2O5JA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5jA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5jA01
4X6AK 5TMCA 4KN4A 2JA6C 3GTKC 2JA7K 5IYDC 3S2DK 3S1QC 3S15C 3FKIK 4Y52K 1I6VA 5IP7K 4XSZA 4A3LK 2O5JA 3PO3K 4C3JK 4A3CC 3H3VL 2VUMK 4XLPA 4MEXA 2E2JC 4QJVB 4A3EK 5C4XC 4X6AC 1TWHK 1BDFA 2JA5K 2WB1L 3GTJK 3S14C 3S15K 4C2MK 2NVTK 3H0GK 4GZYA 2PMZL 3I4NK 5C4JC 4MQ9A 4OIPA 3S2DC 3RZOC 3RZDC 1I3QK 2A6EA 3HOUK 3PO2K 5IYDK 4JK1A 4A3FC 3HOYC 4BXXC 3GTMK 4YFNA 2PPBA 2VUMC 4G7ZA 4C2MC 4A3GC 1TWCK 1I6HK 2YU9C 2NVXC 3HOZK 4BY7C 4QIWL 5C44K 3S14K 3S2HK 1WCMK 1ZYRA 2PA8L 5C4JK 4KN7A 4C3HC 2PMZD 3M4OC 4Y7NC 1K83K 5FLMK 2YU9K 1SMYA 3GTMC 4AYBL 1Y1VC 1R9TC 1TWGK 5IYBK 1WCMC 4BBSK 1I50C 3GTOC 1YNNA 1SFOC 5FJ8K 3S1RK 3HKZD 5D4DA 1XPPA 4YFXA 2Y0SL 2B63K 3S1QK 3M4OK 3FKIC 1TWFC 4A93K 2WAQD 3S1NK 5M5YK 2A6HA 3DXJA 4XSXA 2JA7C 4C3HK 3WODA 2E2JK 1I50K 3GTOK 4A3MK 4NOIA 3PO3C 3S17C 4ZH4A 4C3JC 1HQMA 4A3IC 2R92C 4LLGA 4LJZA 3H0GC 3CQZK 2Y0SD 4A93C 3K7AK 2E2IK 2NVQC 3HOVK 4YG2A 2R93C 3GTGC 4A3FK 4A3MC 4BXXK 2BE5A 3S1NC 2JA8C 2E2HC 3HOXC 3S16K 2A68A 4C3IC 3I4NC 3PO2C 4OINA 3CQZC 1TWCC 1I6HC 4A3GK 4OIQA 4LK1A 2PA8D 2JA6K 3GTKK 4BY7K 4A3IK 2R92K 3GTGK 3I4MK 3GTLK 3M3YK 4A3KK 3S1MK 4A3DK 2JA8K 1TWAC 4QJVA 3K7AC 2R7ZC 3GTQC 3HOZC 2NVXK 3HOVC 2WAQL 2NVYK 2NVQK 3HOWK 4OIRA 1K83C 5FLMC 5C4XK 4Y7NK 5M5XK 2E2HK 4C3IK 3HKZL 4BY1K 2JA5C 2CW0A 4A3CK 5IYBC 1Y1VK 1R9TK 5IP9K 3GTLC 3M3YC 3S1MC 4A3DC 2A69A 4A3EC 4Q5SA 4AYBD 1TWAK 1SFOK 4A3JC 3GTPC 1I3QC 5C3EC 1IW7A 3HOUC 3RZOK 4BBSC 1YNJA 4OIOA 3HOWC 5IYCC 2NVTC 4MEYA 2WB1D 4G7HA 1TWFK 2R7ZK 3S1RC 4A3BC 3GTQK 3RZDK 5M3FK 2NVYC 5IP9C 3GTJC 2O5IA 3HOYK 3H3VD 4QIWD 5M5WK 4A3JK 3GTPK 4BY1C 4YFKA 1Y1WK 5C44C 3S2HC 5IYCK 3S17K 5C3EK 3EQLA 2R93K 4BBRK 4A3LC 4XLNA 3HOXK 4A3BK 2E2IC 1TWGC 4LK0A 4Y52C 5IP7C 1TWHC 4Q4ZA 3S16C 5M3MK 1Y1WC 5TMFA 4KMUA 2B63C 4G7OA 3I4MC 4BBRC 4A3KC
chains in the Genus database with same CATH superfamily
5TMCA 5DM6S 3GTKC 2JA7K 1EFWA 3S2DK 2KPUA 2O5JA 4GTBA 3HXAA 3PIOS 1TWHK 4J3NA 3S15K 4C2MK 3H0GK 3S2DC 3RZOC 3HOYC 1F9NA 4A3GC 1BGWA 3AQPA 3GTPA 3HOZK 2KWAA 5C44K 4GTCA 3S14K 2KXYA 3A8KA 1IBAA 2PA8L 5C4JK 4C3HC 1WOPA 1K83A 2PMZD 4IOAS 1WQHA 5FLMK 3AQOA 4BLBA 2YU9K 1TWAA 4BBSK 1R9TC 1TWGK 5IYBK 1WCMC 4KC6A 1ISEA 1I3QA 3HKZD 4KM8A 2B63K 