOZK 3S1NC 3GTMK 1WCMK 4A3KC 5FLMC 3GTJK 2JA7C 4A3MC 5M5XK 2PA8D 3S1MK 2BE5A 3PO3C 2JA5K 2JA8C 4MEXA 4C3IC 4A3EK 3RZOK 2NVTC 3S14K 2WB1D 4QIWD 5IYBC 2JA6C 3H0GK 3I4MC 2NVXK 2VUMK 3PO2K 4C2MC 2E2JC 1I6VA 3I4NC 5C44C 1WCMC 5C3EK 3S15C 5C4XK 3HKZL 3GTJC 1I50K 1TWAK 1K83C 1TWHC 1TWFC 4A3IC 2WAQL 4NOIA 2JA8K 4KMUA 3GTPC 1TWCC 3DXJA 3HOXC 3S16K 1Y1VK 4OINA 2NVXC 2JA6K 5IP9C 3HOVC 5IYDC 3CQZC 1SFOK 1XPPA 4Q4ZA 2A68A 3S17C 1ZYRA 4A3JC 4OIRA 2NVQK 1Y1WC 3S16C 3RZOC 3HOWC 3HOXK 3GTLK 3GTGK 4MEYA 3GTKK 4C3HK 3HOUK 4BY7K 3HOYK 1BDFA 2A6EA 5IYDK 5D4DA 1YNNA 3GTMC 3S1NK 4KN7A 5IP7C 2E2IK 4XLPA 3K7AC 4BBRC 4XLNA 2JA5C 2R92C 1TWGK 4A3EC 3RZDK 3GTOK 2O5JA 2JA7K 3PO2C 4QJVB 3I4NK 3S2HK 4X6AC 1I3QK 2A69A 4A3DK 2R93K 4A3LC 1TWAC 4BBSC 4YG2A 5M3MK 4Y52C 4A3FK 2B63C 3RZDC 3GTOC 2YU9C 4A93K 2NVYC 1I3QC 5M5YK 5FLMK 1TWCK 4A3LK 4OIQA 2E2HC 4A3JK 2O5IA 1SMYA 3FKIK 3M4OK 3WODA 4A3FC 5C4JC 3GTLC 4BY7C 2B63K 4C3HC 3S14C 2R7ZC 4G7OA 4A93C 3S1QK 3S1RC 2NVQC 2Y0SD 5FJ8K 5C3EC 4BXXK 4LLGA 4A3CC 5M3FK 4BY1K 3S2DK 3K7AK 2PPBA 4BBRK 5IYCC 3M3YC 3M4OC 5IYBK 4Q5SA 4G7ZA 4XSXA 4KN4A 4A3BK 2R7ZK 5C4XC 3S15K 2E2IC 1K83K 1TWHK 1R9TC 4OIOA 1TWFK 3CQZK 1I6HK 4G7HA 4BY1C 3S2DC 2A6HA 3PO3K 5IYCK 1Y1VC 3H3VL 5M5WK 3GTQK 3M3YK 3EQLA 5TMCA
chains in the Genus database with same CATH superfamily
1UV7A 1X31C 3FOEA 5JVGS 3V4GA 1G51A 3GTOA 4A3GC 2NVTK 1BGWA 1YNJA 4OIPA 4DDQA 4LK1A 4A3IK 3OPFA 3GTPK 1C0AA 4ZH4A 2CW0A 5EGEA 1O26A 4Y7NK 2WAQD 1Y1WK 3T01A 1IW7A 1SFOC 4MQ9A 4A3MK 4GZYA 4JK1A 4GTLA 4Y52K 3LAJA 1EI6A 2PMZD 3CF5S 4A3BC 1PJ7A 1TWAA 1O29A 3AQOA 3S1NC 2L3UA 4A3KC 1INNA 1O2FB 3GTJK 4WJ3M 2BE5A 2JA5K 5HQHA 4C3IC 1WOSA 2WB1D 5IYBC 2JA6C 4A3DK 2V6TA 2VUMK 3S15C 4GTEA 3GTMA 2GSUA 1TWAK 1TWHC 1F7VA 1TWCC 3DXJA 5DM6S 1Y1VK 4OINA 2NVXC 1V5VA 1TWGA 4KDDA 1VH2A 1JQWA 2E2IA 1DCOA 1XZQB 3S17C 1ZYRA 4A3JC 3N0BA 1Y1WC 4GTAA 3GTGK 3GTLK 3HOUK 3GTLA 1BDFA 5IYDK 3GEEA 3HXAA 1YNNA 3GTMC 3IPJA 4WFNS 5IP7C 2NVYA 1TWGK 2R92A 1Y1VA 1WIHA 3RZDK 3A8IA 3JSTA 3PO2C 4X6AC 3SZYA 4A3LC 2EBBA 1O24A 1EFWA 5M3MK 1VJEA 2B63C 3CAGA 1TWHA 5M5YK 5FLMK 3GTJA 1TWCK 4IOAS 1SMYA 3M4OK 3QX3A 1XZPA 3S14C 2R7ZC 1SFOA 4KM9A 3PIPS 3K7AK 4BBRK 3AQPA 4WFBS 4G7ZA 4XSXA 1DCHA 3N0CA 3GTPA 3CQZK 