2O5JA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5jA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5jA01
2CW0A 2JA7C 5IYDK 5IYCC 1I6VA 4OIOA 4XSXA 1SFOC 4YFNA 3DXJA 4C3IC 4BY7C 4A3MK 2JA6K 3I4NK 1HQMA 3S1NC 2NVXK 3HOVC 3GTQC 2WB1D 5C4JC 5M3MK 3S1MK 3RZDC 2R93K 1YNNA 2A68A 3S1QC 2B63K 4A3KK 4BY1C 1I3QK 4JK1A 1TWGC 4LLGA 4XSZA 3PO3C 2WAQL 3HOUK 3FKIK 4BBSK 4A3FC 5IP7K 4X6AK 3HOZK 3M3YK 3S1RK 3S2DK 3HOYK 5C44C 3HOXC 3S16K 4A3LK 3S14K 3H3VL 4LK0A 5IYBK 2E2JC 4KN4A 2NVTK 1SMYA 4OINA 2NVQC 2R7ZC 3GTLC 3GTMC 4A3GC 4Y7NC 4AYBL 2BE5A 3S2HC 4A3DC 5C4XC 5D4DA 2JA7K 1ZYRA 3CQZK 3HKZD 3GTKC 4C3IK 5M3FK 2Y0SD 1K83K 5TMCA 4C3JK 3S1NK 4ZH4A 3GTQK 5C4JK 3RZDK 2E2HK 1I50C 2A6HA 5FLMC 4XLNA 4QJVB 4Y52C 1TWGK 3PO3K 2JA8C 4G7ZA 2NVYK 3S15C 2E2IC 4OIPA 1R9TC 4QIWL 2JA5C 2YU9K 2O5JA 5C44K 5FJ8K 3HOXK 3HOWC 4NOIA 3I4MC 4MQ9A 2E2JK 2NVQK 5TMFA 3GTOK 5M5XK 2R7ZK 3GTLK 3GTGK 3GTMK 3K7AC 2PA8D 4GZYA 4MEYA 3WODA 3S2HK 4A3DK 2PMZD 3PO2K 3RZOC 3M4OC 4A3CC 3H0GC 5IYCK 1TWFC 1YNJA 1SFOK 4BY7K 5C3EC 3GTJC 2VUMC 3GTPC 4A3MC 4G7OA 4OIRA 3HOVK 5M5YK 4YFKA 2WB1L 4C2MC 1Y1WC 2R93C 5FLMK 4Y52K 1TWAC 2R92C 3S1QK 1TWHC 4A3JC 2B63C 4BY1K 2JA8K 3S15K 2WAQD 1R9TK 4A93C 4A3EC 4BBSC 4A3FK 2O5IA 1I6HC 3HOWK 3HOZC 1Y1VC 3S1RC 3I4MK 3S17C 3S16C 3H3VD 4LK1A 4Q5SA 1IW7A 4XLPA 3K7AK 2PA8L 1TWCC 3S2DC 5M5WK 5IP9C 4BBRC 4A3IC 4G7HA 1WCMC 5C4XK 4Y7NK 4A3GK 3RZOK 1BDFA 4A3BC 4BXXC 3M4OK 4A3CK 4C3HC 3CQZC 3H0GK 1TWFK 3HKZL 3GTKK 4QJVA 5C3EK 3GTJK 2VUMK 5IYDC 3GTPK 1K83C 2A6EA 4C3JC 4Q4ZA 2Y0SL 2JA6C 3I4NC 4C2MK 1Y1WK 2NVXC 3S1MC 1TWAK 1TWHK 2E2HC 1I50K 4A3JK 2R92K 4YFXA 4KMUA 4A3KC 4A93K 2NVYC 4A3EK 1I3QC 4QIWD 2E2IK 1I6HK 3HOUC 3FKIC 1Y1VK 2YU9C 4OIQA 2JA5K 4LJZA 5IP7C 3S17K 4X6AC 3M3YC 4MEXA 3HOYC 4A3LC 3GTOC 3S14C 5IYBC 3GTGC 2A69A 2PPBA 2NVTC 1TWCK 5IP9K 4KN7A 3EQLA 1WCMK 4BBRK 4A3IK 3PO2C 4AYBD 1XPPA 4YG2A 2PMZL 4C3HK 4A3BK 4BXXK
chains in the Genus database with same CATH superfamily
2CW0A 2KQ1A 3HXAA 5IYCC 1SFOC 1JOEA 4BY7C 2R93A 3GTQC 2WB1D 2B63A 4O2DA 2R93K 1XXCA 5JVOA 2B63K 4JK1A 4XSZA 3GDZA 3FKIK 4A3FC 5IP7K 3M3YK 3HOYK 5C44C 2CFAB 4LQYA 4KN4A 2L3UA 2NVQC 2PHCB 2R7ZC 1J98A 4Y7NC 3GEIA 3S2HC 3CQZA 1O2BA 3AQPA 3CQZK 2GAHC 3OEPA 1K83A 3GTKC 3GTQA 1K83K 5TMCA 3JSTA 4GTBA 4C3JK 4ZH4A 4WFBS 3GTQK 2NVYA 5FLMC 4PABA 