1XZQA 1TWFC 3S1NK 1PJ6A 3FOEA 2A6HA 4XSXA 1I50K 3GTOK 2FQTA 3TFJA 4GTFA 4C3JC 1RU0A 4A3IC 3LYWA 4LJZA 3H0GC 4A93C 3K7AK 4YG2A 4XCHA 1TWCC 1I6HC 5JVOA 3LAJA 2JA6K 3T02A 1WQFA 3GDZA 1WQGA 4A3KK 2XCOA 1TWAC 4QJVA 3K7AC 4GTDA 2NVXK 3HOVC 2NVQK 4OIRA 4WFBS 1K83C 5C4XK 5M5XK 4O2DA 3HKZL 1PJ7A 3V4GA 1Y1VK 3GTJK 3GTLC 3S1MC 4A3DC 4Q5SA 1EQRA 1SFOK 1TWAK 4A3JC 1I3QC 1IW7A 4DDQA 1L0WA 3HOWC 2P5MA 3GTQK 2V6UA 2NVYC 2O5IA 5TJ3A 3H3VD 1DCOA 3GTPK 2CFAB 3ERED 1XXCA 2ZUFA 3S17K 3EQLA 1DCHA 2R93K 2GAHC 2RH6A 2R93A 2E2IC 4LK0A 4LR2A 4Y52C 1USMA 4RMFA 3GTKA 3S16C 5M3MK 1INNA 2B63C 1HI9A 3CF5S 3OPFA 1EK8A 4WCES 4FM9A 4X6AK 3G4AA 2JA6C 5IYDC 2ZJQS 3N0CA 3S1QC 3S15C 4FZBA 1O25A 1I6VA 5IP7K 4A3LK 4Y52K 1WSVA 3PO3K 4C3JK 1DD5A 2VUMK 5HL8A 1B4BA 4MEXA 2E2JC 4KM9A 5C4XC 1BDFA 1Y1VA 2WB1L 3S14C 2NVTK 5HQHA 3I4NK 4OIPA 3PO2K 3RZDC 4G0WA 2PPBA 2VUMC 5IORA 4G7ZA 2B63A 1VGXA 4IOCS 1WCMK 1ZYRA 2JH3A 4KN7A 1B4AA 2P8TA 2E2IA 3GTJA 1K83K 1PJ5A 3JSTA 2XCRB 1ZXOA 1C0AA 1FEUA 5FJ8K 3AD9C 3OREA 3M4OK 4A93K 1JQWA 3DXJA 2E2JK 1YCLA 3PO3C 2V6TA 1EI6A 5CHPA 2R92C 1WORA 4LLGA 1Y1WA 3CQZK 4BKWA 2E2IK 4BXXK 4WILA 1F93A 2JA8C 1IL2A 3S16K 2A68A 1JOEA 1O2BA 1BS2A 3GTKK 2GSUA 3MMLB 4BY7K 3GTGK 3FOFA 2JA8K 3GTLA 2R7ZC 3GTQC 3T01A 1GE9A 1UV7A 2E2HA 5FLMC 4C3IK 3GSIA 4BY1K 3H0GA 1WSRA 5C3EC 3RZOK 2JA5A 4OIOA 2NVTC 4MEYA 4G0UA 1DCPA 2ZFZA 2R7ZK 1V5VA 3PIPS 2JA7A 3GTJC 3HOYK 5M5WK 3S2HC 1AB4A 4M1XA 5IYCK 3LPXA 4C45A 1X31C 1VH2A 4XLNA 3HOXK 4A3BK 1KQ4A 1TWGC 4KMAA 5DM7S 2JA6A 3TFHA 4KMUA 4G7OA 4KN4A 3TTGA 3NUHA 4A3CC 3H3VL 4XLPA 1EH1A 3AD8C 2L3UA 2PMZL 5C4JC 4MQ9A 1I3QK 3HOUK 2A6EA 4A3FC 3FHZA 4BXXC 3SZYA 3GEEA 3N3YA 3GTMK 4AH6A 4YFNA 1USOA 4LOWA 3G4CA 1XZQB 1TWCK 1I6HK 4IO9S 1F7VA 2NVXC 4QIWL 3S2HK 2Y3PA 2NVYA 4Y7NC 5IOTA 2FQOA 5EGHA 1Y1VC 1YNNA 3S1RK 5D4DA 2ZUEA 2KQ1A 3S1QK 2R92A 2WAQD 2GAGC 2JA7C 4P9SA 4A3MK 4LQYA 3ADAC 5JVGS 3S17C 4ZH4A 1HQMA 1J6VA 4BLAA 1XXAA 4WJ4A 3BP8C 2NVQC 3HOVK 2R93C 4A3FK 2BE5A 1JVIA 2E2HC 3HOXC 4C3IC 4KMDA 3PO2C 3T00A 3GEHA 3L4KA 3GTQA 4OINA 2R7ZA 4A3GK 2XCQA 3TFIA 4OIQA 3L4JA 2PA8D 1VLOA 2R92K 3I4MK 3GTLK 3S1MK 4A3DK 1XXBA 3AH5A 3HOZC 3HOWK 4P5AA 2W7VA 2E2HK 2V6SA 5IYBC 1R9TK 4WFAS 2EBBA 2A69A 4AYBD 1ZQ1C 3GTPC 1YNJA 3GEIA 2WB1D 3S1RC 4A3BC 1XZPB 3RZDK 4KB2A 5IP9C 1BJTA 1VRQC 1O26A 3FKIA 5CJ9A 4A3JK 