1R9TC 2VUMA 3H0GA 2XCRB 3RZOK 5TMCA 2YU9K 4KMHA 3HOYC 4A3KK 4P5AA 4G0WA 2PMZL 4QJVA 4C2MK 4C45A 3HOWK 4C3IK 3FKIC 2R92K 2VUMC 1WOOA 4KASA 2V6SA 5CJ9A 2WB1L 3S2HC 4C3JK 1O27A 1O2AA 4GTFA 4A3GK 4BLAA 3GTGA 4GFQA 1J6WA 4BBSK 4U67S 1L0WA 4XSZA 3HKZD 1F7UA 3HOUC 4LK0A 3GDZA 4G0VA 2PA8L 4BXXC 3GTMK 3L4JA 4WCES 1I50A 4A3MC 5M5XK 3S1MK 2NVXA 2JA8C 3AH5A 4LQYA 4MEXA 5IOQA 3PO2K 4C2MC 5C3EK 5C4XK 3GTJC 1TWFC 1I3QA 4KMUA 1WQFA 1JOEA 3ADAC 3TTGA 2KQ1A 2RGRA 3HOVC 1KQ4A 2JA6K 1WSVA 4GTCA 2A68A 4BLBA 2NVQK 1YX2A 3GTKK 3BP3A 5D4DA 1RU0A 3T00A 3PIOS 4KN7A 1F9NA 1O2BA 2GSOA 1YCLA 5IOTA 3K7AC 4BBRC 2FQTA 3TFHA 4A3EC 1VGXA 3GTOK 2O5JA 4QJVB 5JVOA 2A69A 2R93K 3LAPA 4YG2A 4Y52C 4A3FK 3RZDC 2YU9C 4A93K 4FZBA 3L4KA 4J3NA 4KB4A 1K83A 1XXCA 4A3LK 2R7ZA 4PABA 3FKIK 1XXBA 5C4JC 4BY7C 2B63K 4G7OA 2NVQC 5FJ8K 4LLGA 4A3CC 3GIRA 5M3FK 4BY1K 3S2DK 2PPBA 5IYCC 3M3YC 3M4OC 3FOFA 3LYWA 1B4BA 2R7ZK 1K83K 2PHCB 2W7VA 1XXAA 1HI9A 4WJ4A 1DCPA 4G7HA 1VLOA 2P5MA 4WILA 5M5WK 3EQLA 2ZJQS 4YFXA 4GTDA 4AYBD 2R93C 3S1MC 1USOA 5HL8A 1R9TK 4IO9S 5C44K 1IQ0A 4RMFA 1WSRA 4GT9A 1EQRA 3GTQA 3GSIA 4AH6A 3MMLB 5TMFA 5TJ3A 3T02A 4KMAA 4M1XA 2GAHC 3HOVK 2E2HA 1EK8A 3HOZC 1ISEA 4A3CK 3A8JA 1IL2A 4C3JC 2ZUEA 1O25A 5L46A 3GTQC 2KWAA 2Y3PA 3H0GC 1WCMK 2D6FC 2JA7C 2PA8D 2RH6A 2GSNA 4A3EK 1ZXOA 4QIWD 4BXXK 3I4MC 4KC6A 1I6VA 5C44C 1WCMA 3HKZL 1I50K 3AD7C 3G4AA 1WQGA 2JA8K 3HOXC 5JVHS 3S16K 4P9SA 2XCQA 5IP9C 5EGHA 3GEIA 1JVIA 2B63A 1J6VA 4OIRA 3N3YA 3HOWC 4BY7K 4XLPA 1PJ5A 2GAGC 4KM8A 5JFEA 1WORA 2V6UA 2JA7K 3I4NK 3OEPA 1R9TA 1I3QK 2JA7A 1VRQC 3TFIA 2YU9A 4BBSC 1WOPA 1IE0A 4ILDA 5DM7S 3GTOC 2NVYC 4KATA 2ZJRS 4PAAA 2L5NA 2E2HC 1DD5A 4A3FC 5IOSA 4FM9A 2JH3A 4C3HC 4BKWA 5IORA 4A93C 3GEHA 4KB2A 2JA6A 5C3EC 2ZUFA 5IYBK 3FKIA 3S15K 1TWCA 5CHPA 1TWHK 4OIOA 4BY1C 3S2DC 3DLLS 2A6HA 3PO3K 5IYCK 1Y1VC 3AD9C 3GTQK 3M3YK 3GTKC 3ERED 2E2JK 3S17K 1AB4A 1HQMA 3GTGC 4LOWA 1PJ6A 4Y7NC 2Y0SL 3I4MK 1IBAA 2NVYK 4IOCS 1EH1A 4YFNA 1IS1A 5IP7K 3S1QC 1I50C 1XZQA 2E2HK 4QIWL 3S1RK 2ZFZA 1TWGC 4YFKA 4AYBL 3GTKA 1WQHA 5IP9K 4X6AK 2FQOA 3H3VD 4LJZA 1I6HC 1USMA 1GE9A 4XCHA 4A3DC 5C4JK 3HOZK 5FLMC 1FEUA 2CFAA 3PO3C 1ZQ1C 3NUHA 3LPXA 1BJTA 2NVTC 5HL7S 3S14K 3S0XA 2NVXK 3H0GK 4G0UA 2E2JC 3I4NC 1WCMC 