4Y52C 1C0AA 2NVYK 2GSOA 2YU9A 4OIPA 1FEUA 1R9TC 2YU9K 5C44K 2R7ZA 3I4MC 4MQ9A 5TJ3A 2NVQK 1O25A 1O29A 2R7ZK 1INNA 2PA8D 1X31C 4MEYA 3S2HK 1VJEA 4GFQA 1IQ0A 2FQTA 5IOSA 3FOEA 1EK8A 2VUMC 3NUHA 4G7OA 3HOVK 5M5YK 4C2MC 5FLMK 1WOPA 4Y52K 4KDDA 1VH2A 1WQFA 1R9TA 1IL2A 1R9TK 4BBSC 1Y1VC 3I4MK 3FOFA 1HI9A 2PA8L 5JVHS 4A3GK 5IP9C 4A3IC 4G7HA 4WILA 5C4XK 5CJ9A 4A3BC 2VUMA 4C3HC 3GSIA 4QJVA 2VUMK 2JA6C 3I4NC 1I50A 4C2MK 3S1MC 2E2HC 1I50K 3OPFA 1Y1VA 2JA5A 4M1XA 4IOCS 4QIWD 1WIHA 1Y1VK 2JA5K 4OIQA 1XZPA 1EQRA 4MEXA 2ZUFA 3S14C 3A8JA 5IP9K 4A3IK 4G0VA 4AYBD 4A3BK 4C3HK 2JA6A 5JFEA 1I6VA 2ZJQS 4XSXA 2JA6K 4A3MK 3I4NK 1HQMA 4P5BA 3S1NC 3G4CA 3T00A 3S1MK 5C4JC 2RH6A 1F7VA 2A68A 3S1QC 4AH6A 4BY1C 4LLGA 1EH1A 2W7VA 2WAQL 2ZFZA 3DLLS 1F7UA 2EBBA 4GTAA 1UV7A 3S16K 3S14K 4BLBA 1VRQC 4AYBL 1ZVUA 2BE5A 4A3DC 1WOOA 5D4DA 1WOSA 1J6WA 3S1NK 4P5AA 5C4JK 4LR2A 1XXAA 4FZBA 2A6HA 2V6SA 4G7ZA 3FKIA 2V6UA 3LAJA 3HOWC 3GTOA 4NOIA 3GTGA 3GTOK 4WFNS 2Y3PA 1PJ7A 1PJ5A 4J3NA 3GTGK 1G51A 4A3DK 2PMZD 3PO2K 5IOTA 3RZOC 1SFOA 1IE0A 1JVIA 3H0GC 5IYCK 1TWFC 3PIOS 1SFOK 4BY7K 5C3EC 3GTJC 3GTPC 1VLOA 1B4BA 4GTDA 2GSNA 2WB1L 2R92C 1GE9A 1TWHC 4A3JC 4GT9A 4A3EC 4A3FK 3HOWK 3HOZC 3S1RC 3H3VD 4LK1A 3AD9C 1IW7A 5IORA 1TWCC 3S2DC 5M5WK 1ZQ1C 4BBRC 4Y7NK 1WCMC 3A8KA 3H0GA 5CHPA 1TWFA 4KASA 3RZOK 3GTKA 4KATA 3GTJA 3GTPA 3H0GK 1TWFK 3GTKK 4KB2A 4BKWA 5C3EK 3GTJK 3GTPK 4Q4ZA 2R92A 1TWHA 2ZJRS 3QX3A 2R92K 1TWHK 4A3JK 3ERED 2XCOA 4YFXA 4GTCA 5EGEA 4A3EK 1I3QC 1WQHA 3N3YA 4IO9S 3HOUC 1XXBA 1TWCA 2XCRB 4PAAA 1WCMA 1TWCK 3S2DK 2NVTC 4BBRK 1IBAA 4KN7A 3EQLA 1WCMK 1J6VA 1AB4A 2JA7C 2ZJPS 4YFNA 2XCQA 3RZDC 1I3QA 3TFJA 2P8TA 1I3QK 5DM7S 4KM8A 3HOUK 5E68A 4BBSK 3MMLB 1DCOA 3HOXC 2E2JC 2NVTK 1XZQA 4OINA 3GTLC 3GTMC 4KB4A 2P5MA 1WSRA 2JA7K 1ZYRA 3HKZD 3AQOA 3Q3QA 4DDQA 2Y0SD 2E2HA 3RZDK 2KWAA 2E2HK 4G0WA 3ADAC 4QJVB 4XLNA 1DCPA 1KQ4A 2E2IC 4QIWL 4WJ4A 5FJ8K 3HOXK 1BJTA 3L4KA 3GTLA 2E2JK 3GTMA 1WSVA 4IOAS 5M5XK 3GTLK 3GTMK 3K7AC 4GZYA 1L0WA 4GTFA 5HL7S 1XZPB 4U67S 1YNJA 1BS2A 1PJ6A 5L46A 3N0CA 2ZUEA 1BGWA 3GIRA 1Y1WC 2R93C 2CFAA 1TWAC 3S1QK 2B63C 4KMHA 4BY1K 4WJ3M 4BLAA 4A93C 2GAGC 1USOA 2GSUA 1O27A 1YX2A 4Q5SA 2L5NA 4XLPA 3LPXA 3K7AK 2JH3A 3BP8C 4KARA 2KPUA 3CQZC 1ZXOA 1O24A 4WCES 3GEEA 5IYDC 1K83C 4C3JC 1Y1WA 3BP3A 1TWAA 4G0UA 3LAPA 1Y1WK 