4YFKA 1Y1WK 2NVXA 4KAWX 3GIRA 5C3EK 3Q3QA 4BBRK 4A3LC 1J98A 2RGRA 4KMHA 4GT9A 4PABA 1TWHC 4U67S 4GTLA 4Q4ZA 3A8IA 5TMFA 3I4MC 3GTMA 3FKIK 5IOSA 4XSZA 4QJVB 3CAGA 5E68A 4A3EK 4X6AC 1ZVUA 3BP3A 1R9TA 2JA5K 4WFNS 1ZBSA 3BUEA 4GZYA 4G0VA 5IYDK 2D6FC 4JK1A 1TWGA 1O29A 5IOQA 2PHCB 3OEPA 4C2MC 2YU9C 4BY7C 1TWHA 1J6XA 2ZJRS 3M4OC 1G51A 3N0BA 4P5BA 2L5NA 1SMYA 3GTMC 5JVHS 1O2FB 4AYBL 1I50C 3GTOC 4PAAA 1IQ0A 1SFOC 4WJ3M 1WOOA 1XPPA 4YFXA 2Y0SL 1IS1A 3FKIC 4KATA 3AD7C 5M5YK 3S0XA 4C3HK 3WODA 4WF9S 4NOIA 1XZPA 2Y0SD 2GSNA 3CQZA 4KASA 3GTGC 4A3MC 3S1NC 4KARA 3I4NC 1WOSA 5L46A 3CQZC 4LK1A 3GTGA 4A3IK 3VA7A 1I50A 3GTOA 3M3YK 1TWCA 4ILDA 1O24A 2WAQL 2NVYK 4Y7NK 1WIHA 1YX2A 2JA5C 2CW0A 4A3CK 4KDDA 3QX3A 5IP9K 3M3YC 4A3EC 5JFEA 1F7UA 2YU9A 1SFOA 3HOUC 4BBSC 3A8JA 5IYCC 2GSOA 4G7HA 1TWFK 3LAPA 1J6WA 4GTEA 1TWFA 5M3FK 4GFQA 4QIWD 3SZZA 4BY1C 5C44C 4KB4A 2ZJPS 1WCMA 3DLLS 2CFAA 4GTAA 3IPJA 2VUMA 1VJEA 1O28A 5EGEA 5IP7C 1O2AA 1O27A 1Y1WC 1IE0A 5HL7S 4BBRC 4A3KC
chains in the Genus database with same CATH topology
4X6AK 5TMCA 4KN4A 2JA6C 3GTKC 2JA7K 5IYDC 3S2DK 3S1QC 3S15C 3FKIK 4Y52K 1I6VA 5IP7K 4XSZA 4A3LK 2O5JA 3PO3K 4C3JK 4A3CC 3H3VL 2VUMK 4XLPA 4MEXA 2E2JC 4QJVB 4A3EK 5C4XC 4X6AC 1TWHK 1BDFA 2JA5K 2WB1L 3GTJK 3S14C 3S15K 4C2MK 2NVTK 3H0GK 4GZYA 2PMZL 3I4NK 5C4JC 4MQ9A 4OIPA 3S2DC 3RZOC 3RZDC 1I3QK 2A6EA 3HOUK 3PO2K 5IYDK 4JK1A 4A3FC 3HOYC 4BXXC 3GTMK 4YFNA 2PPBA 2VUMC 4G7ZA 4C2MC 4A3GC 1TWCK 1I6HK 2YU9C 2NVXC 3HOZK 4BY7C 4QIWL 5C44K 3S14K 3S2HK 1WCMK 1ZYRA 2PA8L 5C4JK 4KN7A 4C3HC 2PMZD 3M4OC 4Y7NC 1K83K 5FLMK 2YU9K 1SMYA 3GTMC 4AYBL 1Y1VC 1R9TC 1TWGK 5IYBK 1WCMC 4BBSK 1I50C 3GTOC 1YNNA 1SFOC 5FJ8K 3S1RK 3HKZD 5D4DA 1XPPA 4YFXA 2Y0SL 2B63K 3S1QK 3M4OK 3FKIC 1TWFC 4A93K 2WAQD 3S1NK 5M5YK 2A6HA 3DXJA 4XSXA 2JA7C 4C3HK 3WODA 2E2JK 1I50K 3GTOK 4A3MK 4NOIA 3PO3C 3S17C 4ZH4A 4C3JC 1HQMA 4A3IC 2R92C 4LLGA 4LJZA 3H0GC 3CQZK 2Y0SD 4A93C 3K7AK 2E2IK 2NVQC 3HOVK 4YG2A 2R93C 3GTGC 4A3FK 4A3MC 4BXXK 2BE5A 3S1NC 2JA8C 2E2HC 3HOXC 3S16K 2A68A 4C3IC 3I4NC 3PO2C 4OINA 3CQZC 1TWCC 1I6HC 4A3GK 4OIQA 4LK1A 2PA8D 2JA6K 3GTKK 4BY7K 4A3IK 2R92K 3GTGK 3I4MK 3GTLK 3M3YK 4A3KK 3S1MK 4A3DK 2JA8K 1TWAC 4QJVA 3K7AC 2R7ZC 3GTQC 3HOZC 2NVXK 3HOVC 2WAQL 2NVYK 2NVQK 3HOWK 4OIRA 1K83C 5FLMC 5C4XK 4Y7NK 5M5XK 2E2HK 4C3IK 3HKZL 