3AD8C 1F93A 2R93A 1K83C 2WAQL 4A3IC 4NOIA 3GTPC 1XZPB 1ZVUA 3Q3QA 5IYDC 2ZJPS 3CQZC 1B4AA 1SFOK 1XPPA 4WF9S 4Q4ZA 3VA7A 3S16C 3RZOC 3HOXK 4MEYA 4C3HK 3HOYK 2A6EA 3S1NK 4KARA 2KXYA 2E2IK 4XLNA 2JA5C 2R92C 3A8KA 4LR2A 1J6XA 3G4CA 1O28A 4WFAS 3OREA 4KMDA 3S2HK 3SZZA 1TWAC 4P5BA 2KPUA 3BUEA 3BP8C 4O2DA 3CQZA 4GTBA 2JA5A 1BS2A 3TFJA 1I3QC 1TWFA 5E68A 4OIQA 4A3JK 2O5IA 3WODA 3GTLC 3FHZA 3S1QK 3S1RC 2Y0SD 1ZBSA 4Q5SA 4KAWX 1Y1WA 4KN4A 4A3BK 5C4XC 2E2IC 1TWFK 2CFAB 1I6HK 1J98A 2XCOA 2P8TA 3H3VL
chains in the Genus database with same CATH topology
4YFXA 4A3KK 3HOYC 2YU9K 4AYBD 2R93C 2PMZL 3S1MC 4QJVA 4C2MK 1R9TK 2E2JK 3S17K 5C44K 1HQMA 4A3GC 3GTGC 3HOWK 4C3IK 3FKIC 2NVTK 2R92K 4Y7NC 1YNJA 2VUMC 2Y0SL 3I4MK 4OIPA 2NVYK 4YFNA 4LK1A 5IP7K 3S1QC 1I50C 2E2HK 2WB1L 4QIWL 3S2HC 4C3JK 4A3IK 3S1RK 1TWGC 5TMFA 3GTPK 4A3GK 4ZH4A 4YFKA 2CW0A 4AYBL 4Y7NK 2WAQD 5IP9K 1Y1WK 3HOVK 3HOZC 1IW7A 4X6AK 1SFOC 4A3CK 3H3VD 4MQ9A 4LJZA 4GZYA 4A3MK 4JK1A 4BBSK 4C3JC 1I6HC 4XSZA 4Y52K 3HKZD 2PMZD 3HOUC 4LK0A 4A3BC 3GTQC 2PA8L 3H0GC 4BXXC 4A3DC 5C4JK 3GTKC 3HOZK 3S1NC 3GTMK 1WCMK 4A3KC 5FLMC 3GTJK 2JA7C 4A3MC 5M5XK 2PA8D 3S1MK 2BE5A 3PO3C 2JA5K 2JA8C 4MEXA 4C3IC 4A3EK 3RZOK 2NVTC 3S14K 2WB1D 4QIWD 5IYBC 2JA6C 3H0GK 3I4MC 2NVXK 2VUMK 3PO2K 4C2MC 2E2JC 1I6VA 3I4NC 5C44C 1WCMC 5C3EK 3S15C 5C4XK 3HKZL 3GTJC 1I50K 1TWAK 1K83C 1TWHC 1TWFC 4A3IC 2WAQL 4NOIA 2JA8K 4KMUA 3GTPC 1TWCC 3DXJA 3HOXC 3S16K 1Y1VK 4OINA 2NVXC 2JA6K 5IP9C 3HOVC 5IYDC 3CQZC 1SFOK 1XPPA 4Q4ZA 2A68A 3S17C 1ZYRA 4A3JC 4OIRA 2NVQK 1Y1WC 3S16C 3RZOC 3HOWC 3HOXK 3GTLK 3GTGK 4MEYA 3GTKK 4C3HK 3HOUK 4BY7K 3HOYK 1BDFA 2A6EA 5IYDK 5D4DA 1YNNA 3GTMC 3S1NK 4KN7A 5IP7C 2E2IK 4XLPA 3K7AC 4BBRC 4XLNA 2JA5C 2R92C 1TWGK 4A3EC 3RZDK 3GTOK 2O5JA 2JA7K 3PO2C 4QJVB 3I4NK 3S2HK 4X6AC 1I3QK 2A69A 4A3DK 2R93K 4A3LC 1TWAC 4BBSC 4YG2A 5M3MK 4Y52C 4A3FK 2B63C 3RZDC 3GTOC 2YU9C 4A93K 2NVYC 1I3QC 5M5YK 5FLMK 1TWCK 4A3LK 4OIQA 2E2HC 4A3JK 2O5IA 1SMYA 3FKIK 3M4OK 3WODA 4A3FC 5C4JC 3GTLC 4BY7C 2B63K 4C3HC 3S14C 2R7ZC 4G7OA 4A93C 3S1QK 3S1RC 2NVQC 2Y0SD 5FJ8K 5C3EC 4BXXK 4LLGA 4A3CC 5M3FK 4BY1K 3S2DK 3K7AK 2PPBA 4BBRK 5IYCC 3M3YC 3M4OC 5IYBK 4Q5SA 4G7ZA 4XSXA 4KN4A 4A3BK 2R7ZK 5C4XC 3S15K 2E2IC 1K83K 