2NVXC 1TWAK 4C45A 3CF5S 4FM9A 4KMUA 1F9NA 4A3KC 4A93K 2NVYC 3AD8C 2YU9C 4X6AC 4A3LC 5IYBC 2PPBA 3L4JA 3S0XA 2PMZL 1XPPA 5IYDK 5IOQA 4KMAA 4OIOA 3T02A 4C3IC 3DXJA 2NVXA 2NVXK 3HOVC 5M3MK 4LOWA 1YNNA 5HQHA 4A3KK 1DCHA 1TWGC 3PO3C 3OREA 1O2AA 3TTGA 4KMDA 4X6AK 3HOZK 3S1RK 4A3LK 3H3VL 4LK0A 3TFIA 5IYBK 1SMYA 1RU0A 4A3GC 1O26A 4GTEA 5C4XC 4KC6A 3LYWA 1EFWA 4C3IK 5M3FK 3AH5A 2KXYA 4WFAS 1TWGA 1USMA 1I50C 4WF9S 1TWGK 3PO3K 2JA8C 3S15C 1O28A 1O2FB 4GTLA 2JA5C 4P9SA 2O5JA 3VA7A 5TMFA 1V5VA 3WODA 3G4AA 2D6FC 2JA7A 3PIPS 2V6TA 3M4OC 4A3CC 3T01A 4A3MC 1DD5A 4OIRA 4YFKA 5DM6S 1ZBSA 3AD7C 2JA8K 3S15K 2WAQD 3TFHA 3FHZA 2O5IA 1I6HC 1WQGA 3A8IA 3SZYA 1VGXA 3BUEA 3S17C 5JVGS 3S16C 3V4GA 1EI6A 1J6XA 4XCHA 1BDFA 4BXXC 2RGRA 3M4OK 4A3CK 1WORA 3HKZL 1XZQB 4RMFA 2A6EA 2Y0SL 4KAWX 1IS1A 2E2IA 5EGHA 3SZZA 2E2IK 1I6HK 1JQWA 3FKIC 3S17K 4LJZA 5IP7C 3M3YC 1ISEA 3HOYC 1B4AA 3CAGA 2FQOA 3GTOC 5HL8A 3GTGC 2A69A 1F93A 3IPJA 3GEHA 3PO2C 1YCLA 3N0BA 4BXXK 4KM9A 4YG2A 4ILDA
chains in the Genus database with same CATH topology
2CW0A 2JA7C 5IYDK 5IYCC 1I6VA 4OIOA 4XSXA 1SFOC 4YFNA 3DXJA 4C3IC 4BY7C 4A3MK 2JA6K 3I4NK 1HQMA 3S1NC 2NVXK 3HOVC 3GTQC 2WB1D 5C4JC 5M3MK 3S1MK 3RZDC 2R93K 1YNNA 2A68A 3S1QC 2B63K 4A3KK 4BY1C 1I3QK 4JK1A 1TWGC 4LLGA 4XSZA 3PO3C 2WAQL 3HOUK 3FKIK 4BBSK 4A3FC 5IP7K 4X6AK 3HOZK 3M3YK 3S1RK 3S2DK 3HOYK 5C44C 3HOXC 3S16K 4A3LK 3S14K 3H3VL 4LK0A 5IYBK 2E2JC 4KN4A 2NVTK 1SMYA 4OINA 2NVQC 2R7ZC 3GTLC 3GTMC 4A3GC 4Y7NC 4AYBL 2BE5A 3S2HC 4A3DC 5C4XC 5D4DA 2JA7K 1ZYRA 3CQZK 3HKZD 3GTKC 4C3IK 5M3FK 2Y0SD 1K83K 5TMCA 4C3JK 3S1NK 4ZH4A 3GTQK 5C4JK 3RZDK 2E2HK 1I50C 2A6HA 5FLMC 4XLNA 4QJVB 4Y52C 1TWGK 3PO3K 2JA8C 4G7ZA 2NVYK 3S15C 2E2IC 4OIPA 1R9TC 4QIWL 2JA5C 2YU9K 2O5JA 5C44K 5FJ8K 3HOXK 3HOWC 4NOIA 3I4MC 4MQ9A 2E2JK 2NVQK 5TMFA 3GTOK 5M5XK 2R7ZK 3GTLK 3GTGK 3GTMK 3K7AC 2PA8D 4GZYA 4MEYA 3WODA 3S2HK 4A3DK 2PMZD 3PO2K 3RZOC 3M4OC 4A3CC 3H0GC 5IYCK 1TWFC 1YNJA 1SFOK 4BY7K 5C3EC 3GTJC 2VUMC 3GTPC 4A3MC 4G7OA 4OIRA 3HOVK 5M5YK 4YFKA 2WB1L 4C2MC 1Y1WC 2R93C 5FLMK 4Y52K 1TWAC 2R92C 3S1QK 1TWHC 4A3JC 2B63C 4BY1K 2JA8K 3S15K 2WAQD 1R9TK 4A93C 4A3EC 4BBSC 4A3FK 2O5IA 1I6HC 3HOWK 3HOZC 1Y1VC 3S1RC 3I4MK 3S17C 3S16C 3H3VD 4LK1A 4Q5SA 1IW7A 4XLPA 3K7AK 2PA8L 1TWCC 3S2DC 5M5WK 5IP9C 4BBRC 4A3IC 4G7HA 1WCMC 5C4XK 4Y7NK 4A3GK 3RZOK 1BDFA 4A3BC 4BXXC 3M4OK 4A3CK 4C3HC 3CQZC 3H0GK 1TWFK 3HKZL 3GTKK 4QJVA 5C3EK 3GTJK 2VUMK 5IYDC 3GTPK 1K83C 2A6EA 4C3JC 4Q4ZA 2Y0SL 2JA6C 3I4NC 4C2MK 1Y1WK 2NVXC 3S1MC 1TWAK 1TWHK 2E2HC 1I50K 4A3JK 2R92K 4YFXA 4KMUA 4A3KC 4A93K 2NVYC 4A3EK 1I3QC 4QIWD 2E2IK 1I6HK 3HOUC 3FKIC 1Y1VK 2YU9C 4OIQA 2JA5K 4LJZA 5IP7C 3S17K 4X6AC 3M3YC 4MEXA 3HOYC 4A3LC 3GTOC 3S14C 5IYBC 3GTGC 2A69A 2PPBA 2NVTC 1TWCK 5IP9K 4KN7A 3EQLA 1WCMK 4BBRK 4A3IK 3PO2C 4AYBD 1XPPA 4YG2A 2PMZL 4C3HK 4A3BK 4BXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 A;  2JA7 C;  5IYD K;  5IYC C;  1I6V A;  4OIO A;  4XSX A;  1SFO C;  4YFN A;  3DXJ A;  4C3I C;  4BY7 C;  4A3M K;  2JA6 K;  3I4N K;  1HQM A;  3S1N C;  2NVX K;  3HOV C;  3GTQ C;  2WB1 D;  5C4J C;  5M3M K;  3S1M K;  3RZD C;  2R93 K;  1YNN A;  2A68 A;  3S1Q C;  2B63 K;  4A3K K;  4BY1 C;  1I3Q K;  4JK1 A;  1TWG C;  4LLG A;  4XSZ A;  3PO3 C;  2WAQ L;  3HOU K;  3FKI K;  4BBS K;  4A3F C;  5IP7 K;  4X6A K;  3HOZ K;  3M3Y K;  3S1R K;  3S2D K;  3HOY K;  5C44 C;  3HOX C;  3S16 K;  4A3L K;  3S14 K;  3H3V L;  4LK0 A;  5IYB K;  2E2J C;  4KN4 A;  2NVT K;  1SMY A;  4OIN A;  2NVQ C;  2R7Z C;  3GTL C;  3GTM C;  4A3G C;  4Y7N C;  4AYB L;  2BE5 A;  3S2H C;  4A3D C;  5C4X C;  5D4D A;  2JA7 K;  1ZYR A;  3CQZ K;  3HKZ D;  3GTK C;  4C3I K;  5M3F K;  2Y0S D;  1K83 K;  5TMC A;  4C3J K;  3S1N K;  4ZH4 A;  3GTQ K;  5C4J K;  3RZD K;  2E2H K;  1I50 C;  2A6H A;  5FLM C;  4XLN A;  4QJV B;  4Y52 C;  1TWG K;  3PO3 K;  2JA8 C;  4G7Z A;  2NVY K;  3S15 C;  2E2I C;  4OIP A;  1R9T C;  4QIW L;  2JA5 C;  2YU9 K;  2O5J A;  5C44 K;  5FJ8 K;  3HOX K;  3HOW C;  4NOI A;  3I4M C;  4MQ9 A;  2E2J K;  2NVQ K;  5TMF A;  3GTO K;  5M5X K;  2R7Z K;  3GTL K;  3GTG K;  3GTM K;  3K7A C;  2PA8 D;  4GZY A;  4MEY A;  3WOD A;  3S2H K;  4A3D K;  2PMZ D;  3PO2 K;  3RZO C;  3M4O C;  4A3C C;  3H0G C;  5IYC K;  1TWF C;  1YNJ A;  1SFO K;  4BY7 K;  5C3E C;  3GTJ C;  2VUM C;  3GTP C;  4A3M C;  4G7O A;  4OIR A;  3HOV K;  5M5Y K;  4YFK A;  2WB1 L;  4C2M C;  1Y1W C;  2R93 C;  5FLM K;  4Y52 K;  1TWA C;  2R92 C;  3S1Q K;  1TWH C;  4A3J C;  2B63 C;  4BY1 K;  2JA8 K;  3S15 K;  2WAQ D;  1R9T K;  4A93 C;  4A3E C;  4BBS C;  4A3F K;  2O5I A;  1I6H C;  3HOW K;  3HOZ C;  1Y1V C;  3S1R C;  3I4M K;  3S17 C;  3S16 C;  3H3V