4BY1K 2JA5C 2CW0A 4A3CK 5IYBC 1Y1VK 1R9TK 5IP9K 3GTLC 3M3YC 3S1MC 4A3DC 2A69A 4A3EC 4Q5SA 4AYBD 1TWAK 1SFOK 4A3JC 3GTPC 1I3QC 5C3EC 1IW7A 3HOUC 3RZOK 4BBSC 1YNJA 4OIOA 3HOWC 5IYCC 2NVTC 4MEYA 2WB1D 4G7HA 1TWFK 2R7ZK 3S1RC 4A3BC 3GTQK 3RZDK 5M3FK 2NVYC 5IP9C 3GTJC 2O5IA 3HOYK 3H3VD 4QIWD 5M5WK 4A3JK 3GTPK 4BY1C 4YFKA 1Y1WK 5C44C 3S2HC 5IYCK 3S17K 5C3EK 3EQLA 2R93K 4BBRK 4A3LC 4XLNA 3HOXK 4A3BK 2E2IC 1TWGC 4LK0A 4Y52C 5IP7C 1TWHC 4Q4ZA 3S16C 5M3MK 1Y1WC 5TMFA 4KMUA 2B63C 4G7OA 3I4MC 4BBRC 4A3KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X6A K;  5TMC A;  4KN4 A;  2JA6 C;  3GTK C;  2JA7 K;  5IYD C;  3S2D K;  3S1Q C;  3S15 C;  3FKI K;  4Y52 K;  1I6V A;  5IP7 K;  4XSZ A;  4A3L K;  2O5J A;  3PO3 K;  4C3J K;  4A3C C;  3H3V L;  2VUM K;  4XLP A;  4MEX A;  2E2J C;  4QJV B;  4A3E K;  5C4X C;  4X6A C;  1TWH K;  1BDF A;  2JA5 K;  2WB1 L;  3GTJ K;  3S14 C;  3S15 K;  4C2M K;  2NVT K;  3H0G K;  4GZY A;  2PMZ L;  3I4N K;  5C4J C;  4MQ9 A;  4OIP A;  3S2D C;  3RZO C;  3RZD C;  1I3Q K;  2A6E A;  3HOU K;  3PO2 K;  5IYD K;  4JK1 A;  4A3F C;  3HOY C;  4BXX C;  3GTM K;  4YFN A;  2PPB A;  2VUM C;  4G7Z A;  4C2M C;  4A3G C;  1TWC K;  1I6H K;  2YU9 C;  2NVX C;  3HOZ K;  4BY7 C;  4QIW L;  5C44 K;  3S14 K;  3S2H K;  1WCM K;  1ZYR A;  2PA8 L;  5C4J K;  4KN7 A;  4C3H C;  2PMZ D;  3M4O C;  4Y7N C;  1K83 K;  5FLM K;  2YU9 K;  1SMY A;  3GTM C;  4AYB L;  1Y1V C;  1R9T C;  1TWG K;  5IYB K;  1WCM C;  4BBS K;  1I50 C;  3GTO C;  1YNN A;  1SFO C;  5FJ8 K;  3S1R K;  3HKZ D;  5D4D A;  1XPP A;  4YFX A;  2Y0S L;  2B63 K;  3S1Q K;  3M4O K;  3FKI C;  1TWF C;  4A93 K;  2WAQ D;  3S1N K;  5M5Y K;  2A6H A;  3DXJ A;  4XSX A;  2JA7 C;  4C3H K;  3WOD A;  2E2J K;  1I50 K;  3GTO K;  4A3M K;  4NOI A;  3PO3 C;  3S17 C;  4ZH4 A;  4C3J C;  1HQM A;  4A3I C;  2R92 C;  4LLG A;  4LJZ A;  3H0G C;  3CQZ K;  2Y0S D;  4A93 C;  3K7A K;  2E2I K;  2NVQ C;  3HOV K;  4YG2 A;  2R93 C;  3GTG C;  4A3F K;  4A3M C;  4BXX K;  2BE5 A;  3S1N C;  2JA8 C;  2E2H C;  3HOX C;  3S16 K;  2A68 A;  4C3I C;  3I4N C;  3PO2 C;  4OIN A;  3CQZ C;  1TWC C;  1I6H C;  4A3G K;  4OIQ A;  4LK1 A;  2PA8 D;  2JA6 K;  3GTK K;  4BY7 K;  4A3I K;  2R92 K;  3GTG K;  3I4M K;  3GTL K;  3M3Y K;  4A3K K;  3S1M K;  4A3D K;  2JA8 K;  1TWA C;  4QJV A;  3K7A C;  2R7Z C;  3GTQ C;  3HOZ C;  2NVX K;  3HOV C;  2WAQ L;  2NVY K;  2NVQ K;  3HOW K;  4OIR A;  1K83 C;  5FLM C;  5C4X K;  4Y7N K;  5M5X K;  2E2H K;  4C3I K;  3HKZ L;  4BY1 K;  2JA5 C;  2CW0 A;  4A3C K;  5IYB C;  1Y1V K;  1R9T K;  5IP9 K;  3GTL C;  3M3Y C;  3S1M C;  4A3D C;  2A69 A;  4A3E C;  4Q5S A;  4AYB D;  1TWA K;  1SFO K;  4A3J C;  3GTP C;  1I3Q C;  5C3E C;  1IW7 A;  3HOU C;  3RZO K;  4BBS C;  1YNJ A;  4OIO A;  3HOW C;  5IYC C;  2NVT C;  4MEY A;  2WB1 D;  4G7H A;  1TWF K;  2R7Z K;  3S1R C;  4A3B C;  3GTQ K;  3RZD K;  5M3F K;  2NVY C;  5IP9 C;  3GTJ C;  2O5I A;  3HOY K;  3H3V D;  4QIW D;  5M5W K;  4A3J K;  3GTP K;  4BY1 C;  4YFK A;  1Y1W K;  5C44 C;  3S2H C;  5IYC K;  3S17 K;  5C3E K;  3EQL A;  2R93 K;  4BBR K;  4A3L C;  4XLN A;  3HOX K;  4A3B K;  2E2I C;  1TWG C;  4LK0 A;  4Y52 C;  5IP7 C;  1TWH C;  4Q4Z A;  3S16 C;  5M3M K;  1Y1W C;  5TMF A;  4KMU A;  2B63 C;  4G7O A;  3I4M C;  4BBR C;  4A3K C; 
#chains in the Genus database with same CATH topology
 5TMC A;  5DM6 S;  3GTK C;  2JA7 K;  1EFW A;  3S2D K;  2KPU A;  2O5J A;  4GTB A;  3HXA A;  3PIO S;  1TWH K;  4J3N A;  3S15 K;  4C2M K;  3H0G K;  3S2D C;  3RZO C;  3HOY C;  1F9N A;  4A3G C;  1BGW A;  3AQP A;  3GTP A;  3HOZ K;  2KWA A;  5C44 K;  4GTC A;  3S14 K;  2KXY A;  3A8K A;  1IBA A;  2PA8 L;  5C4J K;  4C3H C;  1WOP A;  1K83 A;  2PMZ D;  4IOA S;  1WQH A;  5FLM K;  3AQO A;  4BLB A;  2YU9 K;  1TWA A;  4BBS K;  1R9T C;  1TWG K;  5IYB K;  1WCM C;  4KC6 A;  1ISE A;  1I3Q A;  3HKZ D;  4KM8 A;  2B63 K;  1XZQ A;  1TWF C;  3S1N K;  1PJ6 A;  3FOE A;  2A6H A;  4XSX A;  1I50 K;  3GTO K;  2FQT A;  3TFJ A;  4GTF A;  4C3J C;  1RU0 A;  4A3I C;  3LYW A;  4LJZ A;  3H0G C;  4A93 C;  3K7A K;  4YG2 A;  4XCH A;  1TWC C;  1I6H C;  5JVO A;  3LAJ A;  2JA6 K;  3T02 A;  1WQF A;  3GDZ A;  1WQG A;  4A3K K;  2XCO A;  1TWA C;  4QJV A;  3K7A C;  4GTD A;  2NVX K;  3HOV C;  2NVQ K;  4OIR A;  4WFB S;  1K83 C;  5C4X K;  5M5X K;  4O2D A;  3HKZ L;  1PJ7 A;  3V4G A;  1Y1V K;  3GTJ K;  3GTL C;  3S1M C;  4A3D C;  4Q5S A;  1EQR A;  1SFO K;  1TWA K;  4A3J C;  1I3Q C;  1IW7 A;  4DDQ A;  1L0W A;  3HOW C;  2P5M A;  3GTQ K;  2V6U A;  2NVY C;  2O5I A;  5TJ3 A;  3H3V D;  1DCO A;  3GTP K;  2CFA B;  3ERE D;  1XXC A;  2ZUF A;  3S17 K;  3EQL A;  1DCH A;  2R93 K;  2GAH C;  2RH6 A;  2R93 A;  2E2I C;  4LK0 