2O5JA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5jA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5jA01
4Y7NK 4A3EC 4A3CK 2BE5A 3H0GC 1I6HC 5FJ8K 4A93K 3WODA 4OINA 3GTKK 4YG2A 4A3BC 5C3EK 1K83K 3RZDK 2YU9K 1I50K 4Y52K 3K7AC 3PO3K 2JA5C 2NVYK 4KN7A 1Y1WC 5C4XK 3S1RK 3GTGK 2R7ZK 4OIQA 2E2IK 3GTOC 3S1QK 2A6EA 3I4NC 3HOUK 4X6AK 1YNJA 2VUMC 5TMCA 2WB1L 5IYCC 3FKIK 2NVXK 1TWCC 4A3GK 5IYDC 2PMZL 4QIWL 1R9TK 3S2DC 4XLNA 4OIPA 3HOZC 3RZOC 4C3IC 2E2JC 4A3LK 4Y7NC 3HOYK 3M4OK 1TWHC 1SMYA 1TWGK 3I4MC 1WCMC 4C3HK 2JA8K 4ZH4A 2NVQC 4LLGA 4A3FC 3S14K 2R7ZC 5IP9C 3CQZC 2R92K 3GTMK 5IYBK 5C44C 3HKZL 3S15C 4C2MC 3GTQC 3HOVK 2WB1D 5C4JK 2O5JA 4QJVA 3HOWK 1TWFK 3FKIC 1HQMA 4A3JC 1R9TC 3S1MC 4YFNA 5FLMK 4BBRK 2PA8L 2JA8C 3GTLK 1YNNA 3GTPC 1Y1VK 2A6HA 4A3MC 4YFKA 5M3FK 3S1NK 4BY1C 3GTJC 4C3JC 5IP7C 1IW7A 2Y0SL 3S16C 3S17C 2WAQL 4A3IK 3H3VL 4OIOA 4A3CC 2E2HK 2CW0A 4A93C 3GTKC 5C3EC 1K83C 4Q4ZA 3RZDC 1I50C 4Y52C 2YU9C 4G7OA 2JA7K 3PO2K 3PO3C 2PA8D 2JA6K 2NVYC 3S1RC 3GTGC 5C4XC 2R93K 2E2IC 3S1QC 3HOUC 2B63K 2NVTK 4MEXA 1BDFA 4X6AC 4QJVB 4BBSK 4BY7K 3M3YK 1I6VA 3HOXK 3S2HK 4QIWD 4XSZA 2PMZD 4BXXK 2NVXC 4A3DK 4A3GC 3H3VD 3S16K 4A3LC 4AYBL 1SFOK 4A3EK 4A3IC 1I6HK 3HOYC 3M4OC 1TWGC 2A68A 4C3HC 3K7AK 4A3KK 2PPBA 4JK1A 2JA5K 1Y1WK 3S14C 5M5XK 4KN4A 4GZYA 4OIRA 4KMUA 3GTOK 3HKZD 2R92C 3I4NK 3GTMC 5IYBC 2B63C 3HOVC 2VUMK 5IYCK 4XLPA 4BBSC 5C4JC 5M5WK 4A3DC 2A69A 3S2HC 1TWCK 1ZYRA 3HOWC 1TWFC 5D4DA 4AYBD 4Q5SA 3S2DK 3RZOK 4MQ9A 5IYDK 4C3IK 2E2JK 1XPPA 1I3QK 1SFOC 4G7ZA 1TWAK 1TWHK 3EQLA 5FLMC 4BBRC 3I4MK 1WCMK 4MEYA 2NVQK 3GTLC 4A3KC 4A3FK 1Y1VC 4NOIA 5IP9K 2O5IA 3CQZK 2Y0SD 3S1NC 5C44K 3S15K 4C2MK 2WAQD 3GTQK 5M3MK 3H0GK 2E2HC 4G7HA 4A3BK 4A3JK 4YFXA 3DXJA 4LK0A 2JA7C 3S1MK 4XSXA 1I3QC 1TWAC 4LJZA 3PO2C 2JA6C 2R93C 2NVTC 3GTPK 4LK1A 5M5YK 4A3MK 4BY7C 3M3YC 4BXXC 3HOXC 3GTJK 4C3JK 5IP7K 4BY1K 5TMFA 3HOZK 3S17K
chains in the Genus database with same CATH superfamily
4A3EC 2CFAB 1WQHA 3H0GC 3GTKA 4YG2A 4A3BC 3GDZA 3GEEA 5C3EK 4BLBA 2JA5C 2R7ZK 3GTGK 2GSOA 2E2IA 4OIQA 2GAGC 4WFBS 3GTOC 4P9SA 4BKWA 3I4NC 3HOUK 2RH6A 1YNJA 5IYCC 4KMHA 2NVXK 4A3GK 3RZOC 3OEPA 4C3IC 1TWGA 1TWHC 3I4MC 2JA8K 1O24A 3S14K 5IP9C 1X31C 2B63A 2WB1D 4AH6A 5JVOA 3FOFA 2O5JA 3TTGA 2ZFZA 1TWFK 3FKIC 2XCRB 1B4AA 5CJ9A 2PA8L 1YNNA 