1TWHK 1R9TC 4OIOA 1TWFK 3CQZK 1I6HK 4G7HA 4BY1C 3S2DC 2A6HA 3PO3K 5IYCK 1Y1VC 3H3VL 5M5WK 3GTQK 3M3YK 3EQLA 5TMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX A;  4A3K K;  3HOY C;  2YU9 K;  4AYB D;  2R93 C;  2PMZ L;  3S1M C;  4QJV A;  4C2M K;  1R9T K;  2E2J K;  3S17 K;  5C44 K;  1HQM A;  4A3G C;  3GTG C;  3HOW K;  4C3I K;  3FKI C;  2NVT K;  2R92 K;  4Y7N C;  1YNJ A;  2VUM C;  2Y0S L;  3I4M K;  4OIP A;  2NVY K;  4YFN A;  4LK1 A;  5IP7 K;  3S1Q C;  1I50 C;  2E2H K;  2WB1 L;  4QIW L;  3S2H C;  4C3J K;  4A3I K;  3S1R K;  1TWG C;  5TMF A;  3GTP K;  4A3G K;  4ZH4 A;  4YFK A;  2CW0 A;  4AYB L;  4Y7N K;  2WAQ D;  5IP9 K;  1Y1W K;  3HOV K;  3HOZ C;  1IW7 A;  4X6A K;  1SFO C;  4A3C K;  3H3V D;  4MQ9 A;  4LJZ A;  4GZY A;  4A3M K;  4JK1 A;  4BBS K;  4C3J C;  1I6H C;  4XSZ A;  4Y52 K;  3HKZ D;  2PMZ D;  3HOU C;  4LK0 A;  4A3B C;  3GTQ C;  2PA8 L;  3H0G C;  4BXX C;  4A3D C;  5C4J K;  3GTK C;  3HOZ K;  3S1N C;  3GTM K;  1WCM K;  4A3K C;  5FLM C;  3GTJ K;  2JA7 C;  4A3M C;  5M5X K;  2PA8 D;  3S1M K;  2BE5 A;  3PO3 C;  2JA5 K;  2JA8 C;  4MEX A;  4C3I C;  4A3E K;  3RZO K;  2NVT C;  3S14 K;  2WB1 D;  4QIW D;  5IYB C;  2JA6 C;  3H0G K;  3I4M C;  2NVX K;  2VUM K;  3PO2 K;  4C2M C;  2E2J C;  1I6V A;  3I4N C;  5C44 C;  1WCM C;  5C3E K;  3S15 C;  5C4X K;  3HKZ L;  3GTJ C;  1I50 K;  1TWA K;  1K83 C;  1TWH C;  1TWF C;  4A3I C;  2WAQ L;  4NOI A;  2JA8 K;  4KMU A;  3GTP C;  1TWC C;  3DXJ A;  3HOX C;  3S16 K;  1Y1V K;  4OIN A;  2NVX C;  2JA6 K;  5IP9 C;  3HOV C;  5IYD C;  3CQZ C;  1SFO K;  1XPP A;  4Q4Z A;  2A68 A;  3S17 C;  1ZYR A;  4A3J C;  4OIR A;  2NVQ K;  1Y1W C;  3S16 C;  3RZO C;  3HOW C;  3HOX K;  3GTL K;  3GTG K;  4MEY A;  3GTK K;  4C3H K;  3HOU K;  4BY7 K;  3HOY K;  1BDF A;  2A6E A;  5IYD K;  5D4D A;  1YNN A;  3GTM C;  3S1N K;  4KN7 A;  5IP7 C;  2E2I K;  4XLP A;  3K7A C;  4BBR C;  4XLN A;  2JA5 C;  2R92 C;  1TWG K;  4A3E C;  3RZD K;  3GTO K;  2O5J A;  2JA7 K;  3PO2 C;  4QJV B;  3I4N K;  3S2H K;  4X6A C;  1I3Q K;  2A69 A;  4A3D K;  2R93 K;  4A3L C;  1TWA C;  4BBS C;  4YG2 A;  5M3M K;  4Y52 C;  4A3F K;  2B63 C;  3RZD C;  3GTO C;  2YU9 C;  4A93 K;  2NVY C;  1I3Q C;  5M5Y K;  5FLM K;  1TWC K;  4A3L K;  4OIQ A;  2E2H