A;  4LR2 A;  4Y52 C;  1USM A;  4RMF A;  3GTK A;  3S16 C;  5M3M K;  1INN A;  2B63 C;  1HI9 A;  3CF5 S;  3OPF A;  1EK8 A;  4WCE S;  4FM9 A;  4X6A K;  3G4A A;  2JA6 C;  5IYD C;  2ZJQ S;  3N0C A;  3S1Q C;  3S15 C;  4FZB A;  1O25 A;  1I6V A;  5IP7 K;  4A3L K;  4Y52 K;  1WSV A;  3PO3 K;  4C3J K;  1DD5 A;  2VUM K;  5HL8 A;  1B4B A;  4MEX A;  2E2J C;  4KM9 A;  5C4X C;  1BDF A;  1Y1V A;  2WB1 L;  3S14 C;  2NVT K;  5HQH A;  3I4N K;  4OIP A;  3PO2 K;  3RZD C;  4G0W A;  2PPB A;  2VUM C;  5IOR A;  4G7Z A;  2B63 A;  1VGX A;  4IOC S;  1WCM K;  1ZYR A;  2JH3 A;  4KN7 A;  1B4A A;  2P8T A;  2E2I A;  3GTJ A;  1K83 K;  1PJ5 A;  3JST A;  2XCR B;  1ZXO A;  1C0A A;  1FEU A;  5FJ8 K;  3AD9 C;  3ORE A;  3M4O K;  4A93 K;  1JQW A;  3DXJ A;  2E2J K;  1YCL A;  3PO3 C;  2V6T A;  1EI6 A;  5CHP A;  2R92 C;  1WOR A;  4LLG A;  1Y1W A;  3CQZ K;  4BKW A;  2E2I K;  4BXX K;  4WIL A;  1F93 A;  2JA8 C;  1IL2 A;  3S16 K;  2A68 A;  1JOE A;  1O2B A;  1BS2 A;  3GTK K;  2GSU A;  3MML B;  4BY7 K;  3GTG K;  3FOF A;  2JA8 K;  3GTL A;  2R7Z C;  3GTQ C;  3T01 A;  1GE9 A;  1UV7 A;  2E2H A;  5FLM C;  4C3I K;  3GSI A;  4BY1 K;  3H0G A;  1WSR A;  5C3E C;  3RZO K;  2JA5 A;  4OIO A;  2NVT C;  4MEY A;  4G0U A;  1DCP A;  2ZFZ A;  2R7Z K;  1V5V A;  3PIP S;  2JA7 A;  3GTJ C;  3HOY K;  5M5W K;  3S2H C;  1AB4 A;  4M1X A;  5IYC K;  3LPX A;  4C45 A;  1X31 C;  1VH2 A;  4XLN A;  3HOX K;  4A3B K;  1KQ4 A;  1TWG C;  4KMA A;  5DM7 S;  2JA6 A;  3TFH A;  4KMU A;  4G7O A;  4KN4 A;  3TTG A;  3NUH A;  4A3C C;  3H3V L;  4XLP A;  1EH1 A;  3AD8 C;  2L3U A;  2PMZ L;  5C4J C;  4MQ9 A;  1I3Q K;  3HOU K;  2A6E A;  4A3F C;  3FHZ A;  4BXX C;  3SZY A;  3GEE A;  3N3Y A;  3GTM K;  4AH6 A;  4YFN A;  1USO A;  4LOW A;  3G4C A;  1XZQ B;  1TWC K;  1I6H K;  4IO9 S;  1F7V A;  2NVX C;  4QIW L;  3S2H K;  2Y3P A;  2NVY A;  4Y7N C;  5IOT A;  2FQO A;  5EGH A;  1Y1V C;  1YNN A;  3S1R K;  5D4D A;  2ZUE A;  2KQ1 A;  3S1Q K;  2R92 A;  2WAQ D;  2GAG C;  2JA7 C;  4P9S A;  4A3M K;  4LQY A;  3ADA C;  5JVG S;  3S17 C;  4ZH4 A;  1HQM A;  1J6V A;  4BLA A;  1XXA A;  4WJ4 A;  3BP8 C;  2NVQ C;  3HOV K;  2R93 C;  4A3F K;  2BE5 A;  1JVI A;  2E2H C;  3HOX C;  4C3I C;  4KMD A;  3PO2 C;  3T00 A;  3GEH A;  3L4K A;  3GTQ A;  4OIN A;  2R7Z A;  4A3G K;  2XCQ A;  3TFI A;  4OIQ A;  3L4J A;  2PA8 