3GTPC 1AB4A 4C45A 1O26A 5IOTA 4P5BA 3GIRA 2FQTA 5IP7C 3T01A 1XXCA 4G0WA 1WSRA 4A93C 3JSTA 1K83C 2YU9C 1I3QA 2JA6K 2NVYC 3S1RC 2R93A 4KDDA 3AH5A 1JVIA 1BDFA 4X6AC 2EBBA 4QJVB 3CQZA 1I6VA 4QIWD 3A8IA 3CF5S 3H3VD 1SFOK 3H0GA 4A3IC 3TFIA 3M4OC 3FOEA 4C3HC 2JA5A 2ZJQS 1Y1WK 4GZYA 3GTOA 4OIRA 4ILDA 3HKZD 3VA7A 3GTMC 1O2FB 3HOVC 2VUMK 1YCLA 4BBSC 3GTJA 2A69A 1O27A 1TWCK 3HOWC 5IYDK 4KC6A 2E2JK 1TWAK 1TWHA 2GAHC 3EQLA 5FLMC 1XXBA 2Y3PA 1WCMK 3GEIA 4XCHA 1PJ7A 1Y1VC 3Q3QA 4LQYA 2XCOA 2L5NA 4KB2A 3S15K 3BP3A 5M3MK 1IQ0A 2E2HC 4PABA 1J6VA 3FKIA 4G7HA 4FZBA 3G4CA 1VLOA 4KM8A 4KASA 4LK0A 2JA7C 4LJZA 4GTCA 3HXAA 2NVTC 4LK1A 3BP8C 3T00A 3A8KA 4C3JK 2GSUA 4ZH4A 5TMFA 3CAGA 3S16K 3S17K 4Y7NK 4A3CK 5FJ8K 3WODA 4OINA 1F9NA 3GTKK 1K83A 3RZDK 2YU9A 1I50K 5JVGS 3PO3K 2NVYA 2E2IK 2RGRA 3S1QK 1VH2A 5DM6S 5TMCA 3PIPS 2KPUA 4QIWL 1IBAA 4FM9A 3S2DC 4A3LK 4OIPA 1WOPA 1BJTA 1SMYA 1TWGK 1ZVUA 1FEUA 1ZQ1C 4A3FC 5IORA 2R7ZC 3CQZC 2R92K 3GTMA 1C0AA 5IYBK 5C44C 3HKZL 4C2MC 1HQMA 4GFQA 4A3JC 1L0WA 3S1MC 4YFNA 4BBRK 1INNA 4O2DA 4WFNS 2ZJRS 2JA8C 3GTLK 1Y1VA 2A6HA 1WORA 2XCQA 5M3FK 1J98A 4BY1C 3GTJC 1IW7A 3N0CA 1WOSA 1ZBSA 2E2HA 1O2AA 1EI6A 1DCPA 2JA7A 4Y52C 5C4XC 2R93K 3LAPA 1IS1A 5HL8A 1JOEA 4MEXA 2PHCB 3FHZA 3M3YK 4BXXK 1XZQA 4A3EK 3HOYC 4A3KK 2PPBA 2JA5K 1ZXOA 1EQRA 4KMUA 3GTOK 3I4NK 1O28A 4KMAA 4WJ4A 4IO9S 1YX2A 5IYCK 5C4JC 5M5WK 5D4DA 4AYBD 3RZOK 4MQ9A 2KQ1A 4C3IK 2P5MA 1SFOC 4G7ZA 1TWHK 3I4MK 5JVHS 1J6WA 4WJ3M 1GE9A 2R7ZA 4LOWA 5IP9K 5E68A 3S1NC 3V4GA 4KB4A 1EH1A 3L4JA 4U67S 4XSXA 1TWAC 3PO2C 2V6SA 3GTPK 1VGXA 4BY7C 3HOXC 5IP7K 4KATA 3HOZK 1EFWA 2BE5A 2ZUEA 1I6HC 4A93K 1BS2A 2KWAA 3T02A 1K83K 2YU9K 3K7AC 5HL7S 4LR2A 2NVYK 3S1RK 2A6EA 3TFJA 4X6AK 2WB1L 1V5VA 1R9TK 2P8TA 3PIOS 3GEHA 4Y7NC 3M4OK 1PJ6A 3DLLS 4C3HK 2NVQC 4LLGA 5IOSA 2JA6A 2ZUFA 3GTMK 3HOVK 3GTQC 4KARA 4PAAA 1WOOA 3HOWK 1SFOA 4WFAS 5FLMK 5TJ3A 1EK8A 1Y1VK 4RMFA 1Y1WA 4A3MC 1DCHA 1USMA 3N3YA 2V6TA 3H3VL 4OIOA 2E2HK 1WIHA 2CW0A 5JFEA 5C3EC 4Q4ZA 4KAWX 2JA7K 1TWAA 4GT9A 2PA8D 3GTGC 1WCMA 3AD7C 2B63K 3HOUC 2NVTK 1ISEA 5DM7S 1XXAA 4A3DK 3S2HK 2PMZD 2NVXC 4A3GC 1IE0A 2FQOA 2JH3A 3IPJA 2A68A 1RU0A 1DD5A 3S14C 3G4AA 5M5XK 1ZYRA 3LAJA 1TWFC 4Q5SA 3S2DK 4IOCS 1I3QK 3AD9C 4G0VA 2CFAA 4MEYA 1I50A 4A3KC 4M1XA 4A3FK 3AD8C 4GTFA 1XZQB 3CQZK 2W7VA 2Y0SD 1XZPB 