C;  4A3J K;  2O5I A;  1SMY A;  3FKI K;  3M4O K;  3WOD A;  4A3F C;  5C4J C;  3GTL C;  4BY7 C;  2B63 K;  4C3H C;  3S14 C;  2R7Z C;  4G7O A;  4A93 C;  3S1Q K;  3S1R C;  2NVQ C;  2Y0S D;  5FJ8 K;  5C3E C;  4BXX K;  4LLG A;  4A3C C;  5M3F K;  4BY1 K;  3S2D K;  3K7A K;  2PPB A;  4BBR K;  5IYC C;  3M3Y C;  3M4O C;  5IYB K;  4Q5S A;  4G7Z A;  4XSX A;  4KN4 A;  4A3B K;  2R7Z K;  5C4X C;  3S15 K;  2E2I C;  1K83 K;  1TWH K;  1R9T C;  4OIO A;  1TWF K;  3CQZ K;  1I6H K;  4G7H A;  4BY1 C;  3S2D C;  2A6H A;  3PO3 K;  5IYC K;  1Y1V C;  3H3V L;  5M5W K;  3GTQ K;  3M3Y K;  3EQL A;  5TMC A; 
#chains in the Genus database with same CATH topology
 1UV7 A;  1X31 C;  3FOE A;  5JVG S;  3V4G A;  1G51 A;  3GTO A;  4A3G C;  2NVT K;  1BGW A;  1YNJ A;  4OIP A;  4DDQ A;  4LK1 A;  4A3I K;  3OPF A;  3GTP K;  1C0A A;  4ZH4 A;  2CW0 A;  5EGE A;  1O26 A;  4Y7N K;  2WAQ D;  1Y1W K;  3T01 A;  1IW7 A;  1SFO C;  4MQ9 A;  4A3M K;  4GZY A;  4JK1 A;  4GTL A;  4Y52 K;  3LAJ A;  1EI6 A;  2PMZ D;  3CF5 S;  4A3B C;  1PJ7 A;  1TWA A;  1O29 A;  3AQO A;  3S1N C;  2L3U A;  4A3K C;  1INN A;  1O2F B;  3GTJ K;  4WJ3 M;  2BE5 A;  2JA5 K;  5HQH A;  4C3I C;  1WOS A;  2WB1 D;  5IYB C;  2JA6 C;  4A3D K;  2V6T A;  2VUM K;  3S15 C;  4GTE A;  3GTM A;  2GSU A;  1TWA K;  1TWH C;  1F7V A;  1TWC C;  3DXJ A;  5DM6 S;  1Y1V K;  4OIN A;  2NVX C;  1V5V A;  1TWG A;  4KDD A;  1VH2 A;  1JQW A;  2E2I A;  1DCO A;  1XZQ B;  3S17 C;  1ZYR A;  4A3J C;  3N0B A;  1Y1W C;  4GTA A;  3GTG K;  3GTL K;  3HOU K;  3GTL A;  1BDF A;  5IYD K;  3GEE A;  3HXA A;  1YNN A;  3GTM C;  3IPJ A;  4WFN S;  5IP7 C;  2NVY A;  1TWG K;  2R92 A;  1Y1V A;  1WIH A;  3RZD K;  3A8I A;  3JST A;  3PO2 C;  4X6A C;  3SZY A;  4A3L C;  2EBB A;  1O24 A;  1EFW A;  5M3M K;  1VJE A;  2B63 C;  3CAG A;  1TWH A;  5M5Y K;  5FLM K;  3GTJ A;  1TWC K;  4IOA S;  1SMY A;  3M4O K;  3QX3 A;  1XZP A;  3S14 C;  2R7Z C;  1SFO A;  4KM9 A;  3PIP S;  3K7A K;  4BBR K;  3AQP A;  4WFB S;  4G7Z A;  4XSX A;  1DCH A;  3N0C A;  3GTP A;  3CQZ K;  1R9T C;  2VUM A;  3H0G A;  2XCR B;  3RZO K;  5TMC A;  2YU9 K;  4KMH A;  3HOY C;  4A3K K;  4P5A A;  4G0W A;  2PMZ L;  4QJV A;  4C2M K;  4C45 A;  3HOW K;  4C3I K;  3FKI C;  2R92 K;  2VUM C;  1WOO A;  