D;  4LK1 A;  4Q5S A;  1IW7 A;  4XLP A;  3K7A K;  2PA8 L;  1TWC C;  3S2D C;  5M5W K;  5IP9 C;  4BBR C;  4A3I C;  4G7H A;  1WCM C;  5C4X K;  4Y7N K;  4A3G K;  3RZO K;  1BDF A;  4A3B C;  4BXX C;  3M4O K;  4A3C K;  4C3H C;  3CQZ C;  3H0G K;  1TWF K;  3HKZ L;  3GTK K;  4QJV A;  5C3E K;  3GTJ K;  2VUM K;  5IYD C;  3GTP K;  1K83 C;  2A6E A;  4C3J C;  4Q4Z A;  2Y0S L;  2JA6 C;  3I4N C;  4C2M K;  1Y1W K;  2NVX C;  3S1M C;  1TWA K;  1TWH K;  2E2H C;  1I50 K;  4A3J K;  2R92 K;  4YFX A;  4KMU A;  4A3K C;  4A93 K;  2NVY C;  4A3E K;  1I3Q C;  4QIW D;  2E2I K;  1I6H K;  3HOU C;  3FKI C;  1Y1V K;  2YU9 C;  4OIQ A;  2JA5 K;  4LJZ A;  5IP7 C;  3S17 K;  4X6A C;  3M3Y C;  4MEX A;  3HOY C;  4A3L C;  3GTO C;  3S14 C;  5IYB C;  3GTG C;  2A69 A;  2PPB A;  2NVT C;  1TWC K;  5IP9 K;  4KN7 A;  3EQL A;  1WCM K;  4BBR K;  4A3I K;  3PO2 C;  4AYB D;  1XPP A;  4YG2 A;  2PMZ L;  4C3H K;  4A3B K;  4BXX K; 
#chains in the Genus database with same CATH topology
 2CW0 A;  2KQ1 A;  3HXA A;  5IYC C;  1SFO C;  1JOE A;  4BY7 C;  2R93 A;  3GTQ C;  2WB1 D;  2B63 A;  4O2D A;  2R93 K;  1XXC A;  5JVO A;  2B63 K;  4JK1 A;  4XSZ A;  3GDZ A;  3FKI K;  4A3F C;  5IP7 K;  3M3Y K;  3HOY K;  5C44 C;  2CFA B;  4LQY A;  4KN4 A;  2L3U A;  2NVQ C;  2PHC B;  2R7Z C;  1J98 A;  4Y7N C;  3GEI A;  3S2H C;  3CQZ A;  1O2B A;  3AQP A;  3CQZ K;  2GAH C;  3OEP A;  1K83 A;  3GTK C;  3GTQ A;  1K83 K;  5TMC A;  3JST A;  4GTB A;  4C3J K;  4ZH4 A;  4WFB S;  3GTQ K;  2NVY A;  5FLM C;  4PAB A;  4Y52 C;  1C0A A;  2NVY K;  2GSO A;  2YU9 A;  4OIP A;  1FEU A;  1R9T C;  2YU9 K;  5C44 K;  2R7Z A;  3I4M C;  4MQ9 A;  5TJ3 A;  2NVQ K;  1O25 A;  1O29 A;  2R7Z K;  1INN A;  2PA8 D;  1X31 C;  4MEY A;  3S2H K;  1VJE A;  4GFQ A;  1IQ0 A;  2FQT A;  5IOS A;  3FOE A;  1EK8 A;  2VUM C;  3NUH A;  4G7O A;  3HOV K;  5M5Y K;  4C2M C;  5FLM K;  1WOP A;  4Y52 K;  4KDD A;  1VH2 A;  1WQF A;  1R9T A;  1IL2 A;  1R9T K;  4BBS C;  1Y1V C;  3I4M K;  3FOF A;  1HI9 A;  2PA8 L;  5JVH S;  4A3G K;  5IP9 C;  4A3I C;  4G7H A;  4WIL A;  5C4X K;  5CJ9 A;  4A3B C;  2VUM A;  4C3H C;  3GSI A;  4QJV A;  2VUM K;  2JA6 C;  3I4N C;  1I50 A;  4C2M K;  3S1M C;  2E2H C;  1I50 K;  3OPF A;  1Y1V A;  2JA5 A;  4M1X A;  4IOC S;  4QIW D;  1WIH A;  1Y1V K;  2JA5 K;  4OIQ A;  1XZP A;  1EQR A;  4MEX A;  2ZUF