D;  1VLO A;  2R92 K;  3I4M K;  3GTL K;  3S1M K;  4A3D K;  1XXB A;  3AH5 A;  3HOZ C;  3HOW K;  4P5A A;  2W7V A;  2E2H K;  2V6S A;  5IYB C;  1R9T K;  4WFA S;  2EBB A;  2A69 A;  4AYB D;  1ZQ1 C;  3GTP C;  1YNJ A;  3GEI A;  2WB1 D;  3S1R C;  4A3B C;  1XZP B;  3RZD K;  4KB2 A;  5IP9 C;  1BJT A;  1VRQ C;  1O26 A;  3FKI A;  5CJ9 A;  4A3J K;  4YFK A;  1Y1W K;  2NVX A;  4KAW X;  3GIR A;  5C3E K;  3Q3Q A;  4BBR K;  4A3L C;  1J98 A;  2RGR A;  4KMH A;  4GT9 A;  4PAB A;  1TWH C;  4U67 S;  4GTL A;  4Q4Z A;  3A8I A;  5TMF A;  3I4M C;  3GTM A;  3FKI K;  5IOS A;  4XSZ A;  4QJV B;  3CAG A;  5E68 A;  4A3E K;  4X6A C;  1ZVU A;  3BP3 A;  1R9T A;  2JA5 K;  4WFN S;  1ZBS A;  3BUE A;  4GZY A;  4G0V A;  5IYD K;  2D6F C;  4JK1 A;  1TWG A;  1O29 A;  5IOQ A;  2PHC B;  3OEP A;  4C2M C;  2YU9 C;  4BY7 C;  1TWH A;  1J6X A;  2ZJR S;  3M4O C;  1G51 A;  3N0B A;  4P5B A;  2L5N A;  1SMY A;  3GTM C;  5JVH S;  1O2F B;  4AYB L;  1I50 C;  3GTO C;  4PAA A;  1IQ0 A;  1SFO C;  4WJ3 M;  1WOO A;  1XPP A;  4YFX A;  2Y0S L;  1IS1 A;  3FKI C;  4KAT A;  3AD7 C;  5M5Y K;  3S0X A;  4C3H K;  3WOD A;  4WF9 S;  4NOI A;  1XZP A;  2Y0S D;  2GSN A;  3CQZ A;  4KAS A;  3GTG C;  4A3M C;  3S1N C;  4KAR A;  3I4N C;  1WOS A;  5L46 A;  3CQZ C;  4LK1 A;  3GTG A;  4A3I K;  3VA7 A;  1I50 A;  3GTO A;  3M3Y K;  1TWC A;  4ILD A;  1O24 A;  2WAQ L;  2NVY K;  4Y7N K;  1WIH A;  1YX2 A;  2JA5 C;  2CW0 A;  4A3C K;  4KDD A;  3QX3 A;  5IP9 K;  3M3Y C;  4A3E C;  5JFE A;  1F7U A;  2YU9 A;  1SFO A;  3HOU C;  4BBS C;  3A8J A;  5IYC C;  2GSO A;  4G7H A;  1TWF K;  3LAP A;  1J6W A;  4GTE A;  1TWF A;  5M3F K;  4GFQ A;  4QIW D;  3SZZ A;  4BY1 C;  5C44 C;  4KB4 A;  2ZJP S;  1WCM A;  3DLL S;  2CFA A;  4GTA A;  3IPJ A;  2VUM A;  1VJE A;  1O28 A;  5EGE A;  5IP7 C;  1O2A A;  1O27 A;  1Y1W C;  1IE0 A;  5HL7 S;  4BBR C;  4A3K C; 
#chains in the Genus database with same CATH homology
 4X6A K;  5TMC A;  4KN4 A;  2JA6 C;  3GTK C;  2JA7 K;  5IYD C;  3S2D K;  3S1Q C;  3S15 C;  3FKI K;  4Y52 K;  1I6V A;  5IP7 K;  4XSZ A;  4A3L K;  2O5J A;  3PO3 K;  4C3J K;  4A3C C;  3H3V L;  2VUM K;  4XLP A;  4MEX A;  2E2J C;  4QJV B;  4A3E K;  5C4X C;  4X6A C;  1TWH K;  1BDF A;  2JA5 K;  2WB1 L;  3GTJ K;  3S14 C;  3S15 K;  4C2M K;  2NVT K;  3H0G K;  4GZY A;  2PMZ L;  3I4N K;  5C4J C;  4MQ9 