4KAS A;  2V6S A;  5CJ9 A;  2WB1 L;  3S2H C;  4C3J K;  1O27 A;  1O2A A;  4GTF A;  4A3G K;  4BLA A;  3GTG A;  4GFQ A;  1J6W A;  4BBS K;  4U67 S;  1L0W A;  4XSZ A;  3HKZ D;  1F7U A;  3HOU C;  4LK0 A;  3GDZ A;  4G0V A;  2PA8 L;  4BXX C;  3GTM K;  3L4J A;  4WCE S;  1I50 A;  4A3M C;  5M5X K;  3S1M K;  2NVX A;  2JA8 C;  3AH5 A;  4LQY A;  4MEX A;  5IOQ A;  3PO2 K;  4C2M C;  5C3E K;  5C4X K;  3GTJ C;  1TWF C;  1I3Q A;  4KMU A;  1WQF A;  1JOE A;  3ADA C;  3TTG A;  2KQ1 A;  2RGR A;  3HOV C;  1KQ4 A;  2JA6 K;  1WSV A;  4GTC A;  2A68 A;  4BLB A;  2NVQ K;  1YX2 A;  3GTK K;  3BP3 A;  5D4D A;  1RU0 A;  3T00 A;  3PIO S;  4KN7 A;  1F9N A;  1O2B A;  2GSO A;  1YCL A;  5IOT A;  3K7A C;  4BBR C;  2FQT A;  3TFH A;  4A3E C;  1VGX A;  3GTO K;  2O5J A;  4QJV B;  5JVO A;  2A69 A;  2R93 K;  3LAP A;  4YG2 A;  4Y52 C;  4A3F K;  3RZD C;  2YU9 C;  4A93 K;  4FZB A;  3L4K A;  4J3N A;  4KB4 A;  1K83 A;  1XXC A;  4A3L K;  2R7Z A;  4PAB A;  3FKI K;  1XXB A;  5C4J C;  4BY7 C;  2B63 K;  4G7O A;  2NVQ C;  5FJ8 K;  4LLG A;  4A3C C;  3GIR A;  5M3F K;  4BY1 K;  3S2D K;  2PPB A;  5IYC C;  3M3Y C;  3M4O C;  3FOF A;  3LYW A;  1B4B A;  2R7Z K;  1K83 K;  2PHC B;  2W7V A;  1XXA A;  1HI9 A;  4WJ4 A;  1DCP A;  4G7H A;  1VLO A;  2P5M A;  4WIL A;  5M5W K;  3EQL A;  2ZJQ S;  4YFX A;  4GTD A;  4AYB D;  2R93 C;  3S1M C;  1USO A;  5HL8 A;  1R9T K;  4IO9 S;  5C44 K;  1IQ0 A;  4RMF A;  1WSR A;  4GT9 A;  1EQR A;  3GTQ A;  3GSI A;  4AH6 A;  3MML B;  5TMF A;  5TJ3 A;  3T02 A;  4KMA A;  4M1X A;  2GAH C;  3HOV K;  2E2H A;  1EK8 A;  3HOZ C;  1ISE A;  4A3C K;  3A8J A;  1IL2 A;  4C3J C;  2ZUE A;  1O25 A;  5L46 A;  3GTQ C;  2KWA A;  2Y3P A;  3H0G C;  1WCM K;  2D6F C;  2JA7 C;  2PA8 D;  2RH6 A;  2GSN A;  4A3E K;  1ZXO A;  4QIW D;  4BXX K;  3I4M C;  4KC6 A;  1I6V A;  5C44 C;  1WCM A;  3HKZ L;  1I50 K;  3AD7 C;  3G4A A;  1WQG A;  2JA8 K;  3HOX C;  5JVH S;  3S16 K;  4P9S A;  2XCQ A;  5IP9 C;  5EGH A;  3GEI A;  1JVI A;  2B63 A;  1J6V A;  4OIR A;  3N3Y A;  3HOW C;  4BY7 K;  4XLP A;  1PJ5 A;  2GAG C;  4KM8 A;  5JFE A;  1WOR A;  2V6U A;  2JA7 K;  3I4N K;  3OEP A;  1R9T A;  1I3Q K;  2JA7 A;  1VRQ C;  3TFI A;  2YU9 A;  4BBS C;  1WOP A;  1IE0 A;  4ILD A;  5DM7 S;  3GTO C;  2NVY