A;  3S14 C;  3A8J A;  5IP9 K;  4A3I K;  4G0V A;  4AYB D;  4A3B K;  4C3H K;  2JA6 A;  5JFE A;  1I6V A;  2ZJQ S;  4XSX A;  2JA6 K;  4A3M K;  3I4N K;  1HQM A;  4P5B A;  3S1N C;  3G4C A;  3T00 A;  3S1M K;  5C4J C;  2RH6 A;  1F7V A;  2A68 A;  3S1Q C;  4AH6 A;  4BY1 C;  4LLG A;  1EH1 A;  2W7V A;  2WAQ L;  2ZFZ A;  3DLL S;  1F7U A;  2EBB A;  4GTA A;  1UV7 A;  3S16 K;  3S14 K;  4BLB A;  1VRQ C;  4AYB L;  1ZVU A;  2BE5 A;  4A3D C;  1WOO A;  5D4D A;  1WOS A;  1J6W A;  3S1N K;  4P5A A;  5C4J K;  4LR2 A;  1XXA A;  4FZB A;  2A6H A;  2V6S A;  4G7Z A;  3FKI A;  2V6U A;  3LAJ A;  3HOW C;  3GTO A;  4NOI A;  3GTG A;  3GTO K;  4WFN S;  2Y3P A;  1PJ7 A;  1PJ5 A;  4J3N A;  3GTG K;  1G51 A;  4A3D K;  2PMZ D;  3PO2 K;  5IOT A;  3RZO C;  1SFO A;  1IE0 A;  1JVI A;  3H0G C;  5IYC K;  1TWF C;  3PIO S;  1SFO K;  4BY7 K;  5C3E C;  3GTJ C;  3GTP C;  1VLO A;  1B4B A;  4GTD A;  2GSN A;  2WB1 L;  2R92 C;  1GE9 A;  1TWH C;  4A3J C;  4GT9 A;  4A3E C;  4A3F K;  3HOW K;  3HOZ C;  3S1R C;  3H3V D;  4LK1 A;  3AD9 C;  1IW7 A;  5IOR A;  1TWC C;  3S2D C;  5M5W K;  1ZQ1 C;  4BBR C;  4Y7N K;  1WCM C;  3A8K A;  3H0G A;  5CHP A;  1TWF A;  4KAS A;  3RZO K;  3GTK A;  4KAT A;  3GTJ A;  3GTP A;  3H0G K;  1TWF K;  3GTK K;  4KB2 A;  4BKW A;  5C3E K;  3GTJ K;  3GTP K;  4Q4Z A;  2R92 A;  1TWH A;  2ZJR S;  3QX3 A;  2R92 K;  1TWH K;  4A3J K;  3ERE D;  2XCO A;  4YFX A;  4GTC A;  5EGE A;  4A3E K;  1I3Q C;  1WQH A;  3N3Y A;  4IO9 S;  3HOU C;  1XXB A;  1TWC A;  2XCR B;  4PAA A;  1WCM A;  1TWC K;  3S2D K;  2NVT C;  4BBR K;  1IBA A;  4KN7 A;  3EQL A;  1WCM K;  1J6V A;  1AB4 A;  2JA7 C;  2ZJP S;  4YFN A;  2XCQ A;  3RZD C;  1I3Q A;  3TFJ A;  2P8T A;  1I3Q K;  5DM7 S;  4KM8 A;  3HOU K;  5E68 A;  4BBS K;  3MML B;  1DCO A;  3HOX C;  2E2J C;  2NVT K;  1XZQ A;  4OIN A;  3GTL C;  3GTM C;  4KB4 A;  2P5M A;  1WSR A;  2JA7 K;  1ZYR A;  3HKZ D;  3AQO A;  3Q3Q A;  4DDQ A;  2Y0S D;  2E2H A;  3RZD K;  2KWA A;  2E2H K;  4G0W A;  3ADA C;  4QJV B;  4XLN A;  1DCP A;  1KQ4 A;  2E2I C;  4QIW L;  4WJ4 A;  5FJ8 K;  3HOX K;  1BJT A;  3L4K A;  3GTL A;  2E2J K;  3GTM A;  1WSV A;  4IOA S;  5M5X K;  3GTL K;  3GTM K;  3K7A C;  4GZY A;  1L0W A;  4GTF A;  5HL7 S;  1XZP B;  4U67 S;  1YNJ A;  1BS2 A;  1PJ6 A;  5L46 A;  3N0C A;  2ZUE A;  1BGW A;  3GIR A;  1Y1W C;  2R93 