5C44K 3GTQA 3ADAC 2WAQD 1XZPA 4C2MK 2KXYA 3LPXA 3H0GK 4GTDA 4J3NA 4P5AA 4A3BK 1HI9A 4A3JK 4WF9S 1WSVA 3S1MK 5EGHA 1PJ5A 1F93A 2JA6C 1O29A 4G0UA 3QX3A 4DDQA 1F7VA 5M5YK 1J6XA 2R92A 4BY1K 4BLAA 3GTJK 3AQPA 3TFHA 1O2BA 4GTAA 3L4KA 4Y52K 3GTGA 4KN7A 1Y1WC 4WILA 5C4XK 1G51A 3GTLA 3MMLB 2VUMC 2NVXA 3FKIK 4GTBA 1TWCC 5IYDC 2PMZL 1JQWA 4XLNA 3HOZC 2E2JC 3HOYK 4KM9A 1WCMC 1BGWA 1VJEA 3S15C 4GTEA 5C4JK 4QJVA 1TWFA 3N0BA 1R9TC 1F7UA 3SZZA 4YFKA 3S1NK 4C3JC 3NUHA 2Y0SL 3S16C 4IOAS 3AQOA 3S17C 2WAQL 4A3IK 4A3CC 4KMDA 3GTKC 2GSNA 3OREA 5IOQA 3RZDC 4G7OA 3SZYA 1I50C 1WQFA 3PO2K 3PO3C 2ZJPS 1UV7A 4WCES 2E2IC 3S1QC 1KQ4A 1B4BA 4BBSK 4BY7K 3HOXK 4XSZA 5HQHA 4A3LC 4AYBL 1DCOA 1WQGA 1I6HK 1VRQC 1TWGC 3K7AK 4JK1A 1IL2A 4KN4A 4GTLA 2R92C 5IYBC 3S0XA 2B63C 3GTPA 2VUMA 4XLPA 3ERED 1TWCA 4A3DC 3S2HC 3BUEA 1XPPA 1O25A 3LYWA 2L3UA 4BBRC 2NVQK 2D6FC 3GTLC 5CHPA 4NOIA 2V6UA 2O5IA 3GTQK 5EGEA 3GSIA 1R9TA 4YFXA 3DXJA 1I3QC 2R93C 3A8JA 1USOA 3OPFA 5L46A 4A3MK 3M3YC 4BXXC
chains in the Genus database with same CATH topology
4Y7NK 4A3EC 4A3CK 2BE5A 3H0GC 1I6HC 5FJ8K 4A93K 3WODA 4OINA 3GTKK 4YG2A 4A3BC 5C3EK 1K83K 3RZDK 2YU9K 1I50K 4Y52K 3K7AC 3PO3K 2JA5C 2NVYK 4KN7A 1Y1WC 5C4XK 3S1RK 3GTGK 2R7ZK 4OIQA 2E2IK 3GTOC 3S1QK 2A6EA 3I4NC 3HOUK 4X6AK 1YNJA 2VUMC 5TMCA 2WB1L 5IYCC 3FKIK 2NVXK 1TWCC 4A3GK 5IYDC 2PMZL 4QIWL 1R9TK 3S2DC 4XLNA 4OIPA 3HOZC 3RZOC 4C3IC 2E2JC 4A3LK 4Y7NC 3HOYK 3M4OK 1TWHC 1SMYA 1TWGK 3I4MC 1WCMC 4C3HK 2JA8K 4ZH4A 2NVQC 4LLGA 4A3FC 3S14K 2R7ZC 5IP9C 3CQZC 2R92K 3GTMK 5IYBK 5C44C 3HKZL 3S15C 4C2MC 3GTQC 3HOVK 2WB1D 5C4JK 2O5JA 4QJVA 3HOWK 1TWFK 3FKIC 1HQMA 4A3JC 1R9TC 3S1MC 4YFNA 5FLMK 4BBRK 2PA8L 2JA8C 3GTLK 1YNNA 3GTPC 1Y1VK 2A6HA 4A3MC 4YFKA 5M3FK 3S1NK 4BY1C 3GTJC 4C3JC 5IP7C 1IW7A 2Y0SL 3S16C 3S17C 2WAQL 4A3IK 3H3VL 4OIOA 4A3CC 2E2HK 2CW0A 4A93C 3GTKC 5C3EC 1K83C 4Q4ZA 3RZDC 1I50C 4Y52C 2YU9C 4G7OA 2JA7K 3PO2K 3PO3C 2PA8D 2JA6K 2NVYC 3S1RC 3GTGC 5C4XC 2R93K 2E2IC 3S1QC 3HOUC 2B63K 2NVTK 4MEXA 1BDFA 4X6AC 4QJVB 4BBSK 4BY7K 3M3YK 1I6VA 3HOXK 3S2HK 4QIWD 4XSZA 2PMZD 4BXXK 2NVXC 4A3DK 4A3GC 3H3VD 3S16K 4A3LC 4AYBL 1SFOK 4A3EK 4A3IC 1I6HK 3HOYC 3M4OC 1TWGC 2A68A 4C3HC 3K7AK 4A3KK 2PPBA 4JK1A 2JA5K 1Y1WK 3S14C 5M5XK 4KN4A 4GZYA 4OIRA 4KMUA 3GTOK 3HKZD 2R92C 3I4NK 3GTMC 5IYBC 2B63C 3HOVC 2VUMK 