C;  4KAT A;  2ZJR S;  4PAA A;  2L5N A;  2E2H C;  1DD5 A;  4A3F C;  5IOS A;  4FM9 A;  2JH3 A;  4C3H C;  4BKW A;  5IOR A;  4A93 C;  3GEH A;  4KB2 A;  2JA6 A;  5C3E C;  2ZUF A;  5IYB K;  3FKI A;  3S15 K;  1TWC A;  5CHP A;  1TWH K;  4OIO A;  4BY1 C;  3S2D C;  3DLL S;  2A6H A;  3PO3 K;  5IYC K;  1Y1V C;  3AD9 C;  3GTQ K;  3M3Y K;  3GTK C;  3ERE D;  2E2J K;  3S17 K;  1AB4 A;  1HQM A;  3GTG C;  4LOW A;  1PJ6 A;  4Y7N C;  2Y0S L;  3I4M K;  1IBA A;  2NVY K;  4IOC S;  1EH1 A;  4YFN A;  1IS1 A;  5IP7 K;  3S1Q C;  1I50 C;  1XZQ A;  2E2H K;  4QIW L;  3S1R K;  2ZFZ A;  1TWG C;  4YFK A;  4AYB L;  3GTK A;  1WQH A;  5IP9 K;  4X6A K;  2FQO A;  3H3V D;  4LJZ A;  1I6H C;  1USM A;  1GE9 A;  4XCH A;  4A3D C;  5C4J K;  3HOZ K;  5FLM C;  1FEU A;  2CFA A;  3PO3 C;  1ZQ1 C;  3NUH A;  3LPX A;  1BJT A;  2NVT C;  5HL7 S;  3S14 K;  3S0X A;  2NVX K;  3H0G K;  4G0U A;  2E2J C;  3I4N C;  1WCM C;  3AD8 C;  1F93 A;  2R93 A;  1K83 C;  2WAQ L;  4A3I C;  4NOI A;  3GTP C;  1XZP B;  1ZVU A;  3Q3Q A;  5IYD C;  2ZJP S;  3CQZ C;  1B4A A;  1SFO K;  1XPP A;  4WF9 S;  4Q4Z A;  3VA7 A;  3S16 C;  3RZO C;  3HOX K;  4MEY A;  4C3H K;  3HOY K;  2A6E A;  3S1N K;  4KAR A;  2KXY A;  2E2I K;  4XLN A;  2JA5 C;  2R92 C;  3A8K A;  4LR2 A;  1J6X A;  3G4C A;  1O28 A;  4WFA S;  3ORE A;  4KMD A;  3S2H K;  3SZZ A;  1TWA C;  4P5B A;  2KPU A;  3BUE A;  3BP8 C;  4O2D A;  3CQZ A;  4GTB A;  2JA5 A;  1BS2 A;  3TFJ A;  1I3Q C;  1TWF A;  5E68 A;  4OIQ A;  4A3J K;  2O5I A;  3WOD A;  3GTL C;  3FHZ A;  3S1Q K;  3S1R C;  2Y0S D;  1ZBS A;  4Q5S A;  4KAW X;  1Y1W A;  4KN4 A;  4A3B K;  5C4X C;  2E2I C;  1TWF K;  2CFA B;  1I6H K;  1J98 A;  2XCO A;  2P8T A;  3H3V L; 
#chains in the Genus database with same CATH homology
 4YFX A;  4A3K K;  3HOY C;  2YU9 K;  4AYB D;  2R93 C;  2PMZ L;  3S1M C;  4QJV A;  4C2M K;  1R9T K;  2E2J K;  3S17 K;  5C44 K;  1HQM A;  4A3G C;  3GTG C;  3HOW K;  4C3I K;  3FKI C;  2NVT K;  2R92 K;  4Y7N C;  1YNJ A;  2VUM C;  2Y0S L;  3I4M K;  4OIP A;  2NVY K;  4YFN A;  4LK1 A;  5IP7 K;  3S1Q C;  1I50 C;  2E2H K;  2WB1 L;  4QIW L;  3S2H C;  4C3J K;  4A3I K;  3S1R K;  1TWG C;  5TMF A;  3GTP K;  4A3G K;  4ZH4 A;  4YFK A;  2CW0 A;  4AYB L;  4Y7N K;  2WAQ D;  5IP9 K;  