C;  2CFA A;  1TWA C;  3S1Q K;  2B63 C;  4KMH A;  4BY1 K;  4WJ3 M;  4BLA A;  4A93 C;  2GAG C;  1USO A;  2GSU A;  1O27 A;  1YX2 A;  4Q5S A;  2L5N A;  4XLP A;  3LPX A;  3K7A K;  2JH3 A;  3BP8 C;  4KAR A;  2KPU A;  3CQZ C;  1ZXO A;  1O24 A;  4WCE S;  3GEE A;  5IYD C;  1K83 C;  4C3J C;  1Y1W A;  3BP3 A;  1TWA A;  4G0U A;  3LAP A;  1Y1W K;  2NVX C;  1TWA K;  4C45 A;  3CF5 S;  4FM9 A;  4KMU A;  1F9N A;  4A3K C;  4A93 K;  2NVY C;  3AD8 C;  2YU9 C;  4X6A C;  4A3L C;  5IYB C;  2PPB A;  3L4J A;  3S0X A;  2PMZ L;  1XPP A;  5IYD K;  5IOQ A;  4KMA A;  4OIO A;  3T02 A;  4C3I C;  3DXJ A;  2NVX A;  2NVX K;  3HOV C;  5M3M K;  4LOW A;  1YNN A;  5HQH A;  4A3K K;  1DCH A;  1TWG C;  3PO3 C;  3ORE A;  1O2A A;  3TTG A;  4KMD A;  4X6A K;  3HOZ K;  3S1R K;  4A3L K;  3H3V L;  4LK0 A;  3TFI A;  5IYB K;  1SMY A;  1RU0 A;  4A3G C;  1O26 A;  4GTE A;  5C4X C;  4KC6 A;  3LYW A;  1EFW A;  4C3I K;  5M3F K;  3AH5 A;  2KXY A;  4WFA S;  1TWG A;  1USM A;  1I50 C;  4WF9 S;  1TWG K;  3PO3 K;  2JA8 C;  3S15 C;  1O28 A;  1O2F B;  4GTL A;  2JA5 C;  4P9S A;  2O5J A;  3VA7 A;  5TMF A;  1V5V A;  3WOD A;  3G4A A;  2D6F C;  2JA7 A;  3PIP S;  2V6T A;  3M4O C;  4A3C C;  3T01 A;  4A3M C;  1DD5 A;  4OIR A;  4YFK A;  5DM6 S;  1ZBS A;  3AD7 C;  2JA8 K;  3S15 K;  2WAQ D;  3TFH A;  3FHZ A;  2O5I A;  1I6H C;  1WQG A;  3A8I A;  3SZY A;  1VGX A;  3BUE A;  3S17 C;  5JVG S;  3S16 C;  3V4G A;  1EI6 A;  1J6X A;  4XCH A;  1BDF A;  4BXX C;  2RGR A;  3M4O K;  4A3C K;  1WOR A;  3HKZ L;  1XZQ B;  4RMF A;  2A6E A;  2Y0S L;  4KAW X;  1IS1 A;  2E2I A;  5EGH A;  3SZZ A;  2E2I K;  1I6H K;  1JQW A;  3FKI C;  3S17 K;  4LJZ A;  5IP7 C;  3M3Y C;  1ISE A;  3HOY C;  1B4A A;  3CAG A;  2FQO A;  3GTO C;  5HL8 A;  3GTG C;  2A69 A;  1F93 A;  3IPJ A;  3GEH A;  3PO2 C;  1YCL A;  3N0B A;  4BXX K;  4KM9 A;  4YG2 A;  4ILD A; 
#chains in the Genus database with same CATH homology
 2CW0 A;  2JA7 C;  5IYD K;  5IYC C;  1I6V A;  4OIO A;  4XSX A;  1SFO C;  4YFN A;  3DXJ A;  4C3I C;  4BY7 C;  4A3M K;  2JA6 K;  3I4N K;  1HQM A;  3S1N C;  2NVX K;  3HOV C;  3GTQ C;  2WB1 D;  5C4J C;  5M3M K;  3S1M K;  3RZD C;  2R93 K;  1YNN A;  2A68 A;  3S1Q C;  2B63 K;  4A3K K;  4BY1 C;  1I3Q K;  4JK1 A;  1TWG C;  4LLG A;  4XSZ A;  3PO3 C;  2WAQ L;  3HOU K;  3FKI K;  4BBS K;  4A3F C;  5IP7 