5IYCK 4XLPA 4BBSC 5C4JC 5M5WK 4A3DC 2A69A 3S2HC 1TWCK 1ZYRA 3HOWC 1TWFC 5D4DA 4AYBD 4Q5SA 3S2DK 3RZOK 4MQ9A 5IYDK 4C3IK 2E2JK 1XPPA 1I3QK 1SFOC 4G7ZA 1TWAK 1TWHK 3EQLA 5FLMC 4BBRC 3I4MK 1WCMK 4MEYA 2NVQK 3GTLC 4A3KC 4A3FK 1Y1VC 4NOIA 5IP9K 2O5IA 3CQZK 2Y0SD 3S1NC 5C44K 3S15K 4C2MK 2WAQD 3GTQK 5M3MK 3H0GK 2E2HC 4G7HA 4A3BK 4A3JK 4YFXA 3DXJA 4LK0A 2JA7C 3S1MK 4XSXA 1I3QC 1TWAC 4LJZA 3PO2C 2JA6C 2R93C 2NVTC 3GTPK 4LK1A 5M5YK 4A3MK 4BY7C 3M3YC 4BXXC 3HOXC 3GTJK 4C3JK 5IP7K 4BY1K 5TMFA 3HOZK 3S17K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N K;  4A3E C;  4A3C K;  2BE5 A;  3H0G C;  1I6H C;  5FJ8 K;  4A93 K;  3WOD A;  4OIN A;  3GTK K;  4YG2 A;  4A3B C;  5C3E K;  1K83 K;  3RZD K;  2YU9 K;  1I50 K;  4Y52 K;  3K7A C;  3PO3 K;  2JA5 C;  2NVY K;  4KN7 A;  1Y1W C;  5C4X K;  3S1R K;  3GTG K;  2R7Z K;  4OIQ A;  2E2I K;  3GTO C;  3S1Q K;  2A6E A;  3I4N C;  3HOU K;  4X6A K;  1YNJ A;  2VUM C;  5TMC A;  2WB1 L;  5IYC C;  3FKI K;  2NVX K;  1TWC C;  4A3G K;  5IYD C;  2PMZ L;  4QIW L;  1R9T K;  3S2D C;  4XLN A;  4OIP A;  3HOZ C;  3RZO C;  4C3I C;  2E2J C;  4A3L K;  4Y7N C;  3HOY K;  3M4O K;  1TWH C;  1SMY A;  1TWG K;  3I4M C;  1WCM C;  4C3H K;  2JA8 K;  4ZH4 A;  2NVQ C;  4LLG A;  4A3F C;  3S14 K;  2R7Z C;  5IP9 C;  3CQZ C;  2R92 K;  3GTM K;  5IYB K;  5C44 C;  3HKZ L;  3S15 C;  4C2M C;  3GTQ C;  3HOV K;  2WB1 D;  5C4J K;  2O5J A;  4QJV A;  3HOW K;  1TWF K;  3FKI C;  1HQM A;  4A3J C;  1R9T C;  3S1M C;  4YFN A;  5FLM K;  4BBR K;  2PA8 L;  2JA8 C;  3GTL K;  1YNN A;  3GTP C;  1Y1V K;  2A6H A;  4A3M C;  4YFK A;  5M3F K;  3S1N K;  4BY1 C;  3GTJ C;  4C3J C;  5IP7 C;  1IW7 A;  2Y0S L;  3S16 C;  3S17 C;  2WAQ L;  4A3I K;  3H3V L;  4OIO A;  4A3C C;  2E2H K;  2CW0 A;  4A93 C;  3GTK C;  5C3E C;  1K83 C;  4Q4Z A;  3RZD C;  1I50 C;  4Y52 C;  2YU9 C;  4G7O A;  2JA7 K;  3PO2 K;  3PO3 C;  2PA8 D;  2JA6 K;  2NVY C;  3S1R C;  3GTG C;  5C4X C;  2R93 K;  2E2I C;  3S1Q C;  3HOU C;  2B63 K;  2NVT K;  4MEX A;  1BDF A;  4X6A C;  4QJV B;  4BBS K;  4BY7 K;  3M3Y K;  1I6V A;  3HOX K;  3S2H K;  4QIW D;  4XSZ A;  2PMZ D;  4BXX K;  2NVX C;  4A3D K;  4A3G C;  3H3V D;  3S16 K;  4A3L C;  4AYB L;  1SFO K;  4A3E K;  4A3I C;  1I6H K;  3HOY C;  3M4O C;  1TWG C;  2A68 A;  4C3H C;  3K7A K;  4A3K K;  2PPB A;  4JK1 A;  2JA5 K;  1Y1W