1Y1W K;  3HOV K;  3HOZ C;  1IW7 A;  4X6A K;  1SFO C;  4A3C K;  3H3V D;  4MQ9 A;  4LJZ A;  4GZY A;  4A3M K;  4JK1 A;  4BBS K;  4C3J C;  1I6H C;  4XSZ A;  4Y52 K;  3HKZ D;  2PMZ D;  3HOU C;  4LK0 A;  4A3B C;  3GTQ C;  2PA8 L;  3H0G C;  4BXX C;  4A3D C;  5C4J K;  3GTK C;  3HOZ K;  3S1N C;  3GTM K;  1WCM K;  4A3K C;  5FLM C;  3GTJ K;  2JA7 C;  4A3M C;  5M5X K;  2PA8 D;  3S1M K;  2BE5 A;  3PO3 C;  2JA5 K;  2JA8 C;  4MEX A;  4C3I C;  4A3E K;  3RZO K;  2NVT C;  3S14 K;  2WB1 D;  4QIW D;  5IYB C;  2JA6 C;  3H0G K;  3I4M C;  2NVX K;  2VUM K;  3PO2 K;  4C2M C;  2E2J C;  1I6V A;  3I4N C;  5C44 C;  1WCM C;  5C3E K;  3S15 C;  5C4X K;  3HKZ L;  3GTJ C;  1I50 K;  1TWA K;  1K83 C;  1TWH C;  1TWF C;  4A3I C;  2WAQ L;  4NOI A;  2JA8 K;  4KMU A;  3GTP C;  1TWC C;  3DXJ A;  3HOX C;  3S16 K;  1Y1V K;  4OIN A;  2NVX C;  2JA6 K;  5IP9 C;  3HOV C;  5IYD C;  3CQZ C;  1SFO K;  1XPP A;  4Q4Z A;  2A68 A;  3S17 C;  1ZYR A;  4A3J C;  4OIR A;  2NVQ K;  1Y1W C;  3S16 C;  3RZO C;  3HOW C;  3HOX K;  3GTL K;  3GTG K;  4MEY A;  3GTK K;  4C3H K;  3HOU K;  4BY7 K;  3HOY K;  1BDF A;  2A6E A;  5IYD K;  5D4D A;  1YNN A;  3GTM C;  3S1N K;  4KN7 A;  5IP7 C;  2E2I K;  4XLP A;  3K7A C;  4BBR C;  4XLN A;  2JA5 C;  2R92 C;  1TWG K;  4A3E C;  3RZD K;  3GTO K;  2O5J A;  2JA7 K;  3PO2 C;  4QJV B;  3I4N K;  3S2H K;  4X6A C;  1I3Q K;  2A69 A;  4A3D K;  2R93 K;  4A3L C;  1TWA C;  4BBS C;  4YG2 A;  5M3M K;  4Y52 C;  4A3F K;  2B63 C;  3RZD C;  3GTO C;  2YU9 C;  4A93 K;  2NVY C;  1I3Q C;  5M5Y K;  5FLM K;  1TWC K;  4A3L K;  4OIQ A;  2E2H C;  4A3J K;  2O5I A;  1SMY A;  3FKI K;  3M4O K;  3WOD A;  4A3F C;  5C4J C;  3GTL C;  4BY7 C;  2B63 K;  4C3H C;  3S14 C;  2R7Z C;  4G7O A;  4A93 C;  3S1Q K;  3S1R C;  2NVQ C;  2Y0S D;  5FJ8 K;  5C3E C;  4BXX K;  4LLG A;  4A3C C;  5M3F K;  4BY1 K;  3S2D K;  3K7A K;  2PPB A;  4BBR K;  5IYC C;  3M3Y C;  3M4O C;  5IYB K;  4Q5S A;  4G7Z A;  4XSX A;  4KN4 A;  4A3B K;  2R7Z K;  5C4X C;  3S15 K;  2E2I C;  1K83 K;  1TWH K;  1R9T C;  4OIO A;  1TWF K;  3CQZ K;  1I6H K;  4G7H A;  4BY1 C;  3S2D C;  2A6H A;  3PO3 K;  5IYC K;  1Y1V C;  3H3V L;  5M5W K;  3GTQ K;  3M3Y K;  3EQL A;  5TMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...