K;  4X6A K;  3HOZ K;  3M3Y K;  3S1R K;  3S2D K;  3HOY K;  5C44 C;  3HOX C;  3S16 K;  4A3L K;  3S14 K;  3H3V L;  4LK0 A;  5IYB K;  2E2J C;  4KN4 A;  2NVT K;  1SMY A;  4OIN A;  2NVQ C;  2R7Z C;  3GTL C;  3GTM C;  4A3G C;  4Y7N C;  4AYB L;  2BE5 A;  3S2H C;  4A3D C;  5C4X C;  5D4D A;  2JA7 K;  1ZYR A;  3CQZ K;  3HKZ D;  3GTK C;  4C3I K;  5M3F K;  2Y0S D;  1K83 K;  5TMC A;  4C3J K;  3S1N K;  4ZH4 A;  3GTQ K;  5C4J K;  3RZD K;  2E2H K;  1I50 C;  2A6H A;  5FLM C;  4XLN A;  4QJV B;  4Y52 C;  1TWG K;  3PO3 K;  2JA8 C;  4G7Z A;  2NVY K;  3S15 C;  2E2I C;  4OIP A;  1R9T C;  4QIW L;  2JA5 C;  2YU9 K;  2O5J A;  5C44 K;  5FJ8 K;  3HOX K;  3HOW C;  4NOI A;  3I4M C;  4MQ9 A;  2E2J K;  2NVQ K;  5TMF A;  3GTO K;  5M5X K;  2R7Z K;  3GTL K;  3GTG K;  3GTM K;  3K7A C;  2PA8 D;  4GZY A;  4MEY A;  3WOD A;  3S2H K;  4A3D K;  2PMZ D;  3PO2 K;  3RZO C;  3M4O C;  4A3C C;  3H0G C;  5IYC K;  1TWF C;  1YNJ A;  1SFO K;  4BY7 K;  5C3E C;  3GTJ C;  2VUM C;  3GTP C;  4A3M C;  4G7O A;  4OIR A;  3HOV K;  5M5Y K;  4YFK A;  2WB1 L;  4C2M C;  1Y1W C;  2R93 C;  5FLM K;  4Y52 K;  1TWA C;  2R92 C;  3S1Q K;  1TWH C;  4A3J C;  2B63 C;  4BY1 K;  2JA8 K;  3S15 K;  2WAQ D;  1R9T K;  4A93 C;  4A3E C;  4BBS C;  4A3F K;  2O5I A;  1I6H C;  3HOW K;  3HOZ C;  1Y1V C;  3S1R C;  3I4M K;  3S17 C;  3S16 C;  3H3V D;  4LK1 A;  4Q5S A;  1IW7 A;  4XLP A;  3K7A K;  2PA8 L;  1TWC C;  3S2D C;  5M5W K;  5IP9 C;  4BBR C;  4A3I C;  4G7H A;  1WCM C;  5C4X K;  4Y7N K;  4A3G K;  3RZO K;  1BDF A;  4A3B C;  4BXX C;  3M4O K;  4A3C K;  4C3H C;  3CQZ C;  3H0G K;  1TWF K;  3HKZ L;  3GTK K;  4QJV A;  5C3E K;  3GTJ K;  2VUM K;  5IYD C;  3GTP K;  1K83 C;  2A6E A;  4C3J C;  4Q4Z A;  2Y0S L;  2JA6 C;  3I4N C;  4C2M K;  1Y1W K;  2NVX C;  3S1M C;  1TWA K;  1TWH K;  2E2H C;  1I50 K;  4A3J K;  2R92 K;  4YFX A;  4KMU A;  4A3K C;  4A93 K;  2NVY C;  4A3E K;  1I3Q C;  4QIW D;  2E2I K;  1I6H K;  3HOU C;  3FKI C;  1Y1V K;  2YU9 C;  4OIQ A;  2JA5 K;  4LJZ A;  5IP7 C;  3S17 K;  4X6A C;  3M3Y C;  4MEX A;  3HOY C;  4A3L C;  3GTO C;  3S14 C;  5IYB C;  3GTG C;  2A69 A;  2PPB A;  2NVT C;  1TWC K;  5IP9 K;  4KN7 A;  3EQL A;  1WCM K;  4BBR K;  4A3I K;  3PO2 C;  4AYB D;  1XPP A;  4YG2 A;  2PMZ L;  4C3H K;  4A3B K;  4BXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...