K;  3S14 C;  5M5X K;  4KN4 A;  4GZY A;  4OIR A;  4KMU A;  3GTO K;  3HKZ D;  2R92 C;  3I4N K;  3GTM C;  5IYB C;  2B63 C;  3HOV C;  2VUM K;  5IYC K;  4XLP A;  4BBS C;  5C4J C;  5M5W K;  4A3D C;  2A69 A;  3S2H C;  1TWC K;  1ZYR A;  3HOW C;  1TWF C;  5D4D A;  4AYB D;  4Q5S A;  3S2D K;  3RZO K;  4MQ9 A;  5IYD K;  4C3I K;  2E2J K;  1XPP A;  1I3Q K;  1SFO C;  4G7Z A;  1TWA K;  1TWH K;  3EQL A;  5FLM C;  4BBR C;  3I4M K;  1WCM K;  4MEY A;  2NVQ K;  3GTL C;  4A3K C;  4A3F K;  1Y1V C;  4NOI A;  5IP9 K;  2O5I A;  3CQZ K;  2Y0S D;  3S1N C;  5C44 K;  3S15 K;  4C2M K;  2WAQ D;  3GTQ K;  5M3M K;  3H0G K;  2E2H C;  4G7H A;  4A3B K;  4A3J K;  4YFX A;  3DXJ A;  4LK0 A;  2JA7 C;  3S1M K;  4XSX A;  1I3Q C;  1TWA C;  4LJZ A;  3PO2 C;  2JA6 C;  2R93 C;  2NVT C;  3GTP K;  4LK1 A;  5M5Y K;  4A3M K;  4BY7 C;  3M3Y C;  4BXX C;  3HOX C;  3GTJ K;  4C3J K;  5IP7 K;  4BY1 K;  5TMF A;  3HOZ K;  3S17 K; 
#chains in the Genus database with same CATH topology
 4A3E C;  2CFA B;  1WQH A;  3H0G C;  3GTK A;  4YG2 A;  4A3B C;  3GDZ A;  3GEE A;  5C3E K;  4BLB A;  2JA5 C;  2R7Z K;  3GTG K;  2GSO A;  2E2I A;  4OIQ A;  2GAG C;  4WFB S;  3GTO C;  4P9S A;  4BKW A;  3I4N C;  3HOU K;  2RH6 A;  1YNJ A;  5IYC C;  4KMH A;  2NVX K;  4A3G K;  3RZO C;  3OEP A;  4C3I C;  1TWG A;  1TWH C;  3I4M C;  2JA8 K;  1O24 A;  3S14 K;  5IP9 C;  1X31 C;  2B63 A;  2WB1 D;  4AH6 A;  5JVO A;  3FOF A;  2O5J A;  3TTG A;  2ZFZ A;  1TWF K;  3FKI C;  2XCR B;  1B4A A;  5CJ9 A;  2PA8 L;  1YNN A;  3GTP C;  1AB4 A;  4C45 A;  1O26 A;  5IOT A;  4P5B A;  3GIR A;  2FQT A;  5IP7 C;  3T01 A;  1XXC A;  4G0W A;  1WSR A;  4A93 C;  3JST A;  1K83 C;  2YU9 C;  1I3Q A;  2JA6 K;  2NVY C;  3S1R C;  2R93 A;  4KDD A;  3AH5 A;  1JVI A;  1BDF A;  4X6A C;  2EBB A;  4QJV B;  3CQZ A;  1I6V A;  4QIW D;  3A8I A;  3CF5 S;  3H3V D;  1SFO K;  3H0G A;  4A3I C;  3TFI A;  3M4O C;  3FOE A;  4C3H C;  2JA5 A;  2ZJQ S;  1Y1W K;  4GZY A;  3GTO A;  4OIR A;  4ILD A;  3HKZ D;  3VA7 A;  3GTM C;  1O2F B;  3HOV C;  2VUM K;  1YCL A;  4BBS C;  3GTJ A;  2A69 A;  1O27 A;  1TWC K;  3HOW C;  5IYD K;  4KC6 A;  2E2J K;  1TWA K;  1TWH A;  2GAH C;  3EQL A;  5FLM C;  1XXB A;  2Y3P A;  1WCM K;  3GEI A;  4XCH A;  1PJ7 A;  1Y1V C;  3Q3Q A;  4LQY A;  2XCO A;  2L5N A;  4KB2 A;  3S15 K;  3BP3 A;  5M3M K;  1IQ0 