A;  4OIP A;  3S2D C;  3RZO C;  3RZD C;  1I3Q K;  2A6E A;  3HOU K;  3PO2 K;  5IYD K;  4JK1 A;  4A3F C;  3HOY C;  4BXX C;  3GTM K;  4YFN A;  2PPB A;  2VUM C;  4G7Z A;  4C2M C;  4A3G C;  1TWC K;  1I6H K;  2YU9 C;  2NVX C;  3HOZ K;  4BY7 C;  4QIW L;  5C44 K;  3S14 K;  3S2H K;  1WCM K;  1ZYR A;  2PA8 L;  5C4J K;  4KN7 A;  4C3H C;  2PMZ D;  3M4O C;  4Y7N C;  1K83 K;  5FLM K;  2YU9 K;  1SMY A;  3GTM C;  4AYB L;  1Y1V C;  1R9T C;  1TWG K;  5IYB K;  1WCM C;  4BBS K;  1I50 C;  3GTO C;  1YNN A;  1SFO C;  5FJ8 K;  3S1R K;  3HKZ D;  5D4D A;  1XPP A;  4YFX A;  2Y0S L;  2B63 K;  3S1Q K;  3M4O K;  3FKI C;  1TWF C;  4A93 K;  2WAQ D;  3S1N K;  5M5Y K;  2A6H A;  3DXJ A;  4XSX A;  2JA7 C;  4C3H K;  3WOD A;  2E2J K;  1I50 K;  3GTO K;  4A3M K;  4NOI A;  3PO3 C;  3S17 C;  4ZH4 A;  4C3J C;  1HQM A;  4A3I C;  2R92 C;  4LLG A;  4LJZ A;  3H0G C;  3CQZ K;  2Y0S D;  4A93 C;  3K7A K;  2E2I K;  2NVQ C;  3HOV K;  4YG2 A;  2R93 C;  3GTG C;  4A3F K;  4A3M C;  4BXX K;  2BE5 A;  3S1N C;  2JA8 C;  2E2H C;  3HOX C;  3S16 K;  2A68 A;  4C3I C;  3I4N C;  3PO2 C;  4OIN A;  3CQZ C;  1TWC C;  1I6H C;  4A3G K;  4OIQ A;  4LK1 A;  2PA8 D;  2JA6 K;  3GTK K;  4BY7 K;  4A3I K;  2R92 K;  3GTG K;  3I4M K;  3GTL K;  3M3Y K;  4A3K K;  3S1M K;  4A3D K;  2JA8 K;  1TWA C;  4QJV A;  3K7A C;  2R7Z C;  3GTQ C;  3HOZ C;  2NVX K;  3HOV C;  2WAQ L;  2NVY K;  2NVQ K;  3HOW K;  4OIR A;  1K83 C;  5FLM C;  5C4X K;  4Y7N K;  5M5X K;  2E2H K;  4C3I K;  3HKZ L;  4BY1 K;  2JA5 C;  2CW0 A;  4A3C K;  5IYB C;  1Y1V K;  1R9T K;  5IP9 K;  3GTL C;  3M3Y C;  3S1M C;  4A3D C;  2A69 A;  4A3E C;  4Q5S A;  4AYB D;  1TWA K;  1SFO K;  4A3J C;  3GTP C;  1I3Q C;  5C3E C;  1IW7 A;  3HOU C;  3RZO K;  4BBS C;  1YNJ A;  4OIO A;  3HOW C;  5IYC C;  2NVT C;  4MEY A;  2WB1 D;  4G7H A;  1TWF K;  2R7Z K;  3S1R C;  4A3B C;  3GTQ K;  3RZD K;  5M3F K;  2NVY C;  5IP9 C;  3GTJ C;  2O5I A;  3HOY K;  3H3V D;  4QIW D;  5M5W K;  4A3J K;  3GTP K;  4BY1 C;  4YFK A;  1Y1W K;  5C44 C;  3S2H C;  5IYC K;  3S17 K;  5C3E K;  3EQL A;  2R93 K;  4BBR K;  4A3L C;  4XLN A;  3HOX K;  4A3B K;  2E2I C;  1TWG C;  4LK0 A;  4Y52 C;  5IP7 C;  1TWH C;  4Q4Z A;  3S16 C;  5M3M K;  1Y1W C;  5TMF A;  4KMU A;  2B63 C;  4G7O A;  3I4M C;  4BBR C;  4A3K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...