A;  2E2H C;  4PAB A;  1J6V A;  3FKI A;  4G7H A;  4FZB A;  3G4C A;  1VLO A;  4KM8 A;  4KAS A;  4LK0 A;  2JA7 C;  4LJZ A;  4GTC A;  3HXA A;  2NVT C;  4LK1 A;  3BP8 C;  3T00 A;  3A8K A;  4C3J K;  2GSU A;  4ZH4 A;  5TMF A;  3CAG A;  3S16 K;  3S17 K;  4Y7N K;  4A3C K;  5FJ8 K;  3WOD A;  4OIN A;  1F9N A;  3GTK K;  1K83 A;  3RZD K;  2YU9 A;  1I50 K;  5JVG S;  3PO3 K;  2NVY A;  2E2I K;  2RGR A;  3S1Q K;  1VH2 A;  5DM6 S;  5TMC A;  3PIP S;  2KPU A;  4QIW L;  1IBA A;  4FM9 A;  3S2D C;  4A3L K;  4OIP A;  1WOP A;  1BJT A;  1SMY A;  1TWG K;  1ZVU A;  1FEU A;  1ZQ1 C;  4A3F C;  5IOR A;  2R7Z C;  3CQZ C;  2R92 K;  3GTM A;  1C0A A;  5IYB K;  5C44 C;  3HKZ L;  4C2M C;  1HQM A;  4GFQ A;  4A3J C;  1L0W A;  3S1M C;  4YFN A;  4BBR K;  1INN A;  4O2D A;  4WFN S;  2ZJR S;  2JA8 C;  3GTL K;  1Y1V A;  2A6H A;  1WOR A;  2XCQ A;  5M3F K;  1J98 A;  4BY1 C;  3GTJ C;  1IW7 A;  3N0C A;  1WOS A;  1ZBS A;  2E2H A;  1O2A A;  1EI6 A;  1DCP A;  2JA7 A;  4Y52 C;  5C4X C;  2R93 K;  3LAP A;  1IS1 A;  5HL8 A;  1JOE A;  4MEX A;  2PHC B;  3FHZ A;  3M3Y K;  4BXX K;  1XZQ A;  4A3E K;  3HOY C;  4A3K K;  2PPB A;  2JA5 K;  1ZXO A;  1EQR A;  4KMU A;  3GTO K;  3I4N K;  1O28 A;  4KMA A;  4WJ4 A;  4IO9 S;  1YX2 A;  5IYC K;  5C4J C;  5M5W K;  5D4D A;  4AYB D;  3RZO K;  4MQ9 A;  2KQ1 A;  4C3I K;  2P5M A;  1SFO C;  4G7Z A;  1TWH K;  3I4M K;  5JVH S;  1J6W A;  4WJ3 M;  1GE9 A;  2R7Z A;  4LOW A;  5IP9 K;  5E68 A;  3S1N C;  3V4G A;  4KB4 A;  1EH1 A;  3L4J A;  4U67 S;  4XSX A;  1TWA C;  3PO2 C;  2V6S A;  3GTP K;  1VGX A;  4BY7 C;  3HOX C;  5IP7 K;  4KAT A;  3HOZ K;  1EFW A;  2BE5 A;  2ZUE A;  1I6H C;  4A93 K;  1BS2 A;  2KWA A;  3T02 A;  1K83 K;  2YU9 K;  3K7A C;  5HL7 S;  4LR2 A;  2NVY K;  3S1R K;  2A6E A;  3TFJ A;  4X6A K;  2WB1 L;  1V5V A;  1R9T K;  2P8T A;  3PIO S;  3GEH A;  4Y7N C;  3M4O K;  1PJ6 A;  3DLL S;  4C3H K;  2NVQ C;  4LLG A;  5IOS A;  2JA6 A;  2ZUF A;  3GTM K;  3HOV K;  3GTQ C;  4KAR A;  4PAA A;  1WOO A;  3HOW K;  1SFO A;  4WFA S;  5FLM K;  5TJ3 A;  1EK8 A;  1Y1V K;  4RMF A;  1Y1W A;  4A3M C;  1DCH A;  1USM A;  3N3Y A;  2V6T A;  3H3V L;  4OIO A;  2E2H K;  1WIH A;  2CW0 A;  5JFE A;  5C3E C;  4Q4Z A;  4KAW X;  2JA7 K;  1TWA A;  4GT9 A;  2PA8 D;  3GTG C;  1WCM A;  3AD7 C;  2B63 K;  3HOU C;  2NVT K;  1ISE A;  5DM7 S;  1XXA A;  4A3D K;  3S2H K;  2PMZ D;  2NVX C;  4A3G C;  1IE0 A;  2FQO A;  2JH3 A;  3IPJ A;  2A68 A;  1RU0 A;  1DD5 A;  3S14 C;  3G4A A;  5M5X K;  1ZYR A;  3LAJ A;  1TWF C;  4Q5S A;  3S2D K;  4IOC S;  1I3Q K;  3AD9 C;  4G0V A;  2CFA A;  4MEY A;  1I50 A;  4A3K C;  4M1X A;  4A3F K;  3AD8 C;  4GTF A;  1XZQ B;  3CQZ K;  2W7V A;  2Y0S D;  1XZP B;  5C44 K;  3GTQ A;  3ADA C;  2WAQ D;  1XZP A;  4C2M K;  2KXY A;  3LPX A;  3H0G K;  4GTD A;  4J3N A;  4P5A A;  4A3B K;  1HI9 A;  4A3J K;  4WF9 S;  1WSV A;  3S1M K;  5EGH A;  1PJ5 A;  1F93 A;  2JA6 C;  1O29 A;  4G0U A;  3QX3 A;  4DDQ A;  1F7V A;  5M5Y K;  1J6X A;  2R92 A;  4BY1 K;  4BLA A;  3GTJ K;  3AQP A;  3TFH A;  1O2B A;  4GTA A;  3L4K A;  4Y52 K;  3GTG A;  4KN7 A;  1Y1W C;  4WIL A;  5C4X K;  1G51 A;  3GTL A;  3MML B;  2VUM C;  2NVX A;  3FKI K;  4GTB A;  1TWC C;  5IYD C;  2PMZ L;  1JQW A;  4XLN A;  3HOZ C;  2E2J C;  3HOY K;  4KM9 A;  1WCM C;  1BGW A;  1VJE A;  3S15 C;  4GTE A;  5C4J K;  4QJV A;  1TWF A;  3N0B A;  1R9T C;  1F7U A;  3SZZ A;  4YFK A;  3S1N K;  4C3J C;  3NUH A;  2Y0S L;  3S16 C;  4IOA S;  3AQO A;  3S17 C;  2WAQ L;  4A3I K;  4A3C C;  4KMD A;  3GTK C;  2GSN A;  3ORE A;  5IOQ A;  3RZD C;  4G7O A;  3SZY A;  1I50 C;  1WQF A;  3PO2 K;  3PO3 C;  2ZJP S;  1UV7 A;  4WCE S;  2E2I C;  3S1Q C;  1KQ4 A;  1B4B A;  4BBS K;  4BY7 K;  3HOX K;  4XSZ A;  5HQH A;  4A3L C;  4AYB L;  1DCO A;  1WQG A;  1I6H K;  1VRQ C;  1TWG C;  3K7A K;  4JK1 A;  1IL2 A;  4KN4 A;  4GTL A;  2R92 C;  5IYB C;  3S0X A;  2B63 C;  3GTP A;  2VUM A;  4XLP A;  3ERE D;  1TWC A;  4A3D C;  3S2H C;  3BUE A;  1XPP A;  1O25 A;  3LYW A;  2L3U A;  4BBR C;  2NVQ K;  2D6F C;  3GTL C;  5CHP A;  4NOI A;  2V6U A;  2O5I A;  3GTQ K;  5EGE A;  3GSI A;  1R9T A;  4YFX A;  3DXJ A;  1I3Q C;  2R93 C;  3A8J A;  1USO A;  3OPF A;  5L46 A;  4A3M K;  3M3Y C;  4BXX C; 
#chains in the Genus database with same CATH homology
 4Y7N K;  4A3E C;  4A3C K;  2BE5 A;  3H0G C;  1I6H C;  5FJ8 K;  4A93 K;  3WOD A;  4OIN A;  3GTK K;  4YG2 A;  4A3B C;  5C3E K;  1K83 K;  3RZD K;  2YU9 K;  1I50 K;  4Y52 K;  3K7A C;  3PO3 K;  2JA5 C;  2NVY K;  4KN7 A;  1Y1W C;  5C4X K;  3S1R K;  3GTG K;  2R7Z K;  4OIQ A;  2E2I K;  3GTO C;  3S1Q K;  2A6E A;  3I4N C;  3HOU K;  4X6A K;  1YNJ A;  2VUM C;  5TMC A;  2WB1 L;  5IYC C;  3FKI K;  2NVX K;  1TWC C;  4A3G K;  5IYD C;  2PMZ L;  4QIW L;  1R9T K;  3S2D C;  4XLN A;  4OIP A;  3HOZ C;  3RZO C;  4C3I C;  2E2J C;  4A3L K;  4Y7N C;  3HOY K;  3M4O K;  1TWH C;  1SMY A;  1TWG K;  3I4M C;  1WCM C;  4C3H K;  2JA8 K;  4ZH4 A;  2NVQ C;  4LLG A;  4A3F C;  3S14 K;  2R7Z C;  5IP9 C;  3CQZ C;  2R92 K;  3GTM K;  5IYB K;  5C44 C;  3HKZ L;  3S15 C;  4C2M C;  3GTQ C;  3HOV K;  2WB1 D;  5C4J K;  2O5J A;  4QJV A;  3HOW K;  1TWF K;  3FKI C;  1HQM A;  4A3J C;  1R9T C;  3S1M C;  4YFN A;  5FLM K;  4BBR K;  2PA8 L;  2JA8 C;  3GTL K;  1YNN A;  3GTP C;  1Y1V K;  2A6H A;  4A3M C;  4YFK A;  5M3F K;  3S1N K;  4BY1 C;  3GTJ C;  4C3J C;  5IP7 C;  1IW7 A;  2Y0S L;  3S16 C;  3S17 C;  2WAQ L;  4A3I K;  3H3V L;  4OIO A;  4A3C C;  2E2H K;  2CW0 A;  4A93 C;  3GTK C;  5C3E C;  1K83 C;  4Q4Z A;  3RZD C;  1I50 C;  4Y52 C;  2YU9 C;  4G7O A;  2JA7 K;  3PO2 K;  3PO3 C;  2PA8 D;  2JA6 K;  2NVY C;  3S1R C;  3GTG C;  5C4X C;  2R93 K;  2E2I C;  3S1Q C;  3HOU C;  2B63 K;  2NVT K;  4MEX A;  1BDF A;  4X6A C;  4QJV B;  4BBS K;  4BY7 K;  3M3Y K;  1I6V A;  3HOX K;  3S2H K;  4QIW D;  4XSZ A;  2PMZ D;  4BXX K;  2NVX C;  4A3D K;  4A3G C;  3H3V D;  3S16 K;  4A3L C;  4AYB L;  1SFO K;  4A3E K;  4A3I C;  1I6H K;  3HOY C;  3M4O C;  1TWG C;  2A68 A;  4C3H C;  3K7A K;  4A3K K;  2PPB A;  4JK1 A;  2JA5 K;  1Y1W K;  3S14 C;  5M5X K;  4KN4 A;  4GZY A;  4OIR A;  4KMU A;  3GTO K;  3HKZ D;  2R92 C;  3I4N K;  3GTM C;  5IYB C;  2B63 C;  3HOV C;  2VUM K;  5IYC K;  4XLP A;  4BBS C;  5C4J C;  5M5W K;  4A3D C;  2A69 A;  3S2H C;  1TWC K;  1ZYR A;  3HOW C;  1TWF C;  5D4D A;  4AYB D;  4Q5S A;  3S2D K;  3RZO K;  4MQ9 A;  5IYD K;  4C3I K;  2E2J K;  1XPP A;  1I3Q K;  1SFO C;  4G7Z A;  1TWA K;  1TWH K;  3EQL A;  5FLM C;  4BBR C;  3I4M K;  1WCM K;  4MEY A;  2NVQ K;  3GTL C;  4A3K C;  4A3F K;  1Y1V C;  4NOI A;  5IP9 K;  2O5I A;  3CQZ K;  2Y0S D;  3S1N C;  5C44 K;  3S15 K;  4C2M K;  2WAQ D;  3GTQ K;  5M3M K;  3H0G K;  2E2H C;  4G7H A;  4A3B K;  4A3J K;  4YFX A;  3DXJ A;  4LK0 A;  2JA7 C;  3S1M K;  4XSX A;  1I3Q C;  1TWA C;  4LJZ A;  3PO2 C;  2JA6 C;  2R93 C;  2NVT C;  3GTP K;  4LK1 A;  5M5Y K;  4A3M K;  4BY7 C;  3M3Y C;  4BXX C;  3HOX C;  3GTJ K;  4C3J K;  5IP7 K;  4BY1 